METHODS AND ASSAYS FOR TREATING SUBJECTS WITH SHANK3 DELETION, MUTATION OR REDUCED EXPRESSION
20190076553 ยท 2019-03-14
Assignee
Inventors
- Joseph D. Buxbaum (New York, NY, US)
- Takeshi Sakurai (New York, NY, US)
- Ozlem Gunal (New York, NY, US)
Cpc classification
G01N2333/65
PHYSICS
A61K38/30
HUMAN NECESSITIES
G01N33/53
PHYSICS
A61K49/0008
HUMAN NECESSITIES
A61K31/00
HUMAN NECESSITIES
International classification
G01N33/53
PHYSICS
A61K31/00
HUMAN NECESSITIES
Abstract
Methods and assays are disclosed for treating subjects with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression, where the methods comprise administering to the subject insulin-like growth factor 1 (IGF-1), IGF-1-derived peptide or analog, growth hormone, an AMPAkine, a compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or an agent that activates the growth hormone receptor or the insulin-like growth factor 1 (IGF-1) receptor, or a downstream signaling pathway thereof.
Claims
1. A method for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, SHANK3 mutation or reduced expression of SHANK3, the method comprising administering to the subject insulin-like growth factor 1 (IGF-1), an active IGF-1 fragment including the tripeptide (1-3)IGF-1 or an analog thereof, growth hormone, an AMPAkine, or a compound that enhances glutamate neurotransmission, in an amount and manner effective to treat a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression.
2.-4. (canceled)
5. The method of claim 1, wherein the analog of (1-3)IGF-1 is selected from the group consisting of (1-3)IGF-1 amide, (1-3)IGF-1 stearate, Gly-Pro-D-glutamate, glycine-proline-threonine (Gly-Pro-Thr), glycine-glutamic acid-proline (Gly-Glu-Pro), glutamic acid-glycine-proline (Glu-Gly-Pro), and glutamic acid-proline-glycine (Glu-Pro-Gly).
6. The method of claim 1, wherein IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, compound that enhances glutamate neurotransmission, or agent is administered locally.
7. The method of claim 1, wherein IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, compound that enhances glutamate neurotransmission, or agent is administered systemically.
8-13. (canceled)
14. The method of claim 1, wherein the subject is human.
15. The method of claim 14, wherein the subject has autism, Asperger syndrome, autism spectrum disorder, pervasive developmental disorder, mental retardation, hypotonia, speech deficits, or a developmental delay and/or defect.
16. The method of claim 1, wherein IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, compound that enhances glutamate neurotransmission, or agent alleviates one or more of hypotonia; a motor deficit; absent speech; increased tolerance to pain; thin, flaky toenails; poor thermoregulation; chewing non-food items; teeth grinding; autistic behaviors; tongue thrusting; hair pulling; and aversion to clothes.
17. The method of claim 1, wherein the compound that enhances glutamate neurotransmission inhibits an inhibitory neurotransmitter.
18. The method of claim 17, wherein the inhibitory neurotransmitter is GABA.
19. A method for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, SHANK3 mutation or reduced expression of SHANK3, the method comprising administering to the subject insulin-like growth factor 1 (IGF-1) or an active IGF-1 fragment including the tripeptide (1-3)IGF-1 or an analog thereof, in an amount and manner effective to treat a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression, wherein the subject has autism spectrum disorder, autism, Asperger syndrome, pervasive developmental disorder, mental retardation, hypotonia, a speech deficit, or a developmental delay and/or defect.
20. (canceled)
21. A method for treating a human subject with Phelan-McDermid Syndrome comprising administering insulin-like growth factor 1 (IGF-1) to the human subject in an amount and manner effective to ameliorate delayed speech in a human subject with Phelan-McDermid Syndrome.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
DETAILED DESCRIPTION OF THE INVENTION
[0048] The present invention provides a method for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, SHANK3 mutation or reduced expression of SHANK3, in need thereof, the method comprising administering to the subject insulin-like growth factor 1 (IGF-1), an active IGF-1 fragment comprising the tripeptide (1-3)IGF-1 or an analog thereof, growth hormone, or an AMPAkine, or another compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, in an amount and manner effective to treat a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression. Reduced SHANK3 expression can be due, for example, to abnormal methylation of the gene encoding SHANK3.
[0049] The invention thus provides a method for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, SHANK3 mutation or reduced expression of SHANK3, the method comprising administering to the subject insulin-like growth factor 1 (IGF-1) or an active IGF-1 fragment including the tripeptide (1-3)IGF-1 or an analog thereof, in an amount and manner effective to treat a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression, wherein the subject has autism spectrum disorder, autism, Asperger syndrome, pervasive developmental disorder, mental retardation, hypotonia, a speech deficit, or developmental delay and/or defects.
[0050] The invention further provides a method for treating a subject with autism spectrum disorder, autism or Asperger syndrome comprising administering to the subject insulin-like growth factor 1 (IGF-1) or an active IGF-1 fragment including the tripeptide (1-3)IGF-1 or an analog thereof, in an amount and manner effective to treat a subject with autism spectrum disorder, autism, or Asperger syndrome.
[0051] The present invention also provides a method for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression in need thereof, the method comprising administering to the subject an agent that activates the growth hormone receptor, or a downstream signaling pathway thereof, or the insulin-like growth factor 1 (IGF-1) receptor, or a downstream signaling pathway thereof, or a downstream signaling pathway of (1-3)IGF-1, in an amount and manner effective to treat a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression. As discussed herein, growth hormone stimulates production of IGF-1, and the main downstream signaling pathways of the IGF-1 receptor are the phosphoinositide 3-kinase (PI3K), 3-phosphoinositide-dependent protein kinase 1 (PDK), Akt, mammalian target of rapamycin (mTOR), and extracellular-signal-regulated kinase (ERK) pathways. Examples of such agents include growth hormone, insulin-like growth factor 1 (IGF-1), the tripeptide (1-3)IGF-1 and analogs thereof.
