Antigen-Binding Domain

20240252534 · 2024-08-01

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure relates to antigen-binding domains which bind the antigen prostate-specific membrane antigen (PSMA) and to chimeric antigen receptors (CARs) which comprise such antigen binding domains.

    Claims

    1. An antigen-binding domain which binds prostate-specific membrane antigen (PSMA) and comprises either: (a) a heavy chain variable region (VH) having complementarity determining regions (CDRs): HCDR1, HCDR2 and HCDR3; and a light chain variable region (VL) having CDRs: LCDR1, LCDR2 and LCDR3 selected from the following: (i) HCDR1SEQ ID No. 1; HCDR2SEQ ID No. 2; HCDR3SEQ ID No. 3; LCDR1SEQ ID No. 4; LCDR2SEQ ID No. 5; LCDR3SEQ ID No. 6; (ii) HCDR1SEQ ID No. 9; HCDR2SEQ ID No. 10; HCDR3SEQ ID No. 11; LCDR1SEQ ID No. 12; LCDR2SEQ ID No. 13; LCDR3SEQ ID No. 14; (iii) HCDR1SEQ ID No. 17; HCDR2SEQ ID No. 18; HCDR3SEQ ID No. 19; LCDR1SEQ ID No. 20; LCDR2SEQ ID No. 21; LCDR3SEQ ID No. 22; (iv) HCDR1SEQ ID No. 25; HCDR2SEQ ID No. 26; HCDR3SEQ ID No. 27; LCDR1SEQ ID No. 28; LCDR2SEQ ID No. 29; LCDR3SEQ ID No. 30; (v) HCDR1SEQ ID No. 33; HCDR2SEQ ID No. 34; HCDR3SEQ ID No. 35; LCDR1SEQ ID No. 36; LCDR2SEQ ID No. 37; LCDR3SEQ ID No. 38; (vi) HCDR1SEQ ID No. 41; HCDR2SEQ ID No. 42; HCDR3SEQ ID No. 43; LCDR1SEQ ID No. 44; LCDR2SEQ ID No. 45; LCDR3SEQ ID No. 46; and (vii) HCDR1SEQ ID No. 49; HCDR2SEQ ID No. 50; HCDR3SEQ ID No. 51; LCDR1SEQ ID No. 52; LCDR2SEQ ID No. 53; LCDR3SEQ ID No. 54; or (b) a domain antibody variable region having complementarity determining regions (CDRs): VHHCDR1, VHHCDR2 and VHHCDR3 selected from the following: (i) VHHCDR1SEQ ID No. 57; VHHCDR2SEQ ID No. 58; VHHCDR3SEQ ID No. 59; (ii) VHHCDR1SEQ ID No. 61; VHHCDR2SEQ ID No. 62; VHHCDR3SEQ ID No. 63; (iii) VHHCDR1SEQ ID No. 65; VHHCDR2SEQ ID No. 66; VHHCDR3SEQ ID No. 67; (iv) VHHCDR1SEQ ID No. 69; VHHCDR2SEQ ID No. 70; VHHCDR3SEQ ID No. 71; and (v) VHHCDR1SEQ ID No. 73; VHHCDR2SEQ ID No. 74; VHHCDR3SEQ ID No. 75.

    2. An antigen-binding domain according to claim 1, which comprises either: (a) a heavy chain variable region (VH); and a light chain variable region (VL) selected from the following: (i) VHSEQ ID No. 7, VLSEQ ID No. 8; (ii) VHSEQ ID No. 15, VLSEQ ID No. 16; (iii) VHSEQ ID No. 23, VLSEQ ID No. 24; (iv) VHSEQ ID No. 31, VLSEQ ID No. 32; (v) VHSEQ ID No. 39, VLSEQ ID No. 40; (vi) VHSEQ ID No. 47, VLSEQ ID No. 48; and (vii) VHSEQ ID No. 55, VLSEQ ID No. 56; or (b) a domain antibody variable region selected from the following: (i) SEQ ID No. 60; (ii) SEQ ID No. 64; (iii) SEQ ID No. 68; (iv) SEQ ID No. 72; and (v) SEQ ID No. 76.

    3. A chimeric antigen receptor (CAR) comprising an antigen-binding domain according to claim 1.

    4. A nucleic acid sequence which encodes an antigen-binding domain according to claim 1.

    5. A nucleic acid construct which comprises a nucleic acid sequence according to claim 4 and a nucleic acid sequence which encodes a suicide gene.

    6. A vector which comprises a nucleic acid sequence according to claim 4.

    7. A cell which expresses a CAR according to claim 3.

    8. A method for making a cell according to claim 7, which comprises the step of introducing a nucleic acid sequence which encodes a CAR according to claim 3 into a cell ex vivo.

    9. A pharmaceutical composition which comprises a plurality of cells according to claim 7, together with a pharmaceutically acceptable carrier, diluent or excipient.

    10. A method for treating cancer which comprises the step of administering a cell according to claim 7 to a subject.

    11. (canceled)

    12. (canceled)

    Description

    DESCRIPTION OF THE FIGURES

    [0009] FIG. 1Chimeric Antigen Receptor (CAR) design.

    [0010] (a) generalized architecture of a CAR: A binding domain recognizes antigen; the spacer elevates the binding domain from the cell surface; the trans-membrane domain anchors the protein to the membrane and the endodomain transmits signals. (b) to (d): Different generations and permutations of CAR endodomains: (b) initial designs transmitted ITAM signals alone through Fc?R1-? or CD3? endodomain, while later designs transmitted additional (c) one or (d) two co-stimulatory signals in cis.

    [0011] FIG. 2Structure of prostate-specific membrane antigen.

    [0012] Prostate-specific membrane antigen is a 750 amino acid class II membrane glycoprotein. The cytoplasmic (cytosolic) domain is residues 1-19; the signal-anchor for type II membrane proteins is residues 20-43; and the extracellular domain is residues 44-750. The extracellular domain is comprised of protease, apical and C-terminal domains.

    [0013] FIG. 3Different binding domain formats of chimeric antigen receptors (a) Fab CAR format; (b) dAb CAR format; (c) scFv CAR format

    [0014] FIG. 4ELISA assay of clonal phage and scFv cultures

    [0015] ELISA assay of clonal phage and scFv cultures in replicate after initial screening (n=3) on recombinant protein ELISA assay.

    [0016] FIG. 5Titration and enrichment of specific phage populations

    [0017] (a) Titration and enrichment of specific phage populations after panning rounds 1 and 2 from recombinant human PSMA protein (Acro Biosystems) panning only; (b) titration and enrichment of phage after 1 round of recombinant protein panning and 1 round of cell panning against SupT1 cells expressing PSMA.

    [0018] FIG. 6ELISA screening of monoclonal C Myc tagged dAbs

    [0019] ELISA screening of monoclonal C Myc tagged dAbs expressed by TG1 colonies from titration plates after cell panning. Expression was carried out by IPTG induction and screening was performed against recombinant human PSMA. Detection was performed using anti-C Myc tag HRP conjugate.

    [0020] FIG. 7ELISA screening of monoclonal C Myc tagged dAbs

    [0021] Flow cytometry analysis of anti PSMA dAbs binding to SupT1 cells non-transduced or transduced with High (clone 30) or low (clone 83) PSMA expression. dAb clones B8 and G7 show high levels of specific binding.

    [0022] FIG. 8

    [0023] Flow cytometry analysis of Fc tagged dAbs as represented in FIG. 7.

    [0024] FIG. 9

    [0025] Flow cytometry analysis of NGS identified dAb sequence binding to PSMA expressing cell lines. dAbs 2 and 25 showed high binding to the appropriate cell lines.

    [0026] FIG. 10

    [0027] IHC staining of PSMA expressing cell lines using cell panning and NGS derived dAbs. Data suggests that clones 2 and 25 from NGS show comparable staining to positive controls (J591 and 7A12 antibodies).

    [0028] FIG. 11FACS-based killing assay

    [0029] SupT1 cells engineered to express human PSMA antigen (SupT1-PSMA) were used as target cells. Non-engineered SupT1 cells (SupT1-NT) were used as a negative control. T-cells were co-cultured with target cells at 1:1, 1:4, and 1:8 effector to target ratios. FBK was assayed after 24 h of incubation and analysed by cytofluorimetry analysis

    [0030] FIG. 12Cytokine release assay

    [0031] Secretion of IL-2 (top) and IFN? (bottom) by CAR T-cells was measured by collecting supernatant at 24 hr from the co-cultures of CAR-T cells and SupT1 cells engineered to express human PSMA antigen (SupT1-PSMA) with non-engineered SupT1 cells (SupT1-NT) as a negative control. T-cells were co-cultured with target cells at 1:1, 1:4, and 1:8 effector to target ratios. Production of IL-2 and IFN? was detected by ELISA.

    SUMMARY OF ASPECTS OF THE INVENTION

    [0032] The present inventors have identified and characterised new PSMA binding domains with improved properties.

    [0033] Thus, in a first aspect, the present invention provides an antigen-binding domain which binds prostate-specific membrane antigen and comprises either: [0034] (a) a heavy chain variable region (VH) having complementarity determining regions (CDRs): HCDR1, HCDR2 and HCDR3; and a light chain variable region (VL) having CDRs: LCDR1, LCDR2 and LCDR3 selected from the following: 30 [0035] (i) HCDR1SEQ ID No. 1; HCDR2SEQ ID No. 2; HCDR3SEQ ID No. 3; LCDR1SEQ ID No. 4; LCDR2SEQ ID No. 5; LCDR3SEQ ID No. 6; [0036] (ii) HCDR1SEQ ID No. 9; HCDR2SEQ ID No. 10; HCDR3SEQ ID No. 11; LCDR1SEQ ID No. 12; LCDR2SEQ ID No. 13; LCDR3SEQ ID No. 14; [0037] (iii) HCDR1SEQ ID No. 17; HCDR2SEQ ID No. 18; HCDR3SEQ ID No. 19; LCDR1SEQ ID No. 20; LCDR2SEQ ID No. 21; LCDR3SEQ ID No. 22; [0038] (iv) HCDR1SEQ ID No. 25; HCDR2SEQ ID No. 26; HCDR3SEQ ID No. 27; LCDR1SEQ ID No. 28; LCDR2SEQ ID No. 29; LCDR3SEQ ID No. 30; or [0039] (b) a domain antibody variable region having complementarity determining regions (CDRs): VHHCDR1, VHHCDR2 and VHHCDR3 selected from the following: [0040] (i) VHHCDR1SEQ ID No. 33; VHHCDR2SEQ ID No. 34; VHHCDR3SEQ ID No. 35; [0041] (ii) VHHCDR1SEQ ID No. 37; VHHCDR2SEQ ID No. 38; VHHCDR3SEQ ID No. 39; [0042] (iii) VHHCDR1SEQ ID No. 41; VHHCDR2SEQ ID No. 42; VHHCDR3SEQ ID No. 43;

    [0043] (iv) VHHCDR1SEQ ID No. 45; VHHCDR2SEQ ID No. 46; VHHCDR3SEQ ID No. 47; and

    [0044] (v) VHHCDR1SEQ ID No. 49; VHHCDR2SEQ ID No. 50; VHHCDR3SEQ ID No. 51.

