GROUP B ADENOVIRUS ENCODING AN ANTI-TCR-COMPLEX ANTIBODY OR FRAGMENT

20190077865 ยท 2019-03-14

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure relates to a replication deficient oncolytic viral vector or replication capable group B oncolytic adenovirus selected from the group consisting of Ad11 and enadenotucirev, wherein the virus encodes an antibody or a binding fragment thereof for expression on the surface of a cancer cell, wherein said antibody or binding fragment is specific to a CD3 protein of a T-cell receptor complex (TCR), wherein the virus does not encode a B7 protein or an active fragment thereof, pharmaceutical compositions comprising the same, and use of any one of the same in treatment, particularly in the treatment of cancer.

    Claims

    1. A replication deficient oncolytic viral vector or replication capable group B oncolytic adenovirus selected from the group consisting of Ad11 and enadenotucirev, wherein the virus encodes an antibody or a binding fragment thereof for expression on the surface of a cancer cell, wherein said antibody or binding fragment is specific to a CD3 protein of a T-cell receptor complex (TCR), wherein the virus does not encode a B7 protein or an active fragment thereof.

    2. A replication deficient oncolytic viral vector or replication capable group B oncolytic adenovirus according to claim 1 wherein the virus is Ad11.

    3. A replication deficient oncolytic viral vector or replication capable oncolytic virus according to claim 1 or claim 2, wherein the virus is replication competent.

    4. A replication deficient oncolytic viral vector or replication capable oncolytic virus s according to claim 1 or claim 2, wherein the virus is replication deficient.

    5. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to any one of claims 1 to 4 wherein the encoded antibody further comprises a transmembrane domain or a GPI anchor.

    6. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claim 5, wherein the transmembrane domain is selected from a sequence shown in SEQ ID NO: 10 to 14.

    7. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to any one of claims 1 to 6, wherein the oncolytic adenovirus is EnAd.

    8. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to any one of claims 1 to 7, wherein the antibody or binding fragment is selected from the group comprising a full length antibody, a Fab, modified Fab, Fab, modified Fab, F(ab)2, Fv, single domain antibodies, scFv, bi, tri or tetra-valent antibodies, Bis-scFv, diabodies, triabodies, tetrabodies, humabodies, disulfide stabilised forms of any one of the same and epitope-binding fragments thereof.

    9. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claims 1 to 8, wherein the antibody binding fragment is a single chain Fv.

    10. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to any one of claims 1 to 9, wherein the oncolytic virus encodes at least one further transgene.

    11. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claim 10, wherein the oncolytic virus encodes at least two further transgenes.

    12. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claim 10 or 11, wherein the further transgene(s) encode(s) a protein independently selected from the group comprising a cytokine, a chemokine, an antagonistic antibody molecule or binding fragment thereof, an agonistic antibody molecule or binding fragment thereof, an immunomodulator and combinations thereof.

    13. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claim 12, wherein at least one further transgene encodes an antibody molecule or a binding fragment thereof (for example which may be in a surface expressed form and/or secreted form).

    14. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claim 13, wherein the antibody molecule or binding fragment is an inhibitor.

    15. A replication deficient oncolytic viral vector or a replication competent oncolytic virus according to claim 14, wherein the inhibitor is an inhibitor of an angiogenesis factor or an inhibitor of a T cell deactivating factor.

    16. A replication deficient oncolytic viral vector or a replication competent oncolytic virus according to any one of claims 13 to 15, wherein antibody molecule or binding fragment is an agonist.

    17. A replication deficient oncolytic viral vector or a replication competent oncolytic virus according to claim 16, wherein the agonist is independently selected from the group comprising antibodies to CD40, GITR, OX40, CD27 and 4-1BB.

    18. A replication deficient oncolytic viral vector or a replication competent oncolytic virus according to any one of claims 12 to 17 where the immunomodulator is a membrane-associated protein ligand for immune cell surface receptors selected from the group comprising CTLA-4, PD-1, PD-L1, PD-L2, VISTA, B7-H3, B7-H4, HVEM, ILT-2, ILT-3, ILT-4, TIM-3, LAG-3, BTLA, LIGHT or CD160, for example CTLA-4, PD-1, PD-L1, PD-L2, CD16, CD25, CD33, CD332, CD127, CD31, CD43, CD44, CD162, CD301a, CD301b and Galectin-3, FLT-3, FLT-3 ligand, TLRs, TLR ligands, CCR7, CD1a, CD1c, CD11b, CD11c, CD80, CD83, CD86, CD123, CD172a, CD205, CD207, CD209, CD273, CD281, CD283, CD286, CD289, CD287, CXCR4, GITR Ligand, IFN-?2, IL-12, IL-23, ILT1, ILT2, ILT3, ILT4, ILT5, ILT7, TSLP Receptor, CD141, CD303, CADM1, CLEC9a, XCR1 and CD304, OX40, OX40 ligand, CD27, CD28, CD30, CD40, CD40 ligand, CD70, CD137, GITR, 4-1BB, ICOS and ICOS ligand.

    19. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to any one of claims 10 to 18, wherein at least one further transgene encodes a cytokine (including secreted or cell membrane associated molecules).

    20. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to any one of claims 11 to 19, wherein a second further transgene encodes a cytokine (including secreted or cell membrane associated molecules).