[0052] As used herein, to treat a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, SHANK3 mutation or reduced expression of SHANK3 means to alleviate a sign or symptom associated with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression. The syndrome is characterized by general hypotonia, motor deficits, absent to delayed speech, and global developmental delays. Individuals with a 22q13 deletion or SHANK3 mutation can suffer from a range of symptoms, with mild to very serious physical and behavioral characteristics. Possible symptoms include, but are not limited to, absent to severely delayed speech; hypotonia; increased tolerance to pain; thin, flaky toenails; ptosis; poor thermoregulation; chewing non-food items; teeth grinding; autistic behaviors; tongue thrusting; hair pulling; aversion to clothes; as well as other physical and behavioral symptoms, including autism spectrum disorders and atypical schizophrenia.
[0053] The present invention also provides a method for screening for agents for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression, the method comprising determining whether or not the agent enhances long-term potentiation or increases glutamate transmission, wherein an agent that enhances long-term potentiation or increases glutamate transmission is a candidate for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression, whereas an agent that does not enhance long-term potentiation or increase glutamate transmission is not a candidate for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression. The assay can be carried out, for example, using mice with a disruption of at least one copy of SHANK3 (e.g., Shank3 heterozygous mice).
[0054] The present invention also provides a method for screening for agents for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression, the method comprising determining whether or not the agent activates the growth hormone receptor, or a downstream signaling pathway thereof, or the insulin-like growth factor 1 (IGF-1) receptor, or a downstream signaling pathway thereof, or a downstream signaling pathway of (1-3)IGF-1, wherein an agent that activates the growth hormone receptor, or a downstream signaling pathway thereof, or the insulin-like growth factor 1 (IGF-1) receptor, or a downstream signaling pathway thereof, or a downstream signaling pathway of (1-3)IGF-1 is a candidate for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression, whereas an agent that does not activate the growth hormone receptor, or a downstream signaling pathway thereof, or the insulin-like growth factor 1 (IGF-1) receptor, or a downstream signaling pathway thereof, or a downstream signaling pathway of (1-3)IGF-1 is not a candidate for treating a subject with 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression. Downstream signaling pathways of the IGF-1 receptor include the PI3K, PDK, Akt, mTOR and ERK pathways.
[0055] The assays can be carried out, for example, using a brain slice preparation, such as a hippocampal slice preparation, such as, for example, described herein in Experimental Details. Preferably, the brain slice is from an animal, such as a mouse, with a disruption of at least one copy of SHANK3 (e.g., a Shank3 heterozygous mouse).
[0056] Growth hormone (GH) is a protein based polypeptide hormone which stimulates growth and cell reproduction and regeneration in humans and other animals. Growth hormone is synthesized, stored, and secreted by the somatotroph cells in the anterior pituitary gland. Growth hormone is used clinically to treat children's growth disorders and adult growth hormone deficiency. Growth hormone stimulates production of IGF-1. Growth hormone can refer either to the natural hormone produced by the pituitary or biosynthetic growth hormone for therapy. Somatotropin refers to the growth hormone produced naturally in animals, whereas the term somatropin refers to growth hormone produced by recombinant DNA technology. In preferred embodiments, growth hormone is human growth hormone having the amino acid sequence (SEQ ID NO:1) (Accession AAH90045)
TABLE-US-00001 1 matgsrtslllafgllclpwlqegsafptiplsrlfdnamlrahrlhqlafdtyqefeea 61 yipkeqkysflqnpqtslcfsesiptpsnreetqqksnlellrisllliqswlepvqflr 121 svfanslvygasdsnvydllkdleegiqtlmgrledgsprtgqifkqtyskfdtnshndd 181 allknygllycfrkdmdkvetflrivqcrsvegscgf
or recombinant human growth hormone having the amino acid sequence (SEQ ID NO:2)
TABLE-US-00002 1 fptiplsrlfdnamlrahrlhqlafdtyqefeeayipkeqkysflqnpqtslcfsesipt 61 psnreetqqksnlellrisllliqswlepvqflrsvfanslvygasdsnvydllkdleeg 121 iqtlmgrledgsprtgqifkqtyskfdtnshnddallknygllycfrkdmdkvetflriv 181 qcrsvegscgf.
Recombinant human growth hormone is available, e.g., from Cell Sciences, Canton Mass. (Catalog No. CRH200A-C) (SEQ ID NO:2).
[0057] Insulin-like growth factor 1 (IGF-1), also known as somatomedin C or mechano growth factor, is a protein that is encoded by the IGF1 gene in humans. IGF-1 is a hormone similar in molecular structure to insulin. It plays an important role in childhood growth and continues to have an anabolic effect in adults. A synthetic analog of IGF-1, mecasermin, is used for the treatment of growth failure. IGF-1 is produced primarily by the liver as an endocrine hormone as well as in target tissues in a paracrine/autocrine fashion. Production is stimulated by growth hormone and can be retarded by undernutrition, growth hormone insensitivity, lack of growth hormone receptors, or failure of the downstream signaling pathway post growth hormone receptors including SHP2 and STAT5B. IGF-1 has substantial human safety data and is approved for use in children. In preferred embodiment, IGF-1 is recombinant human IGF-1 (a 7.6 kDa protein) having the amino acid sequence (SEQ ID NO:3)
TABLE-US-00003 1 gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy 61 caplkpaksa.