    [0045] The antigen-binding domain may, for example, comprise either:

    [0046] (a) a heavy chain variable region (VH); and a light chain variable region (VL) selected from the following: [0047] (i) VHSEQ ID No. 7, VLSEQ ID No. 8; [0048] (ii) VHSEQ ID No. 15, VLSEQ ID No. 16; [0049] (iii) VHSEQ ID No. 23, VLSEQ ID No. 24; and [0050] (iv) VHSEQ ID No. 31, VLSEQ ID No. 32; or [0051] (b) a domain antibody variable region selected from the following: [0052] (i) SEQ ID No. 36; [0053] (ii) SEQ ID No. 40; [0054] (iii) SEQ ID No. 44; [0055] (iv) SEQ ID No. 48; and [0056] (v) SEQ ID No. 52.

    [0057] In a second aspect, the present invention provides a chimeric antigen receptor (CAR) comprising an antigen-binding domain according to the first aspect of the invention.

    [0058] In a third aspect, the present invention provides nucleic acid sequence which encodes an antigen-binding domain according to the first aspect of the invention or a CAR according to the second aspect of the invention.

    [0059] In a fourth aspect, the present invention provides nucleic acid construct which comprises a nucleic acid sequence according to the third aspect of the invention and a nucleic acid sequence which encodes a suicide gene.

    [0060] In a fifth aspect, the present invention provides vector which comprises a nucleic acid sequence according to the third aspect of the invention or a nucleic acid construct according to the fourth aspect of the invention.

    [0061] In a sixth aspect, the present invention provides cell which expresses a CAR according to the second aspect of the invention.

    [0062] In a seventh aspect, the present invention provides a method for making a cell according to the sixth aspect of the invention, which comprises the step of introducing a nucleic acid sequence which encodes a CAR according to the second aspect of the invention into a cell ex vivo.

    [0063] In an eighth aspect, the present invention provides a pharmaceutical composition which comprises a plurality of cells according to the sixth aspect of the invention, together with a pharmaceutically acceptable carrier, diluent or excipient.

    [0064] In a ninth aspect, the present invention provides method for treating cancer which comprises the step of administering a cell according to the sixth aspect of the invention to a subject.

    [0065] In a tenth aspect, the present invention provides cell according to the sixth aspect of the invention for use in treating a cancer.

    [0066] In an eleventh aspect, the present invention provides use of a cell according to the sixth aspect of the invention in the manufacture of a medicament for treating cancer.

    DETAILED DESCRIPTION

    Antigen-Binding Domain

    [0067] The antigen-binding domain of the present invention is an antibody-based binding domain which specifically binds the target antigen PSMA.

    [0068] The antigen-binding domain of an antibody, such as an IgG molecule, is made up of two variable domains, one derived from the heavy chain (VH) and one derived from the light chain (VL). Some of the antigen-binding domains of the present invention comprise both VH and VL domains.

    [0069] Antigen binding domains of the present invention comprising a VH and a VL domain may, for example, be in a single-chain variable fragment (scFv) or Fab format. A CAR of the present invention may comprise such as scFv or Fab based antigen binding domain, as illustrated in FIGS. 3a (Fab) and 3c (scFv).

    [0070] The antigen-binding domain may comprise a VH domain having complementarity determining regions (CDRs): HCDR1, HCDR2 and HCDR3; and a VL domain having CDRs: LCDR1, LCDR2 and LCDR3 selected from the following: [0071] (i) HCDR1SEQ ID No. 1; HCDR2SEQ ID No. 2; HCDR3SEQ ID No. 3; LCDR1SEQ ID No. 4; LCDR2SEQ ID No. 5; LCDR3SEQ ID No. 6; [0072] (ii) HCDR1SEQ ID No. 9; HCDR2SEQ ID No. 10; HCDR3SEQ ID No. 11; LCDR1SEQ ID No. 12; LCDR2SEQ ID No. 13; LCDR3SEQ ID No. 14; [0073] (iii) HCDR1SEQ ID No. 17; HCDR2SEQ ID No. 18; HCDR3SEQ ID No. 19; LCDR1SEQ ID No. 20; LCDR2SEQ ID No. 21; LCDR3SEQ ID No. 22; and [0074] (iv) HCDR1SEQ ID No. 25; HCDR2SEQ ID No. 26; HCDR3SEQ ID No. 27; LCDR1SEQ ID No. 28; LCDR2SEQ ID No. 29; LCDR3SEQ ID No. 30; or

    [0075] The positions of CDRs in a sequence may be determined by different numbering schemes, for example Kabat and IMGT. In the present application the Kabat numbering system is used unless otherwise indicated.

    [0076] The antigen-binding domain may comprise one of the following pairs of VH/VL domains:

    TABLE-US-00001 (i) SEQIDNo.7 VH-, SEQIDNo.8 VL-; (ii) SEQIDNo.15 VH-, SEQIDNo.16 VL-; (iii) SEQIDNo.23 VH-, SEQIDNo.24 VL-; and (iv) SEQIDNo.31 VH-, SEQIDNo.32 VL-;. (7A12HCDR1) SEQIDNo.1 SSWMN (7A12HCDR2) SEQIDNo.2 RIYPGDGDTTYNGNFKD (7A12HCDR3) SEQIDNo.3 GTGYLWYFDV (7A12LCDR1) SEQIDNo.4 KASQDINENVA (7A12LCDR2) SEQIDNo.5 YTSALQS (7A12LCDR3) SEQIDNo.6 QQYDNLPFT (7A12VH) SEQIDNo.7 QFQLQQSGPELVKPGASVKISCKASGYAFSSSWMNWVRQRPGKGLEWIGR IYPGDGDTTYNGNFKDKATLTAAKSSSTAYIQINSLTSEDSAVYFCARGT GYLWYFDVWGAGTTVTVSS (7A12VL) SEQIDNo.8 DIQMTQSPSSLSTSLGGKVTITCKASQDINENVAWYQHKPGKGPRLLIWY TSALQSGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCQQYDNLPFTFGS GTKLEIKR (hu7A12HCDR1) SEQIDNo.9 SSWMN (hu7A12HCDR2) SEQIDNo.10 RIYPGDGDTNYAQKFQG (hu7A12HCDR3) SEQIDNo.11 GTGYLWYFDV (hu7A12LCDR1) SEQIDNo.12 RASQDINENLA (hu7A12LCDR2) SEQIDNo.13 YTSNRAT (hu7A12LCDR3) SEQIDNo.14 QQYDNLPFT (hu7A12VH) SEQIDNo.15 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSSWMNWVRQAPGQGLEWMGR IYPGDGDTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGT GYLWYFDVWGQGTMVTVSS (hu7A12VL) SEQIDNo.16 EIVLTQSPATLSLSPGERATLSCRASQDINENLAWYQQKPGQAPRLLIYY TSNRATGIPARFSGSGSGRDFTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIKR (14G2murineHCDR1) SEQIDNo.17 AYEMH (14G2murineHCDR2) SEQIDNo.18 YISSGSDTISYAATVKG (14G2murineHCDR3) SEQIDNo.19 PLGYGLDY (14G2murineLCDR1) SEQIDNo.20 KASQDINNFIA (14G2murineLCDR2) SEQIDNo.21 YTSSLQP (14G2murineLCDR3) SEQIDNo.22 LQYDILFT (14G2murineVH) SEQIDNo.23 EVQLVESGGGLVKPGGSLKLSCAASGFTFNAYEMHWVRQAPEKGLEWVAY ISSGSDTISYAATVKGRFTISRDNAKNTLFLQMTSLRSEDTAMYYCTPPL GYGLDYWGQGTSVIVSS (14G2murineVL) SEQIDNo.24 DIQMTQSPSSLSASLGGKVTITCKASQDINNFIAWYQHKPGKGPRLLIHY TSSLQPGFPSRFSGSGSGREYSFSISNVEPEDIATYYCLQYDILFTFGGG TKLEIKR (10C11murineHCDR1) SEQIDNo.25 NSWMN (10C11murineHCDR2) SEQIDNo.26 RIYPGDGDATYNGNFKD (10C11murineHCDR3) SEQIDNo.27 GTGYLWYFDV (10C11murineLCDR1) SEQIDNo.28 KASQDINENIA (10C11murineLCDR2) SEQIDNo.29 YTSALQS (10C11murineLCDR3) SEQIDNo.30 HQYDNLPFT (10C11murineVH) SEQIDNo.31 QVHLQQSGPELVKPGASVKISCKASGYAFSNSWMNWVRQRPGKGLEWIGR IYPGDGDATYNGNFKDKATLTADKSSSTAYIQLNSLTSEDSAVYFCARGT GYLWYFDVWGAGTTVTVAS (10C11murineVL) SEQIDNo.32 DIQMTQSPSSLSTFLGGKVTITCKASQDINENIAWYQHKPGKGPRLLIWY TSALQSGIPSRFSGSGSGRDYSFSISNLEPEDIATYYCHQYDNLPFTFGS GTKLEIKR Thefollowingalternativehumanisedlight chainsfor7A12arealsoprovided(CDRs determinedaccordingtoKabatnumbering system): (7A12VLAlt1LCDR1) SEQIDNo.53 KASQDINENVA (7A12VLAlt1LCDR2) SEQIDNo.54 YTSALQS (7A12VLAlt1LCDR3) SEQIDNo.55 QQYDNLPFT (7A12VLAlt1) SEQIDNo.56 EIVLTQSPATLSLSPGERATLSCKASQDINENVAWYQQKPGQAPRLLIYY TSALQSGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt2LCDR1) SEQIDNo.57 KASQDINENVA (7A12VLAlt2LCDR2) SEQIDNo.58 YTSALQS (7A12VLAlt2LCDR3) SEQIDNo.59 QQYDNLPFT (7A12VLAlt2) SEQIDNo.60 DIQMTQSPATLSLSPGERATLSCKASQDINENVAWYQHKPGQAPRLLIWY TSALQSGIPARFSGSGSGRDYTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt3LCDR1) SEQIDNo.61 RASQSVSSYLA (7A12VLAlt3LCDR2) SEQIDNo.62 DASNRAT (7A12VLAlt3LCDR3) SEQIDNo.63 QQYDNLPFT (7A12VLAlt3) SEQIDNo.64 EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLIYD ASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt4LCDR1) SEQIDNo.65 KASQDINENVA (7A12VLAlt4LCDR2) SEQIDNo.66 YTSALQS (7A12VLAlt4LCDR3) SEQIDNo.67 QQYDNLPFT (7A12VLAlt4) SEQIDNo.68 DIQMTQSPSSLSASVGDRVTITCKASQDINENVAWYQQKPGKAPKLLIYY TSALQSGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt5LCDR1) SEQIDNo.69 KASQDINENVA (7A12VLAlt5LCDR2) SEQIDNo.70 YTSALQS (7A12VLAlt5LCDR3) SEQIDNo.71 QQYDNLPFT (7A12VLAlt5) SEQIDNo.72 DIQMTQSPSSLSASVGDRVTITCKASQDINENVAWYQHKPGKAPKLLIWY TSALQSGVPSRFSGSGSGRDYTFTISSLQPEDIATYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt6LCDR1) SEQIDNo.73 QASQDISNYLN (7A12VLAlt6LCDR2) SEQIDNo.74 DASNLET (7A12VLAlt6LCDR3) SEQIDNo.75 QQYDNLPFT (7A12VLAlt6) SEQIDNo.76 DIQMTQSPSSLSASVGDRVTITCQASQDISNYLNWYQQKPGKAPKLLIYD ASNLETGVPSRFSGSGSGTDFTFTISSLQPEDIATYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt7LCDR1) SEQIDNo.77 KASQDINENVA (7A12VLAlt7LCDR2) SEQIDNo.78 DASNRAT (7A12VLAlt7LCDR3) SEQIDNo.79 QQYDNLPFT (7A12VLAlt7) SEQIDNo.80 DIQMTQSPATLSLSPGERATLSCKASQDINENVAWYQHKPGQAPRLLIWD ASNRATGIPARFSGSGSGRDYTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt8LCDR1) SEQIDNo.81 RASQSVSSYLA (7A12VLAlt8LCDR2) SEQIDNo.82 YTSALQS (7A12VLAlt8LCDR3) SEQIDNo.83 QQYDNLPFT (7A12VLAlt8) SEQIDNo.84 DIQMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLIWY TSALQSGIPARFSGSGSGRDYTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt9LCDR1) SEQIDNo.85 KASQDINENVA (7A12VLAlt9LCDR2) SEQIDNo.86 YTSNRAT (7A12VLAlt9LCDR3) SEQIDNo.87 QQYDNLPFT (7A12VLAlt9) SEQIDNo.88 DIQMTQSPATLSLSPGERATLSCKASQDINENVAWYQHKPGQAPRLLIWY TSNRATGIPARFSGSGSGRDYTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt10LCDR1) SEQIDNo.89 RASQSVSSYLA (7A12VLAlt10LCDR2) SEQIDNo.90 YTSNRAT (7A12VLAlt10LCDR3) SEQIDNo.91 QQYDNLPFT (7A12VLAlt10) SEQIDNo.92 DIQMTQSPATLSLSPGERATLSCRASQSVSSYLAWYQHKPGQAPRLLIWY TSNRATGIPARFSGSGSGRDYTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt11LCDR1) SEQIDNo.93 KASQDINENVA (7A12VLAlt11LCDR2) SEQIDNo.94 YTSALQS (7A12VLAlt11LCDR3) SEQIDNo.95 QQYDNLPFT (7A12VLAlt11) SEQIDNo.96 EIVLTQSPATLSLSPGERATLSCKASQDINENVAWYQQKPGQAPRLLIYY TSALQSGIPARFSGSGSGSGRDYTLTISSLEPEDFAVYYCQQYDNLPFTF GQGTKVEIK (7A12VLAlt12LCDR1) SEQIDNo.97 KASQDINENVA (7A12VLAlt12LCDR2) SEQIDNo.98 YTSALQS (7A12VLAlt12LCDR3) SEQIDNo.99 QQYDNLPFT (7A12VLAlt12) SEQIDNo.100 DIVMTQSPATLSLSPGERATLSCKASQDINENVAWYQHKPGQAPRLLIWY TSALQSGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt13LCDR1) SEQIDNo.101 KASQDINENVA (7A12VLAlt13LCDR2) SEQIDNo.102 YTSALQS (7A12VLAlt13LCDR3) SEQIDNo.103 QQYDNLPFT (7A12VLAlt13) SEQIDNo.104 DIVMTQSPATLSLSPGERATLSCKASQDINENVAWYQHKPGQAPRLLIWY TSALQSGIPARFSGSGSGSGRDYTLTISSLEPEDFAVYYCQQYDNLPFTF GQGTKVEIK (7A12VLAlt14LCDR1) SEQIDNo.105 KASQDINENVA (7A12VLAlt14LCDR2) SEQIDNo.106 YTSALQS (7A12VLAlt14LCDR3) SEQIDNo.107 QQYDNLPFT (7A12VLAlt14) SEQIDNo.108 EIQLTQSPATLSLSPGERATLSCKASQDINENVAWYQQKPGQAPRLLIYY TSALQSGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIK (7A12VLAlt15LCDR1) SEQIDNo.109 KASQDINENVA (7A12VLAlt15LCDR2) SEQIDNo.110 YTSALQS (7A12VLAlt15LCDR3) SEQIDNo.111 QQYDNLPFT (7A12VLAlt15) SEQIDNo.112 EIQLTQSPATLSLSPGERATLSCKASQDINENVAWYQQKPGQAPRLLIYY TSALQSGIPARFSGSGSGSGRDYTLTISSLEPEDFAVYYCQQYDNLPFTF GQGTKVEIK (7A12VLAlt16LCDR1) SEQIDNo.113 KASQDINENVA (7A12VLAlt16LCDR2) SEQIDNo.114 YTSALQS (7A12VLAlt16LCDR3) SEQIDNo.115 QQYDNLPFT (7A12VLAlt16) SEQIDNo.116 DIQMTQSPATLSLSPGERATLSCKASQDINENVAWYQHKPGQAPRLLIWY TSALQSGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQYDNLPFTFGQ GTKVEIK

    [0077] In addition, humanised heavy chains for 7A12 are also provided (CDRs determined according to Kabat numbering system):

    TABLE-US-00002 (7A12VHAlt1LCDR1) SEQIDNo.117 SSWMN (7A12VHAlt1LCDR2) SEQIDNo.118 RIYPGDGDTTYNGNFKD (7A12VHAlt1LCDR3) SEQIDNo.119 GTGYLWYFDV (7A12VHAlt1) SEQIDNo.120 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSSWMNWVRQAPGQGLEWMGR IYPGDGDTTYNGNFKDRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGT GYLWYFDVWGQGTMVTVSS (7A12VHAlt2LCDR1) SEQIDNo.121 SSWMN (7A12VHAlt2LCDR2) SEQIDNo.122 RIYPGDGDTTYNGNFKD (7A12VHAlt2LCDR3) SEQIDNo.123 GTGYLWYFDV (7A12VHAlt2) SEQIDNo.124 QFQLVQSGAEVKKPGASVKVSCKASGYAFSSSWMNWVRQAPGQGLEWMGR IYPGDGDTTYNGNFKDRATLTADKSISTAYMELSRLRSDDTAVYFCARGT GYLWYFDVWGQGTMVTVSS (7A12VHAlt3LCDR1) SEQIDNo.125 SSWMN (7A12VHAlt3LCDR2) SEQIDNo.126 RIYPGDGDTTYNGNFKD (7A12VHAlt3LCDR3) SEQIDNo.127 GTGYLWYFDV (7A12VHAlt3) SEQIDNo.128 EVQLVESGGGLVQPGGSLRLSCAASGFTFSSSWMNWVRQAPGKGLVWVSR IYPGDGDTTYNGNFKDRFTISRDNAKNTLYLQMNSLRAEDTAVYYCARGT GYLWYFDVWGQGTMVTVSS (7A12VHAlt4LCDR1) SEQIDNo.129 SSWMN (7A12VHAlt4LCDR2) SEQIDNo.130 RIYPGDGDTTYNGNFKD (7A12VHAlt4LCDR3) SEQIDNo.131 GTGYLWYFDV (7A12VHAlt4) SEQIDNo.132 EFQLVESGGGLVQPGGSLRLSCAASGYAFSSSWMNWVRQAPGKGLVWVGR IYPGDGDTTYNGNFKDRATISADKAKNTAYLQMNSLRAEDTAVYFCARGT GYLWYFDVWGQGTMVTVSS (7A12VHAlt5LCDR1) SEQIDNo.133 SSWMN (7A12VHAlt5LCDR2) SEQIDNo.134 RINPNSGGTNYAQKFQG (7A12VHAlt5LCDR3) SEQIDNo.135 GTGYLWYFDV (7A12VHAlt5) SEQIDNo.136 QVQLVQSGAEVKKPGASVKVSCKASGYTFTSSWMNWVRQAPGQGLEWMGR INPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGT GYLWYFDVWGQGTMVTVSS (7A12VHAlt6LCDR1) SEQIDNo.137 SSWMN (7A12VHAlt6LCDR2) SEQIDNo.138 RIYPGDGDTTYNGNFKD (7A12VHAlt6LCDR3) SEQIDNo.139 GTGYLWYFDV (7A12VHAlt6) SEQIDNo.140 QFQLQESGPGLVKPSETLSLTCTVSGYAFSSSWMNWIRQPPGKGLEWIGR IYPGDGDTTYNGNFKDRATISADKSKNQASLKLSSVTAADTAVYFCARGT GYLWYFDVWGKGTTVTVSS (7A12VHAlt7LCDR1) SEQIDNo.141 GYYMH (7A12VHAlt7LCDR2) SEQIDNo.142 RIYPGDGDTTYNGNFKD (7A12VHAlt7LCDR3) SEQIDNo.143 GTGYLWYFDV (7A12VHAlt7) SEQIDNo.144 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGR IYPGDGDTTYNGNFKDRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGT GYLWYFDVWGQGTMVTVSS (7A12VHAlt8LCDR1) SEQIDNo.145 GYYMH (7A12VHAlt8LCDR2) SEQIDNo.146 RIYPGDGDTNYAQKFQG (7A12VHAlt8LCDR3) SEQIDNo.147 GTGYLWYFDV (7A12VHAlt8) SEQIDNo.148 QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGR IYPGDGDTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCARGT GYLWYFDVWGQGTMVTVSS

    [0078] From these sequences, the following consensus sequences for the CDRs can be determined, in which X may be any natural amino acid:

    TABLE-US-00003 IMGTConsensus KabatConsensus CDR (SEQIDNo.) (SEQIDNo.) LCDR1 QXXXXX(149) XASQXXXXXXX(152) LCDR2 XXS(150) XXSXXXX(153) LCDR3 QQYDNLPFT(151) QQYDNLPFT(154) HCDR1 GXXFXXXX(155) XXXMX(158) HCDR2 IXPXXXXX(156) RIXPXXGXTXYXXXFXX(159) HCDR3 ARGTGYLWYFDV(157) GTGYLWYFDV(160)

    [0079] Alternatively, the antigen-binding domain of the present invention may comprise a single variable domain.