    21. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to any one claim 19 or 20, wherein the encoded cytokine is independently selected from TNF alpha super family (TNFSF includes TNF-alpha, TNF-C, OX40L, CD154, FasL, LIGHT, TL1A, CD70, Siva, CD153, 4-1BB ligand, TRAIL, RANKL, TWEAK, APRIL, BAFF, CAMLG, NGF, BDNF, NT-3, NT-4, GITR ligand, EDA-A, EDA-A2), TGF-beta superfamily, IL-1 family (i.e. IL-1 and IL-18), IL-2 family, IL-10 family, IL-17 family, interferon family.

    22. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claim 21, wherein the encoded cytokine is independently selected from TNF-alpha, IL-1, IL-8, IL-10, IL-17, interferon, LIGHT, TL1A, Siva, TRAIL, RANKL, TWEAK, APRIL, NGF, BDNF, NT-3, and EDA-A2.

    23. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claim 21 or 22, wherein the encoded cytokine is independently selected from TNF-C, OX40I, CD154, FasL, CD70, CD153, 4-1BB ligand, and EDA-A.

    24. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to any one of claims 21 to 23, wherein the cytokine is independently selected from the group comprising IL-2, IFN-alpha, IFN-beta, IFN-gamma, Flt3 ligand, GM-CSF, IL-15, and IL-12.

    25. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to any one of claims 10 to 24, wherein at least one further transgene encodes a chemokine.

    26. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claim 25, wherein the chemokine is independently selected from the group comprising MIP-1 alpha, RANTES, IL-8, CCL5, CCL17, CCL20, CCL22, CXCL9, CXCL10, CXCL11, CXCL13, CXCL12, CCL2, CCL19 and CCL21.

    27. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claim 26, wherein the chemokine encoded is MIP-1 alpha.

    28. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to claim 27, wherein the virus comprises transgenes encoding a cytokine and chemokine combination selected from i) MIP-1? and Flt3, and ii) MIP-1? and IFN?.

    29. A replication deficient oncolytic viral vector or replication competent oncolytic virus according to any one of claims 1 to 28, wherein the anti-CD3 antibody or binding fragment has at least the binding domain comprising a VH and a VL regions from muromonab-CD3 (OKT3), otelixizumab, teplizumab or visilizumab.

    30. A method of treating a cancer patient (for example by in vivo stimulation of T cells, for example T cells in the cancer cell environment, to focus on cancerous cells) comprising the step of: administering a therapeutically effective amount of a replication deficient oncolytic viral vector or replication capable group B oncolytic adenovirus selected from the group consisting of Ad11 and enadenotucirev, wherein the virus encodes an antibody or a binding fragment thereof for expression on the surface of a cancer cell, wherein said antibody or binding fragment is specific to a CD3 protein of a T-cell receptor complex (TCR), wherein the virus does not encode a B7 protein or an active fragment thereof, wherein the virus or viral vector selectively infects said cancerous cells and expresses on the surface of the cell the said encoded anti-CD3 antibody or binding fragment, as defined in any one of claims 1 to 26.

    31. A replication deficient oncolytic viral vector or replication capable group B oncolytic adenovirus selected from the group consisting of Ad11 and enadenotucirev, wherein the virus encodes an antibody or a binding fragment thereof for expression on the surface of a cancer cell, wherein said antibody or binding fragment is specific to a CD3 protein of a T-cell receptor complex (TCR), wherein the virus does not encode a B7 protein or an active fragment thereof, as defined in any one of claims 1 to 29, for use in treatment.

    32. A replication deficient oncolytic viral vector or replication capable group B oncolytic adenovirus according to claim 31, for use in the treatment of cancer.

    33. A replication deficient oncolytic viral vector or replication capable group B oncolytic adenovirus according to claim 32, wherein the treatment is by in vivo stimulation of T cells, for example T cells in the cancer cell environment, to focus on cancerous cell.

    34. A replication deficient oncolytic viral vector or replication capable group B oncolytic adenovirus selected from the group consisting of Ad11 and enadenotucirev, wherein the virus encodes an antibody or a binding fragment thereof for expression on the surface of a cancer cell, wherein said antibody or binding fragment is specific to a CD3 protein of a T-cell receptor complex (TCR), wherein the virus does not encode a B7 protein or an active fragment thereof, as defined in any one of claims 1 to 26, for use in in the manufacture of a medicament.

    Description

    SUMMARY OF THE FIGURES

    [0229] FIG. 1 shows a representation of a T cell receptor (example with alpha-beta antigen recognition chains)

    [0230] FIG. 2 shows schematics of transgene cassettes for viruses expressing human CD80 (FIG. 2A), co-expressing human IFN? and human CD80 (FIG. 2B), co-expressing OKT3 scFv and human CD80 (FIG. 2C), co-expressing human Flt3L, human MIP1? and human IFN? (FIG. 2D), co-expressing human Flt3L, human MIP1? and human CD80 (FIG. 2E), co-expressing human IFN?, human MIP1? and human CD80 (FIG. 2F), and a schematic of the open reading frame (ORF) or the OKT3 scFv (FIG. 2G)

    [0231] FIG. 3 shows schematics of the NG-348A (FIG. 3A), NG-420 (FIG. 3B) and NG-420A (FIG. 3C) transgene cassettes

    [0232] FIG. 4 shows high CD80 expression by 48 hours on the cell surface of A549 tumour cells infected with either NG-347 or NG-348 viruses but little or no CD80 expression following EnAd infection

    [0233] FIG. 5 shows high CD80 expression by 48 hours on the cell surface of DLD-1 tumour cells infected with NG-348 viruses but little or no CD80 expression following EnAd infection

    [0234] FIG. 6 shows CD80 expression on EpCam.sup.+ A549 cells infected with NG-348 and co-cultured with human CD3.sup.+ T-cells, but not when infection was with EnAd

    [0235] FIG. 7 shows CD25 is upregulated on human CD3.sup.+ T-cells following co-culture with NG-348 infected A549 cells, but not when infection was with EnAd (FIG. 7A), with both the percentage of CD25.sup.+ cells (FIG. 7B) and the level of CD25 expression per cell (FIG. 7C) was increased.