[0058] The tripeptide (1-3)IGF-1 has the amino acid sequence glycine-proline-glutamic acid (Gly-Pro-Glu or GPE). (1-3)IGF-1 can be obtained from Bachem (Torrance, Calif.) as H-Gly-Pro-Glu-OH (Catalog No. H-2468). The peptide has the advantage that it can penetrate the blood-brain barrier. Analogs of (1-3)IGF-1 that can be used include, but are not limited to, (1-3) IGF-1 amide, (1-3) IGF-1 stearate, Gly-Pro-Dglutamate, glycine-proline-threonine (Gly-Pro-Thr), glycine-glutamic acid-proline (Gly-Glu-Pro), glutamic acid-glycine-proline (Glu-Gly-Pro), and glutamic acid-proline-glycine (Glu-Pro-Gly).
[0059] AMPAkines are a class of compounds that strongly interact with glutamergic AMPA (-amino-3-hydroxyl-5-methyl-4-isoxazolepropionic acid) receptors. Glutamergic AMPA receptors are non-NMDA-type ionotropic transmembrane receptors for glutamate that mediates fast synaptic transmission in the central nervous system (CNS). To date, four structural classes of AMPAkines have been developed: pyrrolidine derivatives of racetam drugs such as piracetam and aniracetam; CX-series of drugs encompassing a range of benzoylpiperidine and benzoylpyrrilidine structures; benothiazide derivatives such as cyclothiazide and IDRA-21; and biarylpropylsulfonamides such as LY-392,098, LY-404,187, LY-451,646, and LY-503,430. AMPAkines bind to glutamergic AMPA receptors, boosting the activity of glutamate, a neurotransmitter, and making it easier to encode memory and learning. Some AMPAkines may increase levels of trophic factors such as brain-derived neurotrophic factor. Preferred AMPAkines include CX AMPAkines (Cortex Pharmaceuticals, Inc., Irvine, Calif.), such as for example CX-516 (Ampalex), CX-546, CX-614, CX-691 (Farampator), CX-717, CX-701, CX-1739, CX-1763 and CX-1837 (see, e.g., U.S. Pat. Nos. 5,650,409, 5,736,543, 5,985,871, 6,166,008, 6,313,115, and 7,799,913, and U.S. Patent Application Publications No. 2002/0055508, 2010/0041647, 2010/0173903, 2010/0267728, 2010/02866177, and 2011/0003835, the contents of which are herein incorporated by reference).
[0060] Compounds that directly or indirectly enhance glutamate neurotransmission including, for example, by inhibiting inhibitory (most typically GABA) transmission, include, for example, glycine transporter 1 (GLYT1) inhibitors, brain-derived neurotrophic factor (BDNF), and cyclothiazide. Cyclothiazide acts both on AMPA receptors and GABA(A) receptors. GLYT1 inhibitors are a functional class of compounds and include compounds that act as GABA(A) receptor negative allosteric modulators and inhibitors. Specific GLYT1 inhibitors include, for example, NFPS, Org 24461, and sarcosine.
[0061] IGF-1 interacts with its receptor (IGF-1R) to initiate downstream responses such as proliferation and differentiation. The IGF-1R is a transmembrane receptor that is activated by IGF-1 and by the related growth factor IGF-2. It belongs to the large class of tyrosine kinase receptors and mediates the effects of IGF-1. Tyrosine kinase receptors, including the IGF-1R, mediate their activity by causing the addition of a phosphate group to particular tyrosines on certain proteins within a cell. This addition of phosphate induces what are called cell signaling cascades - and the usual result of activation of the IGF-1R is survival and proliferation in mitosis-competent cells, and growth (hypertrophy) in tissues such as skeletal muscle and cardiac muscle. IGF-1R activates several downstream signaling pathways. The main downstream signaling pathways of IGF-1R are the PI3K, PDK, Akt, mTOR and ERK pathways.
[0062] Phosphoinositide 3-kinases (PI 3-kinases or PI3Ks) are a family of enzymes involved in cellular functions such as cell growth, proliferation, differentiation, motility, survival and intracellular trafficking. PI3Ks are downstream of IGF-1R and interact with the IRS (Insulin receptor substrate) in order to regulate cell function uptake through a series of phosphorylation events. The phosphoinositol-3-kinase family is divided into three different classes: Class I, Class II, and Class III. The classifications are based on primary structure, regulation, and in vitro lipid substrate specificity. PI3K has also been implicated in Long-term potentiation (LTP). PI3Ks are necessary for the survival of progenitors and mature oligodendrocytes and for the IGF-1-mediated cell survival, proliferation, and protein synthesis.
[0063] AKT protein family, which members are also called protein kinases B (PKB) plays an important role in mammalian cellular signaling. In humans, there are three genes in the Akt family: Akt1, Akt2, and Akt3. These genes code for enzymes that are members of the serine/threonine-specific protein kinase family. Akt1 is involved in cellular survival pathways, by inhibiting apoptotic processes. Akt1 is also able to induce protein synthesis pathways, and is therefore a key signaling protein in the cellular pathways that lead to skeletal muscle hypertrophy, and general tissue growth. Akt2 is an important signaling molecule in the insulin signaling pathway. It is required to induce glucose transport. Akt can be phosphorylated by PDK1 and mTORC2. Beside downstream effectors of PI3K, Akt can be activated in a PI3K-independent manner. Akt2 is required for the insulin-induced translocation of glucose transporter 4 (GLUT4) to the plasma membrane. Glycogen synthase kinase 3 (GSK-3) could be inhibited upon phosphorylation by Akt, which results in promotion of glycogen synthesis. Akt inhibitors and dominant-negative Akt expression can block IGF-1 stimulated protein synthesis in oligodendrocyte progenitors.