    [0080] A single-domain antibody (sdAb), also known as a nanobody, is an antibody fragment consisting of a single monomeric variable antibody domain.

    [0081] The first single-domain antibodies were engineered from heavy-chain antibodies found in camelids; these are called VHH fragments. Cartilaginous fishes also have heavy-chain antibodies (IgNAR, immunoglobulin new antigen receptor), from which single-domain antibodies called VNAR fragments can be obtained. Although most research into single-domain antibodies is currently based on heavy chain variable domains, nanobodies derived from light chains have also been shown to bind specifically to target epitopes.

    [0082] An antigen-binding domain of the present invention may comprise a domain antibody variable region having complementarity determining regions (CDRs): VHHCDR1, VHHCDR2 and VHHCDR3 selected from the following: [0083] VHHCDR1SEQ ID No. 33; VHHCDR2SEQ ID No. 34; VHHCDR3SEQ ID No. 35; [0084] (ii) VHHCDR1SEQ ID No. 37; VHHCDR2SEQ ID No. 38; VHHCDR3SEQ ID No. 39; [0085] (iii) VHHCDR1SEQ ID No. 41; VHHCDR2SEQ ID No. 42; VHHCDR3SEQ ID No. 43; [0086] (iv) VHHCDR1SEQ ID No. 45; VHHCDR2SEQ ID No. 46; VHHCDR3SEQ ID No. 47; and [0087] (v) VHHCDR1SEQ ID No. 49; VHHCDR2SEQ ID No. 50; VHHCDR3SEQ ID No. 51.

    [0088] The antigen binding domain may, for example, comprise a domain antibody variable region selected from the following:

    TABLE-US-00004 (i) SEQIDNo.36 ; (ii) SEQIDNo.40 ; (iii) SEQIDNo.44 ; (iv) SEQIDNo.48 ; and (v) SEQIDNo.52 . (A02VHHCDR1) SEQIDNo.33 TYGTG (A02VHHCDR2) SEQIDNo.34 GISGRGGYTSYIDSVKG (A02VHHCDR3) SEQIDNo.35 DRRMVWGTVRSPDEYDS (A02) SEQIDNo.36 QVQLQESGGGLVQPGGSLRLSCAASERTFSTYGTGWFRQAPGKEREFVAG ISGRGGYTSYIDSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADR RMVWGTVRSPDEYDSWGQGTQVTVSS (B08VHHCDR1) SEQIDNo.37 RYVMG (B08VHHCDR2) SEQIDNo.38 AISWSGSNTNYADSVKG (B08VHHCDR3) SEQIDNo.39 SGQWIIPTTARGYDD (B08) SEQIDNo.40 QVQLQQSGGGLVQAGGSLRLSCAASGRTYGRYVMGWFRQIPGKEREFVAA ISWSGSNTNYADSVKGRFTISRDNAKNTLYLQMNSLKPEDTAVYYCAASG QWIIPTTARGYDDWGQGTQVTVSS (G07VHHCDR1) SEQIDNo.41 TYGTG (G07VHHCDR2) SEQIDNo.42 GISGRGGYTSYIDSVKG (G07VHHCDR3) SEQIDNo.43 DRRMVWGTVRSPDEYDS (G07) SEQIDNo.44 QVQLQESGGGSVQAGGSLRLSCAASERTFSTYGTGWFRQAPGKEREFVAG ISGRGGYTSYIDSVKGRFTTSRDNAKNTVYLQMNSLKPEDTAVYYCAADR RMVWGTVRSPDEYDSWGQGTQVTVSS (NGS2VHHCDR1) SEQIDNO.45 TYTMG (NGS2VHHCDR2) SEQIDNo.46 GITWSTWSSDKTQYLDSVNS (NGS2VHHCDR3) SEQIDNo.47 TPRYYGVAVPTTRGPYDY (NGS2) SEQIDNo.48 QVQLQESGGGWVQAGGSLRLSCAASGRTSRTYTMGWFRQAPGKDGVFVAG ITWSTWSSDKTQYLDSVNSRFTISRDNARNTVYLQMNNLKPEDTAVYYCA ATPRYYGVAVPTTRGPYDYWGQGTQVTVSS (NGS25VHHCDR1) SEQIDNo.49 INTMH (NGS25VHHCDR2) SEQIDNo.50 TITSGGSTNYADSVKG (NGS25VHHCDR3) SEQIDNo.51 YYYRAY (NGS25) SEQIDNo.52 QVQLQQSGGGLVQPGGSLRLSCADSGSIFRINTMHWYRQAPGKQRELVAT ITSGGSTNYADSVKGRFTISRDNTKNTMYLQMNSLKAEDTAVYYCYTYYY RAYWGQGTQVTVSS

    [0089] The present inventors have found that the antigen-binding domains of the present invention have improved stability at acidic pH (see example 7). Since the tumor micro-environment is acidic, it is proposed that these antigen-binding domains have beneficial properties in the treatment of solid cancers.

    Chimeric Antigen Receptors (CARS)

    [0090] A classical chimeric antigen receptor (CAR) is a chimeric type I trans-membrane protein which connects an extracellular antigen-recognizing domain (binder) to an intracellular signalling domain (endodomain). The binder is typically a single-chain variable fragment (scFv) derived from a monoclonal antibody (mAb), but it can be based on other formats which comprise an antibody-like antigen binding site. A spacer domain is usually necessary to isolate the binder from the membrane and to allow it a suitable orientation. A common spacer domain used is the Fc of IgG1. More compact spacers can suffice e.g. the stalk from CD8a and even just the IgG1 hinge alone, depending on the antigen. A trans-membrane domain anchors the protein in the cell membrane and connects the spacer to the endodomain.

    [0091] Early CAR designs had endodomains derived from the intracellular parts of either the ? chain of the Fc?R1 or CD3?. Consequently, these first generation receptors transmitted immunological signal 1, which was sufficient to trigger T-cell killing of cognate target cells but failed to fully activate the T-cell to proliferate and survive. To overcome this limitation, compound endodomains have been constructed: fusion of the intracellular part of a T-cell co-stimulatory molecule to that of CD3? results in second generation receptors which can transmit an activating and co-stimulatory signal simultaneously after antigen recognition. The co-stimulatory domain most commonly used is that of CD28. This supplies the most potent co-stimulatory signalnamely immunological signal 2, which triggers T-cell proliferation. Some receptors have also been described which include TNF receptor family endodomains, such as the closely related OX40 and 41BB which transmit survival signals. Even more potent third generation CARs have now been described which have endodomains capable of transmitting activation, proliferation and survival signals (FIG. 1).

    [0092] When the CAR binds the target-antigen, this results in the transmission of an activating signal to the T-cell it is expressed on. Thus the CAR directs the specificity and cytotoxicity of the T cell towards tumour cells expressing the targeted antigen.

    [0093] CARs typically therefore comprise: (i) an antigen-binding domain; (ii) a spacer; (iii) a transmembrane domain; and (iii) an intracellular domain which comprises or associates with a signalling domain.

    [0094] A CAR may have the general structure:

    [0095] Antigen binding domainspacer domaintransmembrane domainintracellular signaling domain (endodomain).

    CAR Antigen Binding Domain

    [0096] The antigen binding domain is the portion of the chimeric receptor which recognizes antigen. In a classical CAR, the antigen-binding domain comprises: a single-chain variable fragment (scFv) derived from a monoclonal antibody (see FIG. 3c). CARs have also been produced with domain antibody (dAb) or VHH antigen binding domains (see FIG. 3b).

    [0097] A CAR may comprise a Fab fragment of an antibody (see FIG. 3a). A FabCAR comprises two chains: one having an antibody-like light chain variable region (VL) and constant region (CL); and one having a heavy chain variable region (VH) and constant region (CH). One chain also comprises a transmembrane domain and an intracellular signalling domain. Association between the CL and CH causes assembly of the receptor.

    [0098] The two chains of a Fab CAR may have the general structure: [0099] VHCHspacertransmembrane domainintracellular signalling domain; and [0100] VLCL or

    [0101] VLCLspacertransmembrane domainintracellular signalling domain; and VHCH

    [0102] For the Fab-type chimeric receptors described herein, the antigen binding domain is made up of a VH from one polypeptide chain and a VL from another polypeptide chain.

    [0103] The polypeptide chains may comprise a linker between the VH/VL domain and the CH/CL domains. The linker may be flexible and serve to spatially separate the VH/VL domain from the CH/CL domain.

    [0104] Alternatively, a CAR may comprise a single-chain variable fragment (scFv) fragment of an antibody (see FIG. 3c). In these classical CARs, the VH and VL domains may be in either orientation in the molecule, giving the general structure: [0105] VHVLspacertransmembrane domainintracellular signalling domain, or [0106] VLVHspacertransmembrane domainintracellular signalling domain.

    [0107] The polypeptide chain may comprise a linker between the VH domain and the VL domains to provide sufficient flexibility to enable VH/VL pairing and formation of the antigen-binding site.

    [0108] Alternatively, a CAR may comprise a domain-antibody (dAb)-type antigen-binding domain (FIG. 3b). Such a CAR may have the general structure: [0109] dAbspacertransmembrane domainintracellular signalling domain

    Spacer

    [0110] CARs generally comprise a spacer sequence or hinge region to connect the antigen-binding domain with the transmembrane domain and spatially separate the antigen-binding domain from the endodomain. A flexible spacer allows the antigen-binding domain to orient in different directions to facilitate binding.

    [0111] The spacer may be derived from all or part of naturally occurring molecules, such as from all or part of the extracellular region of CD8, CD4 or CD28, or from all or part of an antibody constant region. In particular the spacer may be derived from human CD8 alpha chain, Fc?RIII? receptor or IgG1. The spacer may be a synthetic sequence that corresponds to a naturally occurring hinge sequence or may be an entirely synthetic sequence. The spacer may comprise up to 300 amino acids, for example 10 to 100 amino acids and or 25 to 50 amino acids.