    [0236] FIG. 8 shows CD25 is upregulated on both CD4.sup.+ and CD4.sup.? (primarily CD8) human CD3.sup.+ T cell subsets following co-culture with NG-348 infected A549 cells, but not when infection was with EnAd.

    [0237] FIG. 9 shows low level of HLA-DR expression on human CD3.sup.+ T cells following co-culture with NG-348 or EnAd infected A549 cells

    [0238] FIG. 10 shows induction of CD107a expression on the surface of live, CD3.sup.+ T cells following co-culture with NG-348 infected A549 cells, but not when infection was with EnAd.

    [0239] FIG. 11 shows induction of CD107a expression on the surface of both CD4.sup.+ and CD4.sup.? CD3.sup.+ T cell subsets following co-culture with NG-348 infected A549 cells, but not when infection was with EnAd.

    [0240] FIG. 12 shows induction of IL-2 (FIG. 12A) and IFN? (FIG. 12B) production by CD3.sup.+ T cells following co-culture with NG-348 infected A549 cells, but no IL-2 and only low levels of IFN? when infection was with EnAd.

    [0241] FIG. 13 shows induction of IFN? production by both CD4+(FIG. 13A) and CD8.sup.+ (FIG. 13B) CD3.sup.+ T cells following co-culture with NG-348 infected A549 cells, but no (CD4.sup.+ cells) or low (CD8.sup.+ cells) IFN? when infection was with EnAd.

    [0242] FIG. 14 shows genome replication and hexon gene expression (mRNA levels) for EnAd, NG-347, and NG-348 in MRC-5 fibroblast cells compared to A549 tumour cells

    [0243] FIG. 15 shows CD80 and anti-CD3-scFv transgene mRNA and CD80 transgene protein (flow cytometry) expression for virus NG-348 in MRC-5 fibroblast cells compared to A549 tumour cells

    [0244] FIG. 16 shows CD80 transgene mRNA and CD80 transgene protein for virus NG-347 in MRC-5 fibroblast cells compared to A549 tumour cells.

    [0245] FIG. 17 shows mRNA and secreted protein levels of MIP1? and IFN? generated by virus NG-347 in MRC-5 fibroblast cells compared to A549 tumour cells.

    [0246] FIG. 18 shows genome replication and hexon gene expression (mRNA levels) for EnAd, NG-347, and NG-348 in purified human T-cell cultures.

    [0247] FIG. 19 shows CD80 and anti-CD3 scFv transgene mRNA and protein expression (flow cytometry) for virus NG-348 in human T-cells compared to A549 tumour cells

    [0248] FIG. 20 shows CD80 transgene mRNA and CD80 transgene protein for virus NG-347 in purified human T-cells compared to A549 tumour cells FIG. 21 shows IFN? and MIP1? transgene mRNA generated by virus NG-347 in T cells compared to A549 tumour cells

    [0249] FIG. 22 shows NG-347 and NG-348 genome replication and hexon gene expression by human PBMCs compared to A549 tumour cells

    [0250] FIG. 23 shows CD80 and anti-CD3 scFv mRNA generated by virus NG-348 by PBMCs compared to A549 tumour cells

    [0251] FIG. 24 shows CD80, IFN? and MIP1? mRNA generated by virus NG-347 by PBMCs compared to A549 tumour cells

    [0252] FIG. 25 shows the similar activation of human dendritic cells by EnAd, NG-347 and NG-348 virus particles, as measured by down-regulation of CD14 expression and upregulation of CD80 on the cell surface

    [0253] FIG. 26 shows similar particle-mediated MIP1? and IFN? protein secretion from PBMCs cultured with NG-348 (A) or NG-347 (B) compared to EnAd.

    [0254] FIG. 27 shows NG-347 or NG-348 genome replication in co-cultures or T-cells or PBMCs with MRC-5 fibroblast cells compared to co-cultures with A549 tumour cells

    [0255] FIG. 28 shows INF? secreted by PBMCs or T-cells co-cultured with MRC-5 fibroblast cells compared to A549 tumour cells, and treated with EnAd or virus NG-348.

    [0256] FIG. 29 shows MIP1? and IFN? secreted by human dendritic cells treated with EnAd, NG-347 or NG-348 virus particles

    [0257] FIG. 30 shows NF?B and IFN reporter gene activation in JurkatDual reporter T-cells co-cultured with EnAd, NG-347 or NG-348 infected A549 tumour cells

    [0258] FIG. 31 shows NF-?B-luciferase reporter activity generated by JurkatDual reporter T-cells co-cultured with EnAd, NG-347, NG-348 or NG-420 treated A549 HCT-116, DLD and HT29 tumour cells

    [0259] FIG. 32 shows NF-?B-luciferase reporter activity generated by JurkatDual cells co-cultured with either A549 or HT29 tumour cells infected with virus NG-348 and virus NG-420 as a function of virus particles added

    [0260] FIG. 33 shows the pharmacokinetics of EnAd and virus NG-348 in blood; blood cytokine levels after exposure to EnAd or virus NG-348; tissue biodistribution of EnAd or NG-348 viruses 6 or 24 hours after IV administration to CD1 mice

    [0261] FIG. 34 shows the pharmacokinetics in blood of EnAd, NG-347 and NG-348 viruses following IV administration to CB17-SCID mice bearing a subcutaenous HCT-116 tumour xenograft.