[0064] 3-phosphoinositide dependent protein kinase-1 (PDK1) is a protein which in humans is encoded by the PDPK1 gene and is a master kinase crucial for the activation of AKT/PKB and many other AGC kinases including PKC, S6K, and SGK. An important role for PDK1 is in the signalling pathways activated by several growth factors and hormones including insulin signalling. PDK1 functions downstream of PI3K through PDK1's interaction with membrane phospholipids including phosphatidylinositols, phosphatidylinositol (3,4)-bisphosphate and phosphatidylinositol (3,4,5)-trisphosphate. PI3K indirectly regulates PDPK1 by phosphorylating phosphatidylinositols which in turn generates phosphatidylinositol (3,4)-bisphosphate and phosphatidylinositol (3,4,5)-trisphosphate.
[0065] The mammalian target of rapamycin (mTOR), also known as mechanistic target of rapamycin or FK506 binding protein 12-rapamycin associated protein 1 (FRAP1), is a protein which in humans is encoded by the FRAP1 gene. mTOR is a serine/threonine protein kinase that regulates cell growth, cell proliferation, cell motility, cell survival, protein synthesis, and transcription. mTOR integrates the input from upstream pathways, including insulin, growth factors (such as IGF-1 and IGF-2), and mitogens. mTOR also senses cellular nutrient and energy levels and redox status.
[0066] Extracellular-signal-regulated kinases (ERKs), or classical MAP kinases, are widely expressed protein kinase intracellular signalling molecules that are involved in functions including the regulation of meiosis, mitosis, and postmitotic functions in differentiated cells. Many different stimuli, including growth factors (such as IGF-1 and IGF-2), cytokines, virus infection, ligands for heterotrimeric G protein-coupled receptors, transforming agents, and carcinogens, activate the ERK pathway.
[0067] The 22q13 deletion syndrome or SHANK3 deletion or duplication, mutation or reduced expression can be treated by local or systemic administration of the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or other therapeutic agent. Local treatment may comprise intramuscular or intratissue injection. Systemic treatment may comprise enteral or intravenous methods. The IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or agent may be administered in a pharmaceutical composition comprising the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or agent in a pharmaceutically acceptable carrier.
[0068] The pharmaceutically acceptable carrier must be compatible with the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or agent, and not deleterious to the subject. Examples of acceptable pharmaceutical carriers include carboxymethylcellulose, crystalline cellulose, glycerin, gum arabic, lactose, magnesium stearate, methylcellulose, powders, saline, sodium alginate, sucrose, starch, talc, and water, among others. Formulations of the pharmaceutical composition may conveniently be presented in unit dosage and may be prepared by any method known in the pharmaceutical art. For example, the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or agent may be brought into association with a carrier or diluent, as a suspension or solution. Optionally, one or more accessory ingredients, such as buffers, flavoring agents, surface-active ingredients, and the like, may also be added. The choice of carriers will depend on the method of administration. The pharmaceutical composition can be formulated for administration by any method known in the art, including but not limited to, intravenously and intracranially.
[0069] The amount of IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or agent therapeutically necessary will depend on the severity of the 22q13 deletion syndrome or SHANK3 mutation as well as the manner of administration of the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or agent. One skilled in the art can easily determine the amount and manner of administration of IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or agent necessary.
[0070] According to the method of the present invention, the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or other therapeutic agent may be administered to a subject by any known procedure including, but not limited to, oral administration, parenteral administration, transdermal administration, intranasal administration, and administration through an osmotic mini-pump.
[0071] For oral administration, the formulation of the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or other therapeutic agent may be presented as capsules, tablets, powder, granules, or as a suspension. The formulation may have conventional additives, such as lactose, mannitol, corn starch, or potato starch. The formulation may also be presented with binders, such as crystalline cellulose, cellulose derivatives, acacia, corn starch, or gelatins. Additionally, the formulation may be presented with disintegrators, such as corn starch, potato starch, or sodium carboxymethylcellulose. The formulation also may be presented with dibasic calcium phosphate anhydrous or sodium starch glycolate. Finally, the formulation may be presented with lubricants, such as talc or magnesium stearate.
[0072] For a parenteral administration, the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or other therapeutic agent may be combined with a sterile aqueous solution which is preferably isotonic with the blood of the subject. Such a formulation may be prepared by dissolving a solid active ingredient in water containing physiologically-compatible substances, such as sodium chloride, glycine, and the like, and having a buffered pH compatible with physiological conditions, so as to produce an aqueous solution, then rendering said solution sterile. The formulations may be present in unit or multi-dose containers, such as sealed ampoules or vials. The formulation may be delivered by any mode of injection, including, without limitation, epifascial, intrasternal, intravascular, intravenous, parenchymatous, or subcutaneous.
[0073] For transdermal administration, the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or other therapeutic agent may be combined with skin penetration enhancers, such as propylene glycol, polyethylene glycol, isopropanol, ethanol, oleic acid, N-methylpyrrolidone, and the like, which increase the permeability of the skin to the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or other therapeutic agent. The IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or other therapeutic agent compositions also may be further combined with a polymeric substance, such as ethylcellulose, hydroxypropyl cellulose, ethylene/vinylacetate, polyvinyl pyrrolidone, and the like, to provide the composition in gel form, which may be dissolved in solvent such as methylene chloride, evaporated to the desired viscosity, and then applied to backing material to provide a patch.
[0074] The IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or other therapeutic agent may also be released or delivered from an osmotic mini-pump. The release rate from an elementary osmotic mini-pump may be modulated with a microporous, fast-response gel disposed in the release orifice. An osmotic mini-pump would be useful for controlling the release of, or targeting delivery of, the IGF-1, IGF-1-derived peptide or analog, growth hormone, AMPAkine, or other compound that directly or indirectly enhances glutamate neurotransmission, including by inhibiting inhibitory (most typically GABA) transmission, or other therapeutic agent.