    Transmembrane Domain

    [0112] The transmembrane domain is the portion of the chimeric receptor which spans the membrane. The transmembrane domain may be any protein structure which is thermodynamically stable in a membrane. This is typically an alpha helix comprising of several hydrophobic residues. The transmembrane domain of any transmembrane protein can be used to supply the transmembrane portion of the chimeric receptor. The presence and span of a transmembrane domain of a protein can be determined by those skilled in the art using the TMHMM algorithm (http://www.cbs.dtu.dk/services/TMHMM-2.0/). Alternatively, an artificially designed TM domain may be used.

    Endodomain

    [0113] The endodomain is the signal-transmission portion of the chimeric receptor. It may be part of or associate with the intracellular domain of the chimeric receptor. After antigen recognition, receptors cluster, native CD45 and CD148 are excluded from the synapse and a signal is transmitted to the cell. The most commonly used endodomain component is that of CD3-zeta which contains 3 ITAMs. This transmits an activation signal to the T cell after antigen is bound. CD3-zeta may not provide a fully competent activation signal and additional co-stimulatory signalling may be needed. Co-stimulatory signals promote T-cell proliferation and survival. There are two main types of co-stimulatory signals: those that belong the Ig family (CD28, ICOS) and the TNF family (OX40, 41BB, CD27, GITR etc). For example, chimeric CD28 and OX40 can be used with CD3-Zeta to transmit a proliferative/survival signal, or all three can be used together.

    [0114] The endodomain may comprise: [0115] (i) an ITAM-containing endodomain, such as the endodomain from CD3 zeta; and/or [0116] (ii) a co-stimulatory domain, such as the endodomain from CD28 or ICOS; and/or [0117] (iii) a domain which transmits a survival signal, for example a TNF receptor family endodomain such as OX-40, 4-1BB, CD27 or GITR.

    [0118] A number of systems have been described in which the antigen recognition portion is on a separate molecule from the signal transmission portion, such as those described in WO015/150771; WO2016/124930 and WO2016/030691. The chimeric receptor of the present invention may therefore comprise an antigen-binding component comprising an antigen-binding domain and a transmembrane domain; which is capable of interacting with a separate intracellular signalling component comprising a signalling domain. The vector of the invention may express a chimeric receptor signalling system comprising such an antigen-binding component and intracellular signalling component.

    [0119] The chimeric receptor may comprise a signal peptide so that when it is expressed inside a cell, the nascent protein is directed to the endoplasmic reticulum and subsequently to the cell surface, where it is expressed. The signal peptide may be at the amino terminus of the molecule.

    Prostate-Specific Membrane Antigen (PSMA)

    [0120] Prostate-specific membrane antigen is a class II membrane glycoprotein that catalyzes the hydrolysis of N-acetylaspartylglutamate (NAAG) to glutamate and N-acetylaspartate (NAA). It is a zinc metalloenzyme which in humans it is encoded by the FOLH1 gene.

    [0121] The amino acid sequence for human PSMA is available from Uniprot under accession number Q04609 (https://www.uniprot.org/uniprot/Q04609). In this 750 amino acid sequence, the cytoplasmic domain is residues 1-19; the signal-anchor for type II membrane proteins is residues 20-43; and the extracellular domain is residues 44-750. The extracellular domain is comprised of protease, apical and C-terminal domains (see FIG. 2).

    Nucleic Acid Sequence

    [0122] The present invention also provides a nucleic acid sequence which encodes an antigen-binding domain or a CAR of the invention.

    [0123] As used herein, the terms polynucleotide, nucleotide, and nucleic acid are intended to be synonymous with each other.

    [0124] It will be understood by a skilled person that numerous different polynucleotides and nucleic acids can encode the same polypeptide as a result of the degeneracy of the genetic code. In addition, it is to be understood that skilled persons may, using routine techniques, make nucleotide substitutions that do not affect the polypeptide sequence encoded by the polynucleotides described here to reflect the codon usage of any particular host organism in which the polypeptides are to be expressed.

    [0125] Nucleic acids according to the invention may comprise DNA or RNA. They may be single-stranded or double-stranded. They may also be polynucleotides which include within them synthetic or modified nucleotides. A number of different types of modification to oligonucleotides are known in the art. These include methylphosphonate and phosphorothioate backbones, addition of acridine or polylysine chains at the 3 and/or 5 ends of the molecule. For the purposes of the use as described herein, it is to be understood that the polynucleotides may be modified by any method available in the art. Such modifications may be carried out in order to enhance the in vivo activity or life span of polynucleotides of interest.

    [0126] The terms variant, homologue or derivative in relation to a nucleotide sequence include any substitution of, variation of, modification of, replacement of, deletion of or addition of one (or more) nucleic acid from or to the sequence.

    [0127] The nucleic acid sequence may be codon optimised for expression in a particular host cell.

    Nucleic Acid Construct

    [0128] The present invention also provides a nucleic acid construct encoding a Fab-type

    [0129] CAR of the invention.

    [0130] A nucleic acid construct encoding a FabCAR (FIG. 3A) may have the structure: [0131] VH-CH-spacer-TM-endo-coexpr-VL-CL or [0132] VL-CL-spacer-TM-endo-coexpr-VH-CH [0133] in which: [0134] VH is a nucleic acid sequence encoding a heavy chain variable region; [0135] CH is a nucleic acid sequence encoding a heavy chain constant region spacer is a nucleic acid encoding a spacer; [0136] TM is a nucleic acid sequence encoding a transmembrane domain; [0137] endo is a nucleic acid sequence encoding an endodomain; [0138] coexpr is a nucleic acid sequence enabling co-expression of the first and second polypeptides; [0139] VL is a nucleic acid sequence encoding a light chain variable region; and [0140] CL is a nucleic acid sequence encoding a light chain constant region.

    [0141] For both structures mentioned above, nucleic acid sequences encoding the two polypeptides may be in either order in the construct.

    [0142] In the structure above, coexpr is a nucleic acid sequence enabling co-expression of two polypeptides as separate entities. It may be a sequence encoding a cleavage site, such that the nucleic acid construct produces both polypeptides, joined by a cleavage site(s). The cleavage site may be self-cleaving, such that when the polypeptide is produced, it is immediately cleaved into individual peptides without the need for any external cleavage activity.

    [0143] The cleavage site may be any sequence which enables the two polypeptides to become separated.

    [0144] The term cleavage is used herein for convenience, but the cleavage site may cause the peptides to separate into individual entities by a mechanism other than classical cleavage. For example, for the Foot-and-Mouth disease virus (FMDV) 2A self-cleaving peptide (see below), various models have been proposed for to account for the cleavage activity: proteolysis by a host-cell proteinase, autoproteolysis or a translational effect (Donnelly et al (2001) J. Gen. Virol. 82:1027-1041). The exact mechanism of such cleavage is not important for the purposes of the present invention, as long as the cleavage site, when positioned between nucleic acid sequences which encode proteins, causes the proteins to be expressed as separate entities.

    [0145] The cleavage site may, for example be a furin cleavage site, a Tobacco Etch Virus (TEV) cleavage site or encode a self-cleaving peptide.

    [0146] A self-cleaving peptide refers to a peptide which functions such that when the polypeptide comprising the proteins and the self-cleaving peptide is produced, it is immediately cleaved or separated into distinct and discrete first and second polypeptides without the need for any external cleavage activity.

    [0147] The self-cleaving peptide may be a 2A self-cleaving peptide from an aphtho- or a cardiovirus. The primary 2A/2B cleavage of the aptho- and cardioviruses is mediated by 2A cleaving at its own C-terminus. In apthoviruses, such as foot-and-mouth disease viruses (FMDV) and equine rhinitis A virus, the 2A region is a short section of about 18 amino acids, which, together with the N-terminal residue of protein 2B (a conserved proline residue) represents an autonomous element capable of mediating cleavage at its own C-terminus (Donelly et al (2001) as above).

    [0148] 2A-like sequences have been found in picornaviruses other than aptho- or cardioviruses, picornavirus-like insect viruses, type C rotaviruses and repeated sequences within Trypanosoma spp and a bacterial sequence (Donnelly et al (2001) as above).

    [0149] The cleavage site may comprise the 2A-like sequence shown as SEQ ID No. 161 (RAEGRGSLLTCGDVEENPGP).

    [0150] The present invention also provides a nucleic acid construct which comprises one or more nucleic acid sequence(s) encoding a CAR of the present invention, together with a nucleic acid sequence encoding another molecule such as a suicide gene.

    [0151] A suicide-gene is a genetically encoded mechanism which allows selective destruction of adoptively transferred cells, such as T-cells, in the face of unacceptable toxicity.

    [0152] The suicide gene may be RQR8 as described in WO2013/153391 having the sequence shown as SEQ ID No. 4 of that document; or Rapcasp9 as described in WO2016/135470.

    Vector

    [0153] The present invention also provides a vector, or kit of vectors, which comprises one or more nucleic acid sequence(s) encoding an antigen-binding domain or chimeric antigen receptor according to the invention. Such a vector may be used to introduce the nucleic acid sequence(s) into a host cell so that it expresses an antigen-binding domain or chimeric antigen receptor.

    [0154] The vector may, for example, be a plasmid or a viral vector, such as a retroviral vector or a lentiviral vector, or a transposon based vector or synthetic mRNA.

    [0155] The vector may be capable of transfecting or transducing a cell such as a T cell or a NK cell.

    Cell

    [0156] The present invention provides a cell which comprises a chimeric antigen receptor of the invention.

    [0157] The cell may comprise a nucleic acid sequence, nucleic acid construct or a vector of the present invention.

    [0158] The cell may be a cytolytic immune cell such as a T cell or an NK cell.

    [0159] T cells or T lymphocytes are a type of lymphocyte that play a central role in cell-mediated immunity. They can be distinguished from other lymphocytes, such as B cells and natural killer cells (NK cells), by the presence of a T-cell receptor (TCR) on the cell surface. There are various types of T cell, as summarised below.

    [0160] Helper T helper cells (TH cells) assist other white blood cells in immunologic processes, including maturation of B cells into plasma cells and memory B cells, and activation of cytotoxic T cells and macrophages. TH cells express CD4 on their surface. TH cells become activated when they are presented with peptide antigens by MHC class II molecules on the surface of antigen presenting cells (APCs). These cells can differentiate into one of several subtypes, including TH1, TH2, TH3, TH17, Th9, or TFH, which secrete different cytokines to facilitate different types of immune responses.