    [0262] FIG. 35 shows the tissue distribution of EnAd, NG-347 and NG-348 viruses 6 hours post intravenous dosing in tumour-bearing CB17-SCID mice, and virus genomes in HCT-116 tumour xenografts at day 7 and day 14-21 following intravenous or intra-tumoral dosing of EnAd, NG-347 and NG-348

    [0263] FIG. 36 shows virus hexon mRNA generated in HCT-116 tumour xenografts by EnAd, NG-347 or NG-348 viruses on day 7 or 14-21 following intravenous or intra-tumoral dosing

    [0264] FIG. 37 shows mRNA levels for hexon and CD80 transgene in HCT-116 tumour xenografts 7 or 21 days following intravenous dosing with virus NG-348

    [0265] FIG. 38 shows mRNA levels for a transgenes encoding anti-CD3 scFv and CD80 in HCT-116 tumour xenografts 7 or 14-21 days following IV dosing with virus NG-348

    [0266] FIG. 39 shows mRNA levels of MIP1? and IFN? transgenes in HCT-116 tumour xenografts 7 or 14-21 days following intravenous dosing with virus NG-347

    [0267] FIG. 40 shows CD80 protein expression in HCT-116 tumour xenografts 7 and 21 days following an intravenous dose of virus NG-348; and shows MIP1? and CD80 protein expression in HCT-116 tumours following an intravenous dose of virus NG-347.

    [0268] FIG. 41 shows CD69 is upregulated on more human CD3.sup.+ T-cells following co-culture with NG-347 infected A549 cells than when infection was with EnAd

    [0269] FIG. 42 shows induction of IFN? production by human CD3.sup.+ T cells following co-culture with NG-347 infected A549 cells, but not when infection was with EnAd

    [0270] FIG. 43 shows comparable oncolytic potency (FIG. 43) and infectivity (FIG. 43 table) of EnAd, and NG-348 viruses in an HT-29 cytotoxicity assay

    [0271] FIG. 44 shows the signalling pathway of the TNF superfamily, from a Nature Reviews Immunology 3, 745-756 (September 2003).

    [0272] FIG. 45-53 shows various amino acid and polynucleotide sequences.