[0075] Long-term potentiation (LTP) is a long-lasting enhancement in signal transmission between two neurons that results from stimulating them synchronously. It is one of several phenomena underlying synaptic plasticity, the ability of chemical synapses to change their strength. LTP shares many features with long-term memory, making it an attractive candidate for a cellular mechanism of learning. For example, LTP and long-term memory are triggered rapidly, each depends upon the synthesis of new proteins, each has properties of associativity, and each can last for many months. LTP may account for many types of learning, from the relatively simple classical conditioning present in all animals, to the more complex, higher-level cognition observed in humans. At a cellular level, LTP enhances synaptic transmission. It improves the ability of two neurons, one presynaptic and the other postsynaptic, to communicate with one another across a synapse.
[0076] Chemical synapses are functional connections between neurons throughout the nervous system. In a typical synapse, information is largely passed from the first (presynaptic) neuron to the second (postsynaptic) neuron via a process of synaptic transmission. Through experimental manipulation, a non-tetanic stimulus can be applied to the presynaptic cell, causing it to release a neurotransmitter such as glutamate onto the postsynaptic cell membrane. There, glutamate binds to receptors such as AMPA receptors (AMPARs) embedded in the postsynaptic membrane. The AMPA receptor is one of the main excitatory receptors in the brain, and is responsible for most of its rapid, moment-to-moment excitatory activity. Glutamate binding to the AMPA receptor triggers the influx of positively charged sodium ions into the postsynaptic cell, causing a short-lived depolarization called the excitatory postsynaptic potential (EPSP). Extracellular-signal-regulated kinases (ERKs) play a role in late LTP, where gene expression and protein synthesis is brought about by the persistent activation of protein kinases activated during early LTP. ERK phosphorylates a number of cytoplasmic and nuclear molecules that ultimately result in the protein synthesis and morphological changes observed in late LTP. ERK-mediated changes in transcription factor activity may trigger the synthesis of proteins that underlie the maintenance of L-LTP.
[0077] An excitatory postsynaptic potential (EPSP) is a temporary depolarization of postsynaptic membrane potential caused by the flow of positively charged ions into the postsynaptic cell as a result of opening of ligand-sensitive channels. ESPSs in living cells are caused chemically. When an active presynaptic cell releases neurotransmitters into the synapse, some bind to receptors on the postsynaptic cell. Many of these receptors contain an ion channel capable of passing positively charged ions either into or out of the cell. The depolarizing current causes an increase in membrane potential, the ESPS. The amino acid glutamate is the neurotransmitter most often associated with EPSPs.
[0078] Glutamate is the most abundant excitatory neurotransmitter in the vertebrate nervous system. At chemical synapses, glutamate is stored in vesicles. Nerve impulses trigger release of glutamate from the pre-synaptic cell. In the opposing post-synaptic cell, glutamate receptors, such as the NMDA receptor, bind glutamate and are activated. Because of its role in synaptic plasticity, glutamate is involved in cognitive functions like learning and memory in the brain. The form of plasticity known as long-term potentiation takes place at glutamatergic synapses in the hippocampus, neocortex, and other parts of the brain. Glutamate does not work only as a point to point transmitter but also through spill-over synaptic crosstalk between synapses in which summation of glutamate released from neighboring synapse creates extrasynaptic signaling/volume transmission.
[0079] Glutamate transporters are found in neuronal and glial membranes. They rapidly remove glutamate from the extracellular space. In brain injury or disease, they can work in reverse and excess glutamate can accumulate outside cells. This process causes calcium ions to enter cells via NMDA receptor channels, leading to neuronal damage and eventual cell death, and is called excitotoxicity.
[0080] The subject can be any mammal, in particular a human. The subject can have, for example, one or more of autism, Asperger syndrome, autism spectrum disorder, pervasive developmental disorder, mental retardation, hypotonia, speech deficits and developmental delay and/or defects.
EXPERIMENTAL DETAILS
[0081] Brief Experimental Procedures:
[0082] Hippocampal slices (350 m) are prepared from 1-3 month old Shank3 heterozygous, Shank3 knockout, and wildtype littermates, treated with (1-3) IGF-1 peptide, full-length IGF1, growth hormone, AMPAkine or saline or other appropriate control. Slices are perfused with Ringer's solution, bubbled with 95% O.sub.2/5% CO.sub.2, at 32 C., during extracellular recordings. Baseline of field excitatory postsynaptic potentials (fEPSPs) recorded from stratum radiatum in area CA1, evoked by stimulation of the Schaffer collateral-commissural afferents with bipolar tungsten electrodes placed into area CA3. Long-term potentiation (LTP) is induced either by a high-frequency stimulus (four trains of 100 Hz, 1 s stimulation separated by 5 min), or by theta-burst stimulation (TBS) (10 bursts of four pulses at 100 Hz separated by 200 ms), with a success rate >90% for control and genetically-modified animals with all stimulation protocols. To induce long-term depression (LTD), Schaffer collaterals were stimulated by a low frequency stimulus (900 pulses at 1 Hz for 15 min) or paired-pulse low frequency stimulus. LTD was induced with a success rate >90% for control animals. In order to examine Akt phosphorylation hippocampus and cortex are dissected from the other hemisphere from Shank3 heterozygous and wildtype littermates, used to make slices and are immediately snap-frozen on dry ice. Western blot analysis is performed for total- and phospho-Akt levels. Results are presented in
[0083] A mouse with hemizygous loss of full-length Shank3 (Bozdagi et al., 2010) was used to investigate whether IGF-1 could reverse synaptic deficits in a preclinical model. Tests were first made with an active peptide of IGF-1 ((1-3)IGF-1), which has been shown to cross the blood-brain barrier (O'Kusky et al., 2000) and rescue Rett syndrome symptoms in Mecp2-deficient mice. Intraperitoneal injection at 10 g/g/day for 2 weeks restored normal hippocampal LTP in Shank3 heterozygous mice (
[0084] IGF-1 has been approved for clinical use as a recombinant full-length protein. Full-length IGF-1 enters the CNS through an interaction with lipoprotein-related receptor 1 (LRP1), after activity dependent cleavage of IGF binding protein-3 (IGFBP-3) by matrix metalloproteinase-9 (MMP9) (Nishijima et al., 2010). To investigate whether peripherally administered full-length IGF-1 could also reverse synaptic deficits, IGF-1 was administered by intraperitoneal injection at 240 g/kg/day, starting at P13-15 and continuing for 2 weeks. This dose was chosen because it represents the maximum dose according to the current FDA label for IGF-1. This treatment was also effective in rescuing defective LTP in heterozygous mice (
[0085] Phelan-McDermid syndrome frequently presents with hypotonia and at least transient motor deficits, and subtle motor deficits have been observed in Shank3-heterozygous mice (Bozdagi et al., 2010). To determine whether treatment with full-length IGF-1 may improve motor performance in Shank3-deficient mice, male heterozygous mice were treated with either vehicle or IGF-1 (240 g/kg/day for 2 weeks). Significant enhancement of motor performance was observed following treatment (
[0086] To date, pharmacological treatments for ASD and other neurodevelopmental disorders are primarily ameliorative, focusing on managing associated symptoms such as anxiety, aggression, repetitive behaviors, or epilepsy (King et al., 2006). Pharmacological treatments addressing core deficits, such as cognitive impairments, social deficits, and absent or delayed speech, do not yet exist. Recently, however, the field has begun to see the evaluation of therapies targeted to etiology (personalized medicine) - - - each arising from the basic analysis of model systems - - - in neurodevelopmental disorders including Fragile X syndrome, tuberous sclerosis, and Rett syndrome (Bear et al., 2004; Ehninger et al., 2009; Tropea et al., 2009).
[0087] It is interesting to note that IGF-1 activates the mTOR/Akt pathway as this has been implicated in other neurodevelopmental disorders (Veenstra-Vanderweele et al., 2012). It was therefore predicted that phospho-Akt/Akt ratios would be increased after IGF-1 treatment, and this is what was observed in studies in hippocampal lysates (0.360.03 and 0.550.04 in Shank3 heterozygous mice injected for 2 weeks with vehicle [n=8] or full-length IGF-1 protein [n=10], respectively; 1-tailed p=0.040).
[0088] Loss of one functional copy of the SHANK3 gene, through either mutation or deletion, is found in about 0.5% of ASD (Abrahams and Geschwind, 2008) and in about 0.3% of the developmentally delayed population (Cooper et al., 2011). As such it represents one of the more frequent causes of these disorders and a significant health burden. In addition, there is emerging evidence that the SHANK3 pathway may play a role in other neurodevelopmental disorders, as evidenced by large-scale proteomic and gene expression studies (Darnell et al., 2011; Sakai et al., 2011). Even more broadly, deficits in proteins associated with the postsynaptic density, which is in no small degree sculpted by SHANK3 (Roussignol et al., 2005), are associated with neurodevelopmental disorders (Laumonnier et al., 2007). Mutations in SHANK3 are also associated with schizophrenia (Gauthier et al., 2010). This indicates that therapies for SHANK3 deficiency and synaptic development represent important targets that can have broad positive impact in neurodevelopmental disorders (Melom and Littleton, 2011). These results show that IGF-1, approved for use in children, can lead to functional improvements in a mouse model of ASD and developmental delay, representing an important preclinical step.
REFERENCES