    [0161] Cytolytic T cells (TC cells, or CTLs) destroy virally infected cells and tumor cells, and are also implicated in transplant rejection. CTLs express the CD8 at their surface. These cells recognize their targets by binding to antigen associated with MHC class I, which is present on the surface of all nucleated cells. Through IL-10, adenosine and other molecules secreted by regulatory T cells, the CD8+ cells can be inactivated to an anergic state, which prevent autoimmune diseases such as experimental autoimmune encephalomyelitis.

    [0162] Memory T cells are a subset of antigen-specific T cells that persist long-term after an infection has resolved. They quickly expand to large numbers of effector T cells upon re-exposure to their cognate antigen, thus providing the immune system with memory against past infections. Memory T cells comprise three subtypes: central memory T cells (TCM cells) and two types of effector memory T cells (TEM cells and TEMRA cells). Memory cells may be either CD4+ or CD8+. Memory T cells typically express the cell surface protein CD45RO.

    [0163] Regulatory T cells (Treg cells), formerly known as suppressor T cells, are crucial for the maintenance of immunological tolerance. Their major role is to shut down T cell-mediated immunity toward the end of an immune reaction and to suppress auto-reactive T cells that escaped the process of negative selection in the thymus.

    [0164] Two major classes of CD4+ Treg cells have been describednaturally occurring Treg cells and adaptive Treg cells.

    [0165] Naturally occurring Treg cells (also known as CD4+CD25+FoxP3+ Treg cells) arise in the thymus and have been linked to interactions between developing T cells with both myeloid (CD11c+) and plasmacytoid (CD123+) dendritic cells that have been activated with TSLP. Naturally occurring Treg cells can be distinguished from other T cells by the presence of an intracellular molecule called FoxP3. Mutations of the FOXP3 gene can prevent regulatory T cell development, causing the fatal autoimmune disease IPEX.

    [0166] Adaptive Treg cells (also known as Tr1 cells or Th3 cells) may originate during a normal immune response.

    [0167] The cell may be a Natural Killer cell (or NK cell). NK cells form part of the innate immune system. NK cells provide rapid responses to innate signals from virally infected cells in an MHC independent manner

    [0168] NK cells (belonging to the group of innate lymphoid cells) are defined as large granular lymphocytes (LGL) and constitute the third kind of cells differentiated from the common lymphoid progenitor generating B and T lymphocytes. NK cells are known to differentiate and mature in the bone marrow, lymph node, spleen, tonsils and thymus where they then enter into the circulation.

    [0169] The cells of the invention may be any of the cell types mentioned above.

    [0170] Cells according to the first aspect of the invention may either be created ex vivo either from a patient's own peripheral blood (1st party), or in the setting of a haematopoietic stem cell transplant from donor peripheral blood (2nd party), or peripheral blood from an unconnected donor (3rd party).

    [0171] Alternatively, cells according to the first aspect of the invention may be derived from ex vivo differentiation of inducible progenitor cells or embryonic progenitor cells to T or NK cells. Alternatively, an immortalized T-cell line which retains its lytic function and could act as a therapeutic may be used.

    [0172] In all these embodiments, chimeric polypeptide-expressing cells are generated by introducing DNA or RNA coding for the chimeric polypeptide by one of many means including transduction with a viral vector, transfection with DNA or RNA.

    [0173] The cell of the invention may be an ex vivo cell from a subject. The cell may be from a peripheral blood mononuclear cell (PBMC) sample. Cells may be activated and/or expanded prior to being transduced with nucleic acid encoding the molecules providing the chimeric polypeptide according to the first aspect of the invention, for example by treatment with an anti-CD3 monoclonal antibody. The cell of the invention may be made by: [0174] (i) isolation of a cell-containing sample from a subject or other sources listed above; and [0175] (ii) transduction or transfection of the cells with one or more a nucleic acid sequence(s) encoding a chimeric polypeptide.

    [0176] The cells may then by purified, for example, selected on the basis of expression of the antigen-binding domain of the antigen-binding polypeptide.

    Pharmaceutical Composition

    [0177] The present invention also relates to a pharmaceutical composition containing a plurality of cells according to the invention.

    [0178] The pharmaceutical composition may additionally comprise a pharmaceutically acceptable carrier, diluent or excipient. The pharmaceutical composition may optionally comprise one or more further pharmaceutically active polypeptides and/or compounds. Such a formulation may, for example, be in a form suitable for intravenous infusion.

    Method of Treatment

    [0179] The present invention provides a method for treating and/or preventing a disease which comprises the step of administering the cells of the present invention (for example in a pharmaceutical composition as described above) to a subject.

    [0180] A method for treating a disease relates to the therapeutic use of the cells of the present invention. Herein the cells may be administered to a subject having an existing disease or condition in order to lessen, reduce or improve at least one symptom associated with the disease and/or to slow down, reduce or block the progression of the disease.

    [0181] The method for preventing a disease relates to the prophylactic use of the cells of the present invention. Herein such cells may be administered to a subject who has not yet contracted the disease and/or who is not showing any symptoms of the disease to prevent or impair the cause of the disease or to reduce or prevent development of at least one symptom associated with the disease. The subject may have a predisposition for, or be thought to be at risk of developing, the disease.

    [0182] The method may involve the steps of: [0183] (i) isolating a cell-containing sample; [0184] (ii) transducing or transfecting such cells with a nucleic acid sequence or vector provided by the present invention; [0185] (iii) administering the cells from (ii) to a subject.

    [0186] The cell-containing sample may be isolated from a subject or from other sources, for example as described above. The cells may be isolated from a subject's own peripheral blood (1st party), or in the setting of a haematopoietic stem cell transplant from donor peripheral blood (2nd party), or peripheral blood from an unconnected donor (3rd party).

    [0187] The present invention provides a CAR-expressing cell of the present invention for use in treating and/or preventing a disease.

    [0188] The invention also relates to the use of a CAR-expressing cell of the present invention in the manufacture of a medicament for the treatment and/or prevention of a disease

    [0189] The disease to be treated and/or prevented by the methods of the present invention may be a cancerous disease, such as prostate cancer, bladder cancer, breast cancer, colon cancer, endometrial cancer, kidney cancer (renal cell), leukaemia, lung cancer, melanoma, non-Hodgkin lymphoma, pancreatic cancer, and thyroid cancer.

    [0190] In particular, the disease may be prostate cancer.

    [0191] The cells of the present invention may be capable of killing target cells, such as cancer cells. The target cell may be characterised by the presence of a tumour secreted ligand or chemokine ligand in the vicinity of the target cell. The target cell may be characterised by the presence of a soluble ligand together with the expression of a tumour-associated antigen (TAA) at the target cell surface. The cells and pharmaceutical compositions of present invention may be for use in the treatment and/or prevention of the diseases described above.

    [0192] The invention will now be further described by way of Examples, which are meant to serve to assist one of ordinary skill in the art in carrying out the invention and are not intended in any way to limit the scope of the invention.

    EXAMPLES

    Example 1Generation of PSMA Binders

    [0193] Rat phage display library was generated after immunisation and panned against in house recombinant human PSMA immobilised on beads. After showing enrichment of specific phage the library was screened using a phage ELISA assay and isolated clones were sequenced. Binding of the clones as reassessed to confirm positive selection before being cloned into murine IgG2A Fc vectors for further analysis.

    Materials and Methods

    Production of Strep2 Tagged PSMA

    [0194] StrepII tagged PSMA (MP27034) was made in house and transfected into 30 ml of HEK293F cells as per standard protocol. After 4 days culture supernatants were harvested and 0.22 ?m filter sterilised prior to aliquoting and storage at 4? C.

    Bead Based Capture of Recombinant PSMA and FACS Analysis Protocol (QC)

    [0195] 25 ?l of Magstrep beads (IBA) were removed from storage vial. Beads were washed in 1 mL of PBS.T (0.05% Tween)?3 with magnetic separation between washes. 1.5 mL of MP27034 supernatant (PSMA not quantified) was incubated with beads for 30 min at room temperature with agitation. Beads were washed with 1 mL (?3) PBS.T separating via magnet after each wash. Beads were blocked in 1 ml of 1% BSA PBS for 30 min at room temp alongside 25 ?l unconjugated beads for negative selection/control in QC experiments. Wash beads with 1 mL (?3) PBS.T separating via magnet after each wash. Stain with 1/1000 dilution of anti-PSMA Alexaflour 488 (Abcam ab187570) for 10 min at room temperature with agitation. Flow confirmation of binding was carried out using conjugated beads on Milteni MACSquant.

    Phage Panning

    [0196] PSMA St2 (27034) in supernatant from transiently transfected HEK293T cells (RJ) was conjugated to beads as described above (without staining). Both IBA type 2 and type 3 strep-tactin beads were used for panning on the KingFisher Flex. A 100-fold representation of the phage library (1?10.sup.10 phage/ml) was incubated with BSA conjugated beads in order remove non-specific binding phage for 30 min at room temperature with agitation. Beads were magnetically separated and the phage containing supernatant was transferred directly to PSMA-conjugated beads.

    [0197] Panning and wash steps were carried out on the Kingfisher Flex using Phage display protocol 2 utilising washing in PBS.T 0.05% for 3 min?5 cycles. Elution from PSMA St2 conjugated beads was carried out using 500 ?l of a 2? Biotin solution in PBS for 20 min.

    [0198] Phage were then titrated and amplified according to standard protocols. Briefly, eluted phage were amplified by reinfection into log phase TG1 cells (5 ml) and plating out on Amp/Gluc agar plates. Titrations were performed to establish phage numbers and enrichment. Several rounds of phage panning and amplification were used to generate binders.

    Monoclonal Phage Expression ELISA

    [0199] A standard phage ELISA protocol was used. In brief; individual bacterial colonies were picked and cultured at 37? C. in 2TY Gluc/Amp media until OD.sub.600nm of 0.5 before induction of phage expression by addition helper phage (M13KO7) for superinfection for 40 min, re-suspension in 2TY supplemented with ampicillin and kanamycin (100 ?g/ml and 70 ?g/ml respectively) and overnight culture at 30? C. with agitation. The cells were pelleted by centrifugation and supernatant used directly for screening ELISAs and flow cytometry.

    Elisa

    [0200] All incubations were room temperature for 1 h with agitation whilst washing was 3 times with 0.05% PBS.tween. PSMA was plated on a nunc 96 well plate at 1 ?g/ml (50 ?l) and incubated at room temp for 1 h, the plate was washed and blocked with 2% milk for 1 h and washed again before supernatants were added. Detection antibody was anti-M13-HRP conjugate, and the plate was developed with TMB substrate before being read at 450 nm.