    SUMMARY OF THE SEQUENCE LISTING

    [0273] The present application contains 119 sequences in the associated sequence listing. [0274] SEQ ID NO: 1 Amino acid sequence of the VH region of the antibody OKT3. [0275] SEQ ID NO: 2 Amino acid sequence of the VH region of the antibody OKT3. [0276] SEQ ID NO: 3 Amino acid sequence of the scFv construct contain OKT3 VH and VL. [0277] SEQ ID NO: 4 Amino acid sequence of membrane anchored version of the scFv of SEQ ID NO: 3 [0278] SEQ ID NO: 5 Amino acid sequence of SEQ ID NO: 4, with V5 tag. [0279] SEQ ID NO: 6 Amino acid sequence of teplizumab VH. [0280] SEQ ID NO: 7 Amino acid sequence of teplizumab VL. [0281] SEQ ID NO: 8 Amino acid sequence of teplizumab heavy chain. [0282] SEQ ID NO: 9 Amino acid sequence of teplizumab light chain. [0283] SEQ ID NO: 10 Amino acid sequence of PDGFR Receptor A. [0284] SEQ ID NO: 11 Amino acid sequence of PDGFR Receptor B. [0285] SEQ ID NO: 12 Amino acid sequence of Insulin-Like growth factor 1. [0286] SEQ ID NO: 13 Amino acid sequence of IL-6R. [0287] SEQ ID NO: 14 Amino acid sequence of CD28. [0288] SEQ ID NO: 15 Amino acid sequence of PDGFR TM Domain. [0289] SEQ ID NO: 16 Amino acid sequence of c-myc tag. [0290] SEQ ID NO: 17 Amino acid sequence of c-myc tag with spacers. [0291] SEQ ID NO: 18 Amino acid sequence of PDGFR TM Domain with N-terminal c-myc tag. [0292] SEQ ID NO: 19 Amino acid sequence of HuVH human VH leader sequence [0293] SEQ ID NO: 20 Amino acid sequence of a linker. [0294] SEQ ID NO: 21 Polynucleotide sequence of EnAd Genome [0295] SEQ ID NO: 22 to 30 Amino acid sequence of hinge linker sequence. [0296] SEQ ID NO: 31 to 70 Amino acid sequence of a flexible linker sequence. [0297] SEQ ID NO: 71 to 86 Amino acid sequence of a linker sequence. [0298] SEQ ID NO: 87 Polynucleotide sequence of E2B region of the EnAd GENOME (BP 10355-5068). [0299] SEQ ID NO: 88 Polynucleotide sequence of a non-coding sequence suitable for inclusion into BX. [0300] SEQ ID NO: 89 Polynucleotide sequence of a non-coding sequence suitable for inclusion into BY. [0301] SEQ ID NO: 90 & 91 Polynucleotide sequence of a splice acceptor sequence. [0302] SEQ ID NO: 92 Polynucleotide sequence comprising a start codon. [0303] SEQ ID NO: 93 Polynucleotide sequence of IRES. [0304] SEQ ID NO: 94 Amino acid sequence of high efficiency self-cleavable P2A peptide sequence. [0305] SEQ ID NO: 95 Amino acid sequence of high efficiency self-cleavable F2A peptide sequence. [0306] SEQ ID NO: 96 Amino acid sequence of high efficiency self-cleavable E2A peptide sequence. [0307] SEQ ID NO: 97 Amino acid sequence of high efficiency self-cleavable T2A peptide sequence. [0308] SEQ ID NO: 98 Amino acid sequence of human CD80 amino acid sequence. [0309] SEQ ID NO: 99 Polynucleotide sequence of a polyadenylation sequence (5V40 late polyA sequence). [0310] SEQ ID NO: 100 Polynucleotide of NG-348 virus genome sequence. [0311] SEQ ID NO: 101 Amino acid of V5 TAG [0312] SEQ ID NO: 102 Polynucleotide of NG-348A virus genome sequence. [0313] SEQ ID NO: 103 Polynucleotide of NG-420 virus genome sequence. [0314] SEQ ID NO: 104 Polynucleotide of NG-420A virus genome sequence. [0315] SEQ ID NO: 105 Amino acid sequence human interferon-a amino acid sequence. [0316] SEQ ID NO: 106 Amino acid sequence human soluble Flt3 ligand amino acid sequence. [0317] SEQ ID NO: 107 Amino acid sequence human macrophage inflammatory protein 1a amino acid sequence (LD78b isoform). [0318] SEQ ID NO: 108 Amino acid sequence membrane anchored form of the anti-human CD3 single chain Fv. [0319] SEQ ID NO: 109 Polynucleotide sequence of NG-330 virus genome. [0320] SEQ ID NO: 110 Polynucleotide sequence of NG-343 virus genome. [0321] SEQ ID NO: 111 Polynucleotide sequence of NG-345 virus genome. [0322] SEQ ID NO: 112 Polynucleotide sequence of NG-346 virus genome. [0323] SEQ ID NO: 113 Polynucleotide sequence of NG-347 virus genome. [0324] SEQ ID NO: 114 Polynucleotide of E3 region from EnAd. [0325] SEQ ID NO: 115 Polynucleotide of a non-coding sequence suitable for inclusion into BY. [0326] SEQ ID NO: 116 Polynucleotide sequence of NG-348 virus genome. [0327] SEQ ID NO: 117 Polynucleotide sequence of membrane tethered OKT3-scFv. [0328] SEQ ID NO: 118 Polynucleotide sequence of transgene cassette from NG-348. [0329] SEQ ID NO: 119 Polynucleotide sequence of fully synthetic EnAd genome with incorporated [0330] cloning site for transgene cassette insertion as in plasmid pEnAd2.4

    DETAILED DISCLOSURE

    [0331] T cells in the cancer environment include T cells inside a tumor and T cells in the vicinity of the tumor, for example T cells outside the tumor but able to engage the tumor or cancerous cell, in particular physically engage the tumor or cancerous cell.

    [0332] There is evidence to suggest that the T cell infiltrate into tumors and once inside they are deactivated. Advantageously the method of the present disclosure is capable of activating T cells inside the tumor. In one embodiment the T cells inside the tumor are activated by oncolytic virus or viral vector according to the present disclosure.

    [0333] In one embodiment a transmembrane tether or anchor sequence employed in the present disclosure comprises a PDGFR TM domain (e.g. ala513-arg561), such as shown in the sequence of SEQ ID NO: 15.

    [0334] In one embodiment a tether or anchor sequence employed in the present disclosure comprises a tag attached to a PDGF receptor or fragment thereof, such as PDGFR TM domain.

    [0335] Suitable tags include His-tags, Flag-tags, c-myc tag and the like. More specifically the tether or anchor may comprise a c-myc tag for example of SEQ ID NO: 16 EQKLISEEDL followed by a PDGFR TM domain is employed, for ala513-arg561), such as shown in the sequence of SEQ ID NO: 15

    [0336] In one embodiment the c-myc tag comprises a spacer or spacer amino acids at the 3 and/or 5 end, for example as shown in the sequence of SEQ ID NO: 17 gsEQKLISEEDLn.

    [0337] In one embodiment the tether or anchor sequence employed is shown in the sequence of SEQ ID NO: 18.

    [0338] Generally the protein/polypeptide to which the tether or anchor is attached does not comprise a stop codon.

    [0339] In one embodiment the leader sequence for the protein to be expressed on the cancer cell surface is human, for example the human VH leader sequence (HuVH)(SEQ ID NO. 19).

    [0340] In one embodiment the structure of the ORF cassette is as follows:

    TABLE-US-00002 LS-POLY-TAG-TM_D
    wherein [0341] LS is a leader sequence, for example a human leader sequence; [0342] POLY is a polynucleotide encoding polypeptide or proteins of interest, in particular one disclosed herein; [0343] TAG is a tag for example one disclosed herein, such as c-myc, in particular as described herein; [0344] TM_D is a TM domain for example a PDGFR TM domain, also described herein.