[0089] Abrahams, B. S. & Geschwind, D. H. Advances in autism genetics: on the threshold of a new neurobiology. Nature reviews. Genetics 9, 341-355 (2008). [0090] Bats C, Groc L, Choquet D. The interaction between Stargazin and PSD-95 regulates AMPA receptor surface trafficking. Neuron. 2007 Mar. 1; 53(5):719-34. [0091] Bangash M A, Park J M, Melnikova T, Wang D, Jeon S K, Lee D, Syeda S, Kim J, Kouser M, Schwartz J, Cui Y, Zhao X, Speed H E, Kee S E, Tu J C, Hu J H, Petralia R S, et al. Enhanced Polyubiquitination of Shank3 and NMDA Receptor in a Mouse Model of Autism. Cell. 2011 May 11. [Epub ahead of print]. [0092] Baron, Marisa K, Tobias M Boeckers, Bianca Vaida, Salem Faham, Mari Gingery, Michael R Sawaya, et al. 2006. An architectural framework that may lie at the core of the postsynaptic density. Science 311, no. 5760 (January 27): 531-5. [0093] Bear, M. F., Huber, K. M. & Warren, S. T. The mGluR theory of fragile X mental retardation. Trends Neurosci 27, 370-377 (2004). [0094] Beri, Silvana, Noemi Tonna, Giorgia Menozzi, Maria Clara Bonaglia, Carlo Sala, Roberto Giorda, et al. 2007. DNA methylation regulates tissue-specific expression of Shank3. Journal of Neurochemistry 101, no. 5 (June): 1380-91. [0095] Boeckers, T M. 2006. The postsynaptic density. Cell and Tissue Research 326, no. 2 (November): 409-22. [0096] Bonaglia, M C, R Giorda, R Borgatti, G Felisari, C Gagliardi, A Selicorni, et al. 2001. Disruption of the ProSAP2 gene in a t(12;22)(q24.1;q13.3) is associated with the 22q13.3 deletion syndrome. American Journal of Human Genetics 69 (2): 261-8. [0097] Bonaglia, M C, R Giorda, E Mani, G Aceti, B-M Anderlid, A Baroncini, et al. 2006. Identification of a recurrent breakpoint within the SHANK3 gene in the 22q13.3 deletion syndrome. Journal of Medical Genetics 43, no. 10 (October): 822-8. [0098] Bonaglia M C, et al. Molecular mechanisms generating and stabilizing terminal 22q13 deletions in 44 subjects with Phelan/McDermid syndrome. PLoS Genet. 2011 July; 7(7):e1002173. Epub 2011 Jul. 14. [0099] Bozdagi O, Sakurai T, Papapetrou D, Wang X, Dickstein D L, Takahashi N, Kajiwara Y, Yang M, Katz A M, Scattoni M L, Harris M J, Saxena R, Silverman J L, Crawley J N, Zhou Q, Hof P R, Buxbaum J D. Haploinsufficiency of the autism-associated Shank3 gene leads to deficits in synaptic function, social interaction, and social communication. Mol Autism. 2010 Dec. 17; 1(1):15. [0100] Brakeman P R, Lanahan A A, O'Brien R, Roche K, Barnes C A, Huganir R L, Worley P F. Homer: a protein that selectively binds metabotropic glutamate receptors. Nature. 1997 Mar. 20; 386(6622):284-8. [0101] Ching, Tsui-Ting, Alika K Maunakea, Peter Jun, Chibo Hong, Giuseppe Zardo, Daniel Pinkel, et al. 2005. Epigenome analyses using BAC microarrays identify evolutionary conservation of tissue-specific methylation of SHANK3. Nature Genetics 37, no. 6 (June): 645-51. [0102] Cooper, G. M. et al. A copy number variation morbidity map of developmental delay. Nature genetics 43, 838-846 (2011). [0103] Darnell, J. C. et al. FMRP stalls ribosomal translocation on mRNAs linked to synaptic function and autism. Cell 146, 247-261 (2011). [0104] Durand, Christelle M, Catalina Betancur, Tobias M Boeckers, Juergen Bockmann, Pauline Chaste, Fabien Fauchereau, et al. 2007. Mutations in the gene encoding the synaptic scaffolding protein SHANK3 are associated with autism spectrum disorders. Nature Genetics 39, no. 1 (January): 25-7. [0105] Ehninger, D., de Vries, P. J. & Silva, A. J. From mTOR to cognition: molecular and cellular mechanisms of cognitive impairments in tuberous sclerosis. J Intellect Disabil Res 53, 838-851 (2009). [0106] Farr, Carol D, Philip R Gafken, Angela D Norbeck, Catalin E Doneanu, Martha D Stapels, Douglas F Barofsky, et al. 2004. Proteomic analysis of native metabotropic glutamate receptor 5 protein complexes reveals novel molecular constituents. Journal of Neurochemistry 91, no. 2 (October): 438-50. [0107] Gauthier J, Spiegelman D, Piton A, Lafreniere R G, Laurent S, St-Onge J, Lapointe L, Hamdan F F, Cossette P, Mottron L, Fombonne E, Joober R, Marineau C, Drapeau P, Rouleau G A. Novel de novo SHANK3 mutation in autistic patients. Am J Med Genet B Neuropsychiatr Genet. 2009 Apr. 5; 150B(3):421-4. [0108] Gauthier J, Champagne N, Lafrenire R G, Xiong L, Spiegelman D, Brustein E, Lapointe M, Peng H, Cote M, Noreau A, Hamdan F F, Addington A M, Rapoport J L, et al. De novo mutations in the gene encoding the synaptic scaffolding protein SHANK3 in patients ascertained for schizophrenia. Proc Natl Acad Sci USA. 2010 Apr. 27; 107(17):7863-8. Epub 2010 Apr. 12. [0109] Hamdan F F, Gauthier J, Araki Y, Lin D T, Yoshizawa Y, Higashi K, Park A R, Spiegelman D, Dobrzeniecka S, Piton A, Tomitori H, Daoud H, Massicotte C, Henrion E, et al. Excess of de novo deleterious mutations in genes associated with glutamatergic systems in nonsyndromic intellectual disability. Am J Hum Genet. 2011 Mar. 11; 88(3):306-16. Epub 2011 Mar. 3. [0110] Hering, Heike, and Morgan Sheng. 2003. Activity-dependent redistribution and essential role of cortactin in dendritic spine morphogenesis. J Neurosci 23 (37): 11759-69. [0111] Hung A Y, Futai K, Sala C, Valtschanoff J G, Ryu J, Woodworth M A, Kidd F L, Sung C C, Miyakawa T, Bear M F, Weinberg R J, Sheng M. Smaller dendritic spines, weaker synaptic transmission, but enhanced spatial learning in mice lacking Shankl. J Neurosci 2008; 28(7): 1697-1708. [0112] Husi, H, M A Ward, J S Choudhary, W P Blackstock, and S G Grant. 