    [0201] Deviation from this ELISA protocol include scFv detection using anti-c-Myc HRP or anti-Flag-HRP where necessary. 25

    Results

    PSMA Batch QC Prior to Initiation of Panning

    [0202] Prior to initiating panning a batch of PSMA was produced from transient 293 transfection. QC of this showed that PSMA ST2 could be successfully bound to, and eluted from, Type 3 beads using biotin. Therefore type 3 beads were used for all following bead based panning strategies.

    TABLE-US-00005 TABLE 1 Titration of input and output phage ratio for panning against recombinant protein. Panning ratios Input phage titre Eluted phage titre Pan 1 2 ? 10.sup.10 4 ? 10.sup.5 Pan 2 2 ? 10.sup.8 2 ? 10.sup.5

    [0203] Panning enrichment showed positive results for phage titres after two pans and therefore single colonies were selected to screen for specific antibodies.

    [0204] Based on selection criteria of PSMA binding over background, colonies were stored as glycerol stocks in 50% glycerol and cultured to enable repeat screening.

    TABLE-US-00006 TABLE 2 Selected colonies from PSMA Phage ELISA analysis Plate Well ID Plate 1 A - 1, 2, 3. B - 1. C 1. E - 1, 2. H- 7 Plate 2 A - 11. B - 9, 12*. C - 8, 9, 11, 12. D - 12. E-3*. G - 5. H - 6, 9.

    [0205] Repeated ELISA results from M13 phage expression by monoclonal selections (after phage precipitation) showed that signals were replicable and significant compared to binding to background proteins.

    [0206] FIG. 4ELISA assay of clonal phage and scFv cultures in replicate after initial screening (n=3) on recombinant protein ELISA assay

    SUMMARY

    [0207] A selection of binders were generated from this phage display campaign alongside further sequences using hybridoma generation from the same animal

    7A12 Humanisation

    In Silico Humanisation and Antibody Modelling

    [0208] 7A12 humanisation was performed by in silico modelling and CDR grafting using BioLuminate software (Schrodinger).

    In Silico Immunogenicity Analysis

    [0209] Aim: To predict T-cell epitopes of the newly designed humanised constructs using the IEDB tool (https://www.iedb.org/) for MHCI binding and MHCI immunogenicity properties (Nielsen et al. 2003 Protein Sci. 12, 1007-1017; Bui et al. 2005 Immunogenetics 57, 304-314; Peters & Sette 2005 BMC Bioinformatics 6, 132; Karosiene et al. 2012 Immunogenetics 64, 177-186; Zhanget al. 2009 Bioinformatics 25, 1293-1299). Additionally, predict humanness of the grafted framework with the T20 score analyser (https://dm.lakepharma.com/bioinformatics/) (Gao et al. 2013 BMC Biotechnol. 13, 55).

    IEDB

    [0210] This tools allows the analysis of peptides derived from the antibody sequence for binding affinity to MHCI. The sequence of the grafted antibody framework is analysed through the Proteasomal cleavage/TAP transport/MHC class I combined predictor (http://tools.iedb.org/processing/) on the human HLA allele A*02:01 using all peptide length (8 to 14). A specific cut-off of 274 nM is applied to differentiate binding peptides (Paul, S. et al. 2013 J. Immunol. 191, 5831-5839).

    IEDB MHC-I Immunogenicity

    [0211] All peptides with an IC50 below 274 nM were then analysed on the Class I immunogenicity tool (http://tools.iedb.org/immunogenicity/) to determine immunogenicity score (a positive value denotes immunogenicity) (Calis et al. 2013 PLOS Comput. Biol. 9, e1003266).

    [0212] As an affinity threshold of 50 nM is required for an efficient CTL response (Sette, A. et al. 1994 J. Immunol. Baltim. 153, 5586-5592), all peptides with an affinity of 50 nM or less for MHC-I are considered potentially immunogenic.

    T20 Score

    [0213] The T20 score analyser is used to calculate a monoclonal antibody humanness score from antibody variable sequences (Gao et al. 2013 BMC Biotechnol. 13, 55). The sequence of the grafted antibody framework is analysed through the T20 score analyser (https://dm.lakepharma.com/bioinformatics/). A score of 80 or more is associated to a human sequence.

    Example 2Generation of Anti-PSMA Single Domain Antibodies

    [0214] Single domain antibodies (dAb) with specificity for PSMA were isolated from an immunised llama phage display library using a combination of immobilised antigen and cell-based phage display panning.

    [0215] Screening assays were initially carried out on recombinant protein before confirmation of cell binding to transduced and endogenous PSMA expressing cells was confirmed by flow cytometry.

    [0216] SPR analysis (Biacore) showed that the antibodies bound with an affinity in the nM range and the selected antibodies bind to PSMA (human and Rhesus) in IHC staining.

    Materials and Methods

    Immunisations and Library Preparation

    [0217] Two llamas (9240, 9241) were genetically immunised with pCMV-PSMA via subcutaneous injection (days 0 and 21) to prime an immune response before protein immunisation with recombinant His-tagged PSMA (day 42 and 63). Peripheral blood lymphocytes (PBLs) were isolated from 150 ml blood samples taken at 70 days post primary immunization. RNA was isolated from PBLs using the RNeasy maxi kit (Qiagen). cDNA was synthesized from each llama using oligo-dT priming and Superscript III reverse transcriptase. dAb encoding cDNA was amplified by PCR using specific primers, analysed to ensure presence of 400 bp fragment and purified (Zymoclean). The resulting clean PCR product was cut by restriction enzyme digest (PST1 and NOT1) and ligated into M13 phage vector viral coat protein (pRL144). Multiple electroporations were performed into TG1 E. coli and selections carried out on ampicillin agar plates before pooling and freezing samples.

    [0218] Phage with antibodies expressed as protein coat were amplified from TG1 E. coli. Briefly, TG1 cells were inoculated into 2TY media supplemented with Glucose (2%)/ampicillin (1 ?g/ml) and cultured at 37? C. with agitation to an OD.sub.600nm of 0.5 before addition of M13KO7 helper phage. Cells were resuspended 40 min later into 2YT media supplemented with kanamycin and ampicillin (70/100 ?g/ml) and incubated at 30? C. overnight with agitation. Phage were purified using PEG based precipitation and titrated into TG1 E. coli to determine PFUs/ml.

    Phage Display Panning

    Recombinant Protein

    [0219] Recombinant PSMA was immobilised on a Nunc immunotube at 1 ?g/ml overnight at 4? C. before blocking with a 2% milk PBS solution. Phage were blocked in 2% milk PBS (2 ml) for 1 h before addition to the PSMA coated immunotube. After 1 h at room temperature the tube wash washed 15 times with 3?1 min incubations using PBS 0.05% Tween 20. Elution of specific phage was performed by addition of re-warmed trypsin (2 ml) to the tube and incubation at 37? C. for 10-15 min. Eluted phage were amplified by reinfection into log phase TG1 cells (5 ml) and plating out on Amp/Gluc agar plates. Titrations were performed to establish phage numbers and enrichment.

    Cell Based Panning

    [0220] Cell based panning was used to enrich and isolate binders with specificity to PSMA as displayed on the cell surface. SupT1 cells stably transduced with PSMA and non-transduced SupT1 cells were cultured and 5?10.sup.6 cells total per Library were harvested and re-suspended into 4 ml ice cold milk/PBS 2% and kept on ice. Phage (2?10.sup.11 PFU/ml) from pan 1 on recombinant protein were blocked in 2 ml PBS/milk 2% for 1 h before centrifugation (400?g/5 min/4? C.) and re-suspension of SupT1 NT cells in phage solution. Phage and SupT1 NT cells were incubated with end over end rotation at 4? C. for 1 h to remove non-specific binders after which the process was repeated with SupT1-PSMA cells. Washing was performed by serial centrifugation and re-suspension in PBS 0.05% Tween 20 (pH5 adjusted) before incubation with 37? C. Trypsin EDTA (10 min) and phage titration and amplification into E. coli TG1 cells as described above.

    Screening

    [0221] Individual bacterial colonies were picked and cultured at 37? C. in 2TY Gluc/Amp media until OD.sub.600nm of 0.5 before induction of dAb expression by addition of IPTG (1 mM) and overnight culture at 30? C. The cells were pelleted by centrifugation and supernatant used directly for screening ELISAs and flow cytometry.

    Elisa

    [0222] All incubations were room temp 1 h with agitation whilst washing was 3 times with PBS 0.05% Tween 20. PSMA was plated on a Nunc 96 well plate at 1 ?g/ml (50 ?l) and incubated at room temp for 1 h, the plate was washed and blocked with 2% milk for 1 h and washed again before supernatants were added. Detection antibody was anti-C Myc-HRP conjugate, and the plate was developed with TMB substrate before being read at 450 nm.

    Flow Cytometry

    [0223] Transduced or non-transduced SupT1 cells expressing human PSMA at high medium or low levels, along with tumour cell lines LnCAP, PC3 and 22RV1 were stained in various flow cytometry experiments. Briefly cells were incubated with screening antibodies tagged with either Murine Fc or C-Myc tag before washing with PBS.T 0.05% and appropriate secondary antibodies (anti-C Myc PE and anti-murine Fc AF647). Flow cytometers used were Miltenyi MACSquant (FIG. 5) and IntelliCyt (FIG. 6).

    Results

    [0224] Two phage display libraries were constructed from two DNA and protein immunised llamas to enable interrogation of their antibody repertoire. Panning was carried out against recombinant human PSMA (Acro Biosystems) showing initial high enrichment of specific clones (FIG. 5(A)). After screening these libraries were both panned against SupT1 cells expressing PSMA in order to generate cell membrane bound PSMA specificity. Cell panned libraries yielded similar enrichment titres to those from recombinant protein panning (FIG. 5(B)).

    [0225] After assessment of initial panning enrichment, monoclonal phage expressing TG1 colonies were selected from titration plates, cultured and dAb expression induced by IPTG addition and glucose starvation. ELISA analysis showed a mix of positive clones and background binders (FIG. 6). Positive clones were selected, sequenced and further screened against recombinant PSMA in titration assays (data not shown). Selected binders were progressed to flow cytometry where clones B8 and G7 from llama 2 were shown to have the highest affinity and specific for high expressing PSMA clones (FIG. 7 and FIG. 8).