    [0345] When the polypeptide is a scFv then the ORF may be as follows:

    TABLE-US-00003 LS-VAR.sub.1-LINK-VAR.sub.2-TAG-TM_D
    wherein [0346] LS is a leader sequence, for example a human leader sequence; [0347] VAR.sub.1 is a polynucleotide encoding a variable region such as VH region; [0348] LINK is a linker, for example as disclosed herein, such as a linker based on the units of G.sub.4S, in particular the sequence of SEQ ID NO: 20 GGGGSGGGGSGGGGS; [0349] VAR.sub.2 is a polynucleotide encoding a variable region, such as a VL region; [0350] TAG is a tag, for example one disclosed herein, such as c-myc, in particular a sequence described herein; [0351] TM_D is a TM domain for example a PDGFR TM domain, for example a sequence described herein.

    [0352] The disclosure also extends to embodiments, in particular those described specifically herein, which comprise a tag at the N- or C-termini of the polypeptide chains, such that it resides inside or on the outside of the membrane. Thus a C-termini tag located inside the membrane is advantageous because it is not likely to interfere with the binding or function of the polypeptide.

    [0353] Alternative methods to employing transmembrane domains for expressing proteins on the surface of the infected cancer cell include approaches employing glycophospholipid anchor (also referred to as a GPI anchor) attached to the C-terminal amino acid of the extracellular protein or fragment (Low et al 1986, Cross 1987, Low and Saltiel 1988, Ferguson and William 1988). Known glycophospholipid anchors include those from Thy-1, N-CAM and DAF.

    [0354] In one embodiment a combination of a transmembrane domain and a secretory signal sequence is employed to express a protein encoded by the virus (for example as described herein) on the surface of an infected cancer cell. The present inventors have shown that the proteins encoded are expressed only on cells which are permissive to infection by the oncolytic virus, i.e. cancer cells.

    [0355] In one embodiment the fragment employed to express the protein on the surface of the infected cancer cell (such as the transmembrane fragment) is selected from the group comprising TM Domain Sequences (Minimal portions) given in SEQ ID NO: 10 to 15 (or 10 to 14).

    [0356] In one embodiment a transmembrane domain from CD80 or CD86 is employed to express the protein on the surface the cancer cell.

    [0357] In one embodiment the fragment employed to express the protein on the surface of the infected cancer cell (such as the transmembrane fragment) is selected from about 20 to 25 hydrophobic amino acids which form a transmembrane alpha helix, for example from the proteins including PDGF receptor, insulin-like growth factor receptor, IL-6 receptor, CD28, glycophorin, LDL receptor, influenza HA protein, insulin receptor, Asialoglycoprotein receptor, Transferrin receptor.

    [0358] In one embodiment the transmembrane domain employed is derived from a G protein-coupled receptor or S antigen from hepatitis B.

    [0359] In one embodiment a fusion protein comprising a full length extracellular domain of a B7 protein or fragment and also a transmembrane domain derived from a protein other than B7 is arranged such that the B7 protein is located at the terminal end of the fusion protein distal from the cancer cell surface, that is on the outside of the cancer cell facing the extracellular space.

    [0360] Having the DNA sequence encoding B7 or an active fragment under the control of an endogenous promoter is also advantageous because the protein is expressed in accordance with the virus life cycle as opposed to being constitutively expressed. In the present situation continuous expression under an exogenous promoter, for example a strong promoter like the CMV promoter, may produce more B7 protein than is necessary for a therapeutic effect and result in off-target effects.

    [0361] In one embodiment oncolytic virus according to present disclosure is an adenovirus, for example a group B adenovirus. In one embodiment the virus according to the present disclosure is a chimeric virus, for example EnAd. In one embodiment the adenovirus is replication competent.

    [0362] In one embodiment the oncolytic virus is replication capable, for example replication competent.

    [0363] Replication capable as employed herein is a virus that can replicate in a host cell. In one embodiment replication capable encompasses replication competent and replication selective viruses.

    [0364] Replication competent as employed herein is intended to mean an oncolytic virus that is capable of replicating in a human cell, such as a cancer cell, without any additional complementation to that required by wild-type viruses, for example without relying on defective cellular machinery.

    [0365] Replication selective or selective replication as employed herein is intended to mean an oncolytic virus that is able to replicate in cancer cells employing an element which is specific to said cancer cells or upregulated therein, for example defective cellular machinery, such as a p53 mutation, thereby allowing a degree of selectivity over healthy/normal cells.

    [0366] A replication capable oncolytic virus is a replication capable virus which preferentially infects cancer cells. That is, they are tumour selective by infecting tumour cells in preference to non-tumour cells. EnAd is an example of a replication competent virus.

    [0367] In one embodiment the virus is replication deficient and provided as a viral vector. Viral vectors require a packaging cell or helper to provide a complementary gene to allow replication.

    [0368] Replication deficient oncolytic viral vector as employed herein refers a replication deficient virus which preferentially infects cancer cells. That is, they are tumour selective by infecting tumour cells in preference to non-tumour cells, for example the viral vector is derived from a replication competent oncolytic virus by deleting a gene essential for replication.

    [0369] In one embodiment replication deficient oncolytic viral vectors according to the present disclosure

    [0370] In one embodiment the gene encoding the anti-TCR antibody or binding fragment thereof (such as an anti-CD3 antibody or binding fragment thereof) is located between the stop codon and polyA recognition site of the adenoviral gene L5 and the stop codon and polyA recognition site of the gene E4.