2000. Proteomic analysis of NMDA receptor-adhesion protein signaling complexes. Nature Neuroscience 3, no. 7 (July): 661-9. [0113] King, B. H. & Bostic, J. Q. An update on pharmacologic treatments for autism spectrum disorders. Child Adolesc Psychiatr Clin N Am 15, 161-175, (2006). [0114] Luciani J J, de Mas P, Depetris D, Mignon-Ravix C, Bottani A, Prieur M, Jonveaux P, Philippe A, Bourrouillou G, de Martinville B, Delobel B, Vallee L, Croquette M F, Mattei M G. Telomeric 22q13 deletions resulting from rings, simple deletions, and translocations: cytogenetic, molecular, and clinical analyses of 32 new observations. J Med Genet 2003; 40(9): 690-696. [0115] Melom, J. E. & Littleton, J. T. Synapse development in health and disease. Current opinion in genetics & development 21, 256-261 (2011). [0116] Moessner R, Marshall C R, Sutcliffe J S, Skaug J, Pinto D, Vincent J, Zwaigenbaum L, Fernandez B, Roberts W, Szatmari P, Scherer S W. Contribution of SHANK3 mutations to autism spectrum disorder. Am J Hum Genet 2007; 81(6): 1289-1297. [0117] Naisbitt, S, E Kim, J C Tu, B Xiao, C Sala, J Valtschanoff, et al. 1999. Shank, a novel family of postsynaptic density proteins that binds to the NMDA receptor/PSD-95/GKAP complex and cortactin. Neuron 23, no. 3 (July): 569-82. [0118] Nishijima, T. et al. Neuronal activity drives localized blood-brain-barrier transport of serum insulin-like growth factor-I into the CNS. Neuron 67, 834-846 (2010). [0119] Okabe, Shigeo. 2007. Molecular anatomy of the postsynaptic density. Molecular and Cellular Neurosciences 34, no. 4 (April): 503-18. [0120] O'Kusky, J. R., Ye, P. & D'Ercole, A. J. Insulin-like growth factor-I promotes neurogenesis and synaptogenesis in the hippocampal dentate gyrus during postnatal development. The Journal of Neuroscience 20, 8435-8442 (2000). [0121] Pea J, Feliciano C, Ting J T, Wang W, Wells M F, Venkatraman T N, Lascola C D, Fu Z, Feng G. Shank3 mutant mice display autistic-like behaviours and striatal dysfunction. Nature. 2011 Apr. 28; 472(7344):437-42. Epub 2011 Mar. 20. [0122] Phelan M C, Rogers R C, Saul R A, Stapleton G A, Sweet K, McDermid H, Shaw S R, Claytor J, Willis J, Kelly D P. 22q13 deletion syndrome. Am J Med Genet 2001; 101: 91-9. [0123] Qiao, Feng, and James U Bowie. 2005. The many faces of SAM. Science's STKE: signal transduction knowledge environment 2005, no. 286 (May 31): rel. [0124] Roussignol, Gautier, Fabrice Ango, Stefano Romorini, Jian Cheng Tu, Carlo Sala, Paul F Worley, et al. 2005. Shank expression is sufficient to induce functional dendritic spine synapses in aspiny neurons. Journal of Neuroscience 25(14) (April 6): 3560-70. [0125] Sakai, Y. et al. Protein interactome reveals converging molecular pathways among autism disorders. Science translational medicine 3, 86ra49 (2011). [0126] Sala, C, V Piech, N R Wilson, M Passafaro, G Liu, M Sheng, et al. 2001. Regulation of dendritic spine morphology and synaptic function by Shank and Homer. Neuron 31, no. 1 (July 19): 115-30. [0127] Sala, Carlo, Gautier Roussignol, Jacopo Meldolesi, and Laurent Fagni. 2005. Key role of the postsynaptic density scaffold proteins Shank and Homer in the functional architecture of Ca2+ homeostasis at dendritic spines in hippocampal neurons. J Neurosci 25(18): 4587-92. [0128] Sugiyama, Yoshiko, Izumi Kawabata, Kenji Sobue, and Shigeo Okabe. 2005. Determination of absolute protein numbers in single synapses by a GFP-based calibration technique. Nature Methods 2, no. 9 (September): 677-84. [0129] Tropea, D. et al. Partial reversal of Rett Syndrome-like symptoms in MeCP2 mutant mice. Proceedings of the National Academy of Sciences of the United States of America 106, 2029-2034 (2009). [0130] Tu J C, Xiao B, Naisbitt S, Yuan J P, Petralia R S, Brakeman P, Doan A, Aakalu V K, Lanahan A A, Sheng M, Worley P F. Coupling of mGluR/Homer and PSD-95 complexes by the Shank family of postsynaptic density proteins. Neuron 1999; 23(3): 583-592. [0131] Uchino S, Wada H, Honda S, Nakamura Y, Ondo Y, Uchiyama T, Tsutsumi M, Suzuki E, Hirasawa T, Kohsaka S. Direct interaction of post-synaptic density-95/Dlg/ZO-1 domain-containing synaptic molecule Shank3 with GluR1 alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionic acid receptor. J Neurochem 2006; 97(4): 1203-14. [0132] Veenstra-Vanderweele, J. & Blakely, R. D. Networking in autism: leveraging genetic, biomarker and model system findings in the search for new treatments. Neuropsychopharmacology 37, 196-212 (2012). [0133] Vorstman, J A S, W G Staal, E van Daalen, H van Engeland, P F R Hochstenbach, L Franke, et al. 2006. Identification of novel autism candidate regions through analysis of reported cytogenetic abnormalities associated with autism. Molecular Psychiatry 11, no. 1 (January): 1, 18-28. [0134] Wang X, McCoy P, Rodriguiz R M, Pan Y, Je H S, Roberts A, Kim C, Berrios J, Colvin J S, Bousquet-Moore D, Lorenzo I, Wu G, Weinberg R J, Ehlers M D, Philpot B D, Beaudet A L, Wetsel W C, Jiang Y H. Synaptic dysfunction and abnormal behaviors in mice lacking major isoforms of Shank3. Hum Mol Genet. 2011 May 10. [0135] Wilson H L, Wong A C, Shaw S R, Tse W Y, Stapleton G A, Phelan M C, Hu S, Marshall J, McDermid H E. Molecular characterisation of the 22q13 deletion syndrome supports the role of haploinsufficiency of SHANK3/PROSAP2 in the major neurological symptoms. J Med Genet. 2003 August; 40(8):575-84. [0136] Wong, A C, Y Ning, J Flint, K Clark, J P Dumanski, D H Ledbetter, et al. 1997. Molecular characterization of a 130-kb terminal microdeletion at 22q in a child with mild mental retardation. American Journal of Human Genetics 60 (1): 113-20.