    [0226] The enriched repertoire of dAbs within the library of cell panned phage as shown by initial screening was significant enough to warrant further screening of similar sequences by Next gen Sequence analysis (NGS). Llama 1 and 2 were both analysed by NGS (PacBio) and sequences were assessed for similarity to isolated sequences of high affinity for verified cell binders. A set of 36 further binders were 35 generated via G Block gene synthesis (IDT technologies). These were cloned into a murine IgG2A-Fc format and expressed from HEK293 cells before screening against a range of cell types including transduced and endogenous expression (FIG. 9).

    [0227] Two binders of particular interest were isolated from NGS sequences (clones 2 and 25). Immunohistochemistry was performed against transduced cells or human tumour samples and also from Rhesus monkey samples to establish the potential for In vivo model validation and IHC analysis of colocalization (FIG. 10).

    [0228] Results showed that whilst B8 and G7 clones (49110 and 49112) did bind to PSMA positive cell lines they were either inferior to gold standard controls or did not bind to Rhesus PSMA transduced cell lines. Based on this data the two selected candidates for further analysis are clones 2 and 25 from NGS selection.

    Example 3Biophysical Characterisation of Anti-PSMA VHH Antibodies

    Methods

    [0229] Anti-PSMA clones were expressed in expi-CHO cells by transient transfection. Supernatant from transfected CHO cells was purified using protein A affinity chromatography. A HiTrap MabSelect SuRE 1 ml column was equilibrated with 5 column volumes of PBS pH 7.4. Supernatant was applied to the column using Akta? Pure system at a flow rate of 1 mL/min. Following application of supernatant, the column was washed with 20 column volumes of PBS. Sample was then eluted from the column with 3 ml of IgG elution buffer (Pierce21004) at 1 mL/min and directly loaded onto 2 HiTrap 5 ml desalting columns, previously equilibrated in PBS, and collected on a 96-well plate using a fraction collector unit.

    [0230] Fractions containing the protein were pooled and analysed via SDS-PAGE. Material was divided in aliquots and stored at ?80? C.

    Size Exclusion Chromatography

    [0231] 20 ?l of purified recombinant antibody were loaded onto a Superdex 200 increase 5/150 GL column in an Akta Pure system. Briefly, the column was equilibrated with 1.5 column volumes of PBS at 0.3 ml/min. Sample was loaded by direct loop injection at 0.3 ml/min and run in PBS over 1.5 column volumes. Eluted protein was detected at OD 280 nm. VHH-Fc construct was expected to elute at 2 ml.

    Thermo-Stability

    [0232] Samples were normalised to 1 mg/ml and loaded onto standard glass capillaries (Nanotemper). Thermo-stability was determined by linear temperature increments of 1? C./min from 20? ? C. to 95? ? C. on Nanotemper Prometheus NT.48 instrument. Data analysed as first derivative of 350 nm/330 nm ratio.

    Surface Plasmon Resonance

    [0233] Kinetic affinity for soluble PSMA was determined using Biacore T200 instrument. Recombinant purified antibodies were captured on a Protein A chip #7 at 10 ?l/min for 60 s, aiming at 100 RU. Recombinant PSMA-His (sino biologicals) dialysed in HBS-P+ buffer was used as analyte from 1 ?M with 1:2 serial dilutions for 10 points and flown at 30 ?l/min for 150 s with 300 s dissociation time. A double reference subtraction was applied. Sensograms fitted with 1:1 Langmuir model.

    Anti-PSMA Antibody J591 (UPenn) was Used as Reference

    Results

    [0234] The antibodies were transiently expressed in ExpiCHO in VHH-Fc format and purified via protein A affinity chromatography. Protein purity was assessed by SDS-PAGE and molecular dispersion was measured via size exclusion chromatography. Antibodies demonstrated a low aggregation propensity.

    [0235] Thermal stability was assessed via DSF, showing a melting temperature above 57? C. for both antibodies tested.

    [0236] Affinity was determined by surface plasmon resonance on a Biacore T200 instrument against recombinant soluble PSMA. Affinities were measured in the nM range for both antibodies (Table 3)

    TABLE-US-00007 TABLE 3 Clone KD (M) Tm (? C.) Aggregation (%) B08 2.12e?7 67.4 2.05 G07 3.16e?7 57.2 1.53

    Example 4Construction of Anti-PSMA CARS

    [0237] A panel of CAR-encoding nucleic acid constructs are generated as follows: [0238] fmc63_BBz: SFGmR.RQR8-2A-FMC63-CD8STK-TyrpTM-41BBz [0239] mu7A12_BBz: SFGmR.RQR8-2A-aPSMA_mu7A12_CD8STK-TyrpTM-41BBz [0240] hu7A12_BBz: SFGmR.RQR8-2A-aPSMA_hu7A12_CD8STK-TyrpTM-41BBz [0241] hu7A12_28 z: SFGmR.RQR8-2A-aPSMA_hu7A12_CD8STK-TyrpTM-41BBz [0242] J591_BBz: SFGmR.RQR8-2A-aPSMA_hu7A12_CD8STK-TyrpTM-41BBz [0243] in which [0244] SFGmR is the vector backbone; [0245] RQR8 is the sort-suicide gene RQR8, which is described in WO2013/153391; [0246] 2A is a member of the 2A self-cleaving peptide family allowing co-expression of the RQR8 and CAR polypeptides [0247] CD8STK is a CD8 stalk spacer [0248] TrypTM is a transmembrane domain derived from Tryp-1 [0249] 41BBz is a second generation endodomain comprising the endodomains from CD3zeta and 4-1BB.

    Example 5FACs-Based Killing Assay (FBK)

    [0250] The capacity of the CAR-T cells to kill target cells was investigated using a FACS-based killing assay. SupT1 cells engineered to express human PSMA antigen (SupT1-PSMA) were used as target cells. Non-engineered SupT1 cells (SupT1-NT) were used as a negative control. T-cells were co-cultured with target cells at 1:1, 1:4, and 1:8 effector to target ratios. FBK was assayed after 24 h of incubation and analysed by cytofluorimetry analysis. 25

    Example 6Cytokine Release

    [0251] Secretion of IL-2 and IFN? by CAR T-cells was measured by collecting supernatant at 24 hr from the co-cultures described in Example 5. Production of IL-2 and IFN? was detected by ELISA.

    Methodology

    Cell Lines

    [0252] SupT1 cell line (NT and PSMA+) were cultured in RPMI-1640 Medium supplemented with 10% fetal bovine serum (FBS) and 1% GlutaMAX. T-cells were isolated from peripheral blood mononuclear cells (PBMCs) and maintained in RPMI-1640 Medium supplemented with 10% FBS, 1% GlutaMAX and 100 U/mL IL-2.

    Transduction

    [0253] Retrovirus was generated by transiently transfecting HEK293T cells using GeneJuice with RDF plasmid (RD114 envelope), gag/pol plasmid and CAR plasmid. Retroviral viral supernatant was harvested at 48 and 72 hours. T cells were stimulated using 0.5 g/mL of anti-CD3 and anti-CD28 antibodies in T175 TC-treated flasks and maintained in 100 U/mL IL-2. Non-TC treated six-well plates were coated with Retronectin and incubated at 4? C. for 24 hours prior to T cell transduction. 3 ml of viral supernatant was plated prior to the addition of 1 ml of activated T cells at a concentration of 1?10.sup.6 cells/ml, 100 U/mL of IL-2 was then added and centrifuged at 1000?g for 40 minutes at room temperature and incubated at 37? C. and 5% CO2 for 2-3 days.

    NK Cells and NKT Cells Depletion

    [0254] EasySep? Human CD56 Positive Selection Kit was used to carry out CD56 depletion.

    Cytotoxicity Assay

    [0255] CAR T-cells were co-cultured with SupT1-NT and SupT1-PSMA at an effector to target ratio (E:T ratio) of 1:1, 1:4, or 1:8 (where the target cells are at a constant concentration of 50,000 cells per condition) in a TC-treated 96-well plate. Readouts were taken 24 hours post co-culture by staining with anti-CD3-PeCy7 and Qben10-APC to differentiate effector T-cells and target cells, 7-AAD dead cell stain was used to exclude dead cells. Cytotoxicity readouts were accessed by flow cytometry

    Cytokine ELISA

    [0256] Human IL-2 ELISA MAX? Deluxe and Human IFN-? ELISA MAX? Deluxe kits were used to access the levels of cytokine secreted into co-culture supernatants taken from Cytotoxicity Assay.

    Example 7pH Scouting

    [0257] The stability and affinity kinetics of binders at different levels of pH was investigated.

    Methodology

    Surface Plasmon Resonance

    [0258] Kinetic affinity for soluble PSMA at different pH was determined using Biacore T200 instrument. Recombinant purified antibodies were captured on a Protein A chip #6, pre-equilibrated the required PH (pH7.4, pH7, pH6.5 and pH6) using buffered HBS-P+, at 10 ?l/min for 60 s, aiming at 100 RU. Recombinant PSMA-His (sino biologicals) dialysed in HBS-P+buffer and adjusted to the required PH was used as analyte from 1 ?M with 1:2 serial dilutions for 10 points and flown at 30 ?l/min for 150 s with 300 s dissociation time. A double reference subtraction was applied. Sensograms fitted with 1:1 Langmuir model.

    Thermo-Stability

    [0259] Samples were normalised to 1 mg/ml in PBS buffered to the required PH (pH 7.4, pH 7, pH 6.5 and pH 6) and loaded onto standard glass capillaries (Nanotemper). Thermo-stability was determined by linear temperature increments of 1?C/min from 20? C. to 95? C. on Nanotemper Prometheus NT.48 instrument. Data analysed as first derivative of 350 nm/330 nm ratio.

    Results

    [0260] All antibodies tested showed an increased affinity towards the target protein at lower pH. Clones 7A12 and 7A12 humanised showed a higher thermal stability that was largely unaffected by change in pH conditions. These results support the conclusion of a more stable binder at physiological and tumour specific pH microenvironment for clone 7A12 compared to J591 (Table 4).

    TABLE-US-00008 TABLE 4 AU number Clone pH KD (M) Tm (? C.) 30531 7A12 7.4 2.293E?9 60.9 7 1.773E?9 61 6.5 1.019E?9 61.4 6 5.736E?10 61.7 42396 7A12 7.4 3.656E?9 73.5 humanised 7 3.301E?9 73.3 6.5 1.712E?9 73.1 6 5.320E?10 73 34494 J591 7.4 2.758E?9 53.3 7 2.543E?9 53.8 6.5 9.836E?10 55.8 6 5.508E?10 56.3

    [0261] All publications mentioned in the above specification are herein incorporated by reference. Various modifications and variations of the described methods and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in molecular biology or related fields are intended to be within the scope of the following claims.