    [0371] In one embodiment gene encoding the anti-TCR antibody or binding fragment thereof (such as an anti-CD3 antibody or binding fragment thereof) is located between about bp 29356 and about 29357 of the EnAd genome, for example as shown in SEQ ID NO: 21, or a position equivalent thereto. The skilled person will understand that the absolute numerical value of the location can change based on how the numbering is allocated.

    The CD3 antibody component facilitates in vivo stimulation of T cells, for example T cells in the cancer cell environment, to focus on cancerous cells.

    [0372] Immunomodulator as employed herein means a modulator of immune response. Immunomodulators function in adjustment of the immune response to a desired level, as in immunopotentiation, immunosuppression, or induction of immunologic tolerance.

    [0373] In one embodiment the immunomodulator is an antibody or binding fragment (in particular an inhibitor antibody or binding fragment) specific to a target selected from the group comprising CTLA-4, PD-1, PD-L1, PD-L2, VISTA, B7-H3, B7-H4, HVEM, ILT-2, ILT-3, ILT-4, TIM-3, LAG-3, BTLA, LIGHT or CD160, for example CTLA-4, PD-1, PD-L1 and PD-L2.

    [0374] In one embodiment the immunomodulator is an antibody or binding fragment (in particular an inhibitor antibody or binding fragment) specific to a target selected from the group comprising CD16, CD25, CD33, CD332, CD127, CD31, CD43, CD44, CD162, CD301a, CD301b and Galectin-3.

    [0375] In one embodiment the immunomodulator is an antibody or binding fragment specific to a target selected from the group comprising: FLT-3, FLT-3 ligand, TLRs, TLR ligands, CCR7, CD1a, CD1c, CD11b, CD11c, CD80, CD83, CD86, CD123, CD172a, CD205, CD207, CD209, CD273, CD281, CD283, CD286, CD289, CD287, CXCR4, GITR Ligand, IFN-?2, IL-12, IL-23, ILT1, ILT2, ILT3, ILT4, ILT7, TSLP Receptor, CD141, CD303, CADM1, CLEC9a, XCR1 and CD304.

    [0376] In one embodiment the immunomodulator is an antibody or binding fragment specific to a target selected from the group comprising OX40, OX40 ligand, CD27, CD28, CD30, CD40, CD40 ligand, CD70, CD137, GITR, 4-1BB, ICOS and ICOS ligand, for example CD40 and CD40 ligand.

    [0377] In one embodiment the immunomodulator is a membrane-associated protein ligand for immune cell surface receptors selected from the group comprising CTLA-4, PD-1, PD-L1, PD-L2, VISTA, B7-H3, B7-H4, HVEM, ILT-2, ILT-3, ILT-4, TIM-3, LAG-3, BTLA, LIGHT or CD160, for example CTLA-4, PD-1, PD-L1 and PD-L2.

    [0378] In one embodiment the immunomodulator is a membrane-associated protein ligand for immune cell surface receptors selected from the group comprising CD16, CD25, CD33, CD332, CD127, CD31, CD43, CD44, CD162, CD301a, CD301b and Galectin-3.

    [0379] In one embodiment the immunomodulator is a membrane-associated protein ligand for immune cell surface receptors selected from the group comprising: FLT-3, FLT-3 ligand, TLRs, TLR ligands, CCR7, CD1a, CD1c, CD11b, CD11c, CD80, CD83, CD86, CD123, CD172a, CD205, CD207, CD209, CD273, CD281, CD283, CD286, CD289, CD287, CXCR4, GITR Ligand, IFN-?2, IL-12, IL-23, ILT1, ILT2, ILT3, ILT4, ILT5, ILT7, TSLP Receptor, CD141, CD303, CADM1, CLEC9a, XCR1 and CD304.

    [0380] In one embodiment the immunomodulator is a membrane-associated protein ligand for immune cell surface selected from the group comprising OX40, OX40 ligand, CD27, CD28, CD30, CD40, CD40 ligand, CD70, CD137, GITR, 4-1BB, ICOS and ICOS ligand, for example CD40 and CD40 ligand.

    [0381] In one embodiment the immunomodulator is an antibody or binding fragment specific to a target selected from the group comprising IL-1?, IL-1?, IL-6, IL-9, IL-12, IL-13, IL-17, IL-18, IL-22, IL-23, IL-24, IL-25, IL-26, IL-27, IL-33, IL-35, interleukin-2 (IL-2), IL-4, IL-5, IL-7, IL-10, IL-15, IL-21, IL-25, IL-1RA, IFN?, IFN?, IFN?, TNF?, TGF?, lymphotoxin ? (LTA) and GM-CSF.

    [0382] In one embodiment the oncolytic adenovirus according to the present disclosure has a formula (I):


    5TTR-B.sub.1-B.sub.A-B.sub.2-B.sub.X-B.sub.B-B.sub.Y-B.sub.3-3TTR(I)

    wherein: [0383] B.sub.1 is a bond or comprises: E1A, E1B or E1A-E1B; [0384] B.sub.A is E2B-L1-L2-L3-E2A-L4; [0385] B.sub.2 is a bond or comprises E3 or a transgene, for example under an endogenous or exogenous promoter; [0386] B.sub.X is a bond or a DNA sequence comprising: a restriction site, one or more transgenes or both; [0387] B.sub.B comprises L5; [0388] B.sub.Y comprises a transgene encoding a B7 protein or an active fragment thereof; and [0389] B.sub.3 is a bond or comprises E4.

    [0390] In one embodiment the oncolytic virus has a formula (Ia):


    5TTR-B.sub.1-B.sub.A-B.sub.2-B.sub.B-B.sub.Y-B.sub.3-3TTR(Ia)

    wherein: [0391] B.sub.1 is a bond or comprises: E1A, E1B or E1A-E1B; [0392] B.sub.A is E2B-L1-L2-L3-E2A-L4; [0393] B.sub.2 is a bond or comprises E3; [0394] B.sub.B comprises L5; [0395] B.sub.Y comprises a transgene encoding a B7 protein or an active fragment thereof; and [0396] B.sub.3 is a bond or comprises E4.

    [0397] In one embodiment the virus genome in constructs of formula (I) and/or (Ia) is from Ad11 or EnAd, in particular EnAd.

    [0398] In one embodiment the transgene encoding the anti-TCR antibody or binding fragment thereof (such as an anti-CD3 antibody or binding fragment thereof), is under the control of an endogenous promoter, for example the major late promoter.

    [0399] In one embodiment B.sub.Y comprises a transgene cassette, said cassette comprising a transgene encoding a B7 protein or fragment thereof and a regulatory element, such as combination of regulatory elements.

    [0400] In one embodiment the regulatory element is splice acceptor sequence.

    [0401] In one embodiment the regulatory element is a Kozak sequence.

    [0402] In one embodiment, for example where the transgene encodes a polycistronic RNA molecule, the regulatory element is an IRES sequence.

    [0403] In one embodiment the regulatory sequence is a high efficiency self-cleavable peptide sequence such as P2A, T2A, F2A, E2A.

    [0404] In one embodiment the regulatory sequence is a polyA tail.

    [0405] In one embodiment there are at least two regulatory sequences, for example a splice acceptor and a Kozak sequence or a splice acceptor and a polyA tail, or a splice acceptor and an IRES sequence, or a splice acceptor and a P2A sequence.

    [0406] In one embodiment there are at least three regulator sequences, for example a splice acceptor sequence, a Kozak sequence and polyA tail, or a splice acceptor sequence an IRES or 2A sequence and a polyA tail; or a splice acceptor sequence, Kozak sequence and an IRES or 2A sequence.

    [0407] In one embodiment there are at least four regulatory sequences, for example a splice acceptor sequence, a Kozak sequence, an IRES or 2A sequence and a polyA tail, in particular from L5 to E4 in the order splice acceptor sequence, Kozak sequence, IRES or 2A sequence and a polyA tail.

    [0408] In on embodiment the transgene encodes a polycistronic RNA molecule comprising both an IRES and a 2A regulatory sequence

    [0409] In one embodiment a non-adenovirus encodes a B7 protein is independently selected from B7-1, B7-2, B7-DC, B7-H1, B7-H2, B7-H3, B7-H4, B7-H5, B7-H6, B7-H7, active fragments of the same, and combinations thereof. In one embodiment the B7 protein is B7-1 (CD80), B7-2 (CD86) or an active fragment of any of the same and combinations thereof, in particular B7-1 or an active fragment thereof.

    [0410] In one embodiment the B7 fragment comprises or consists of a transmembrane domain from a B7 protein in particular one described herein, such as B7-1. This domain is thought to contribute expression on the cell surface.

    [0411] In one embodiment the cytoplasmic domain of the B7 protein is present. In one embodiment the cytoplasmic domain is absent. The absence of the cytoplasmic domain may reduce or eliminate intracellular signaling to the cancer cell, which is relevant to one or more embodiments discussed below.

    [0412] The elements in a fragment or full length B7 protein may be from the same or different B7 proteins. Thus in one embodiment the B7 fragment or protein is chimeric.

    [0413] In one embodiment the virus of the present disclosure encodes multiple proteins for expression on the surface of the infected cancer cell, for example a non-adenovirus encodes at least one is a B7 protein or an active fragment thereof, for example two, three, four or more different proteins are encoded, in particular two or three proteins are encoded by the virus for expression on the cancer cell surface or secretion into the extracellular space.

    [0414] In one embodiment a B7 protein or active fragment is encoded by the non-adenovirus of the present disclosure for expression on the surface of the cancer cell and a soluble form, which is released or secreted from the cell, of the same B7 protein or a different B7 protein (including active fragments) is also encoded by the virus.

    [0415] In one embodiment at least two different B7 proteins or active fragments are encoded by a non-adenovirus of the present disclosure.

    [0416] In one embodiment the multiple proteins may be encoded to be expressed as separate proteins which are independently processed and expressed in the cancer cell membrane. The independence of the proteins on the surface of the cancer cell may make a positive contribution to the immune activation. Whilst not wishing to be bound by theory, lipid packing can influence the fluidity (i.e. the viscosity) of the lipid bilayer in the membrane of the cancer cell. Viscosity of the membrane can affect the rotation and orientation of proteins and other bio-molecules within the membrane, thereby affecting the functions of these molecules. Thus when the proteins encoded by the virus are located as individual and separate proteins within the membrane of the infected cancer cell, the fluidity of the lipid bilayer allows independent movement of the molecules which may be a particularly suitable format similar to a natural format that is conducive to biological function.

    [0417] In one embodiment the independently processed and expressed proteins are located (anchored) in different locations, such as physically separate locations, in the cancer cell membrane.

    [0418] In one embodiment one or more proteins (for example all the proteins) encoded by the virus and expressed on the surface of the infected cancer cell are not fusion proteins.

    Thus in one embodiment the virus according to the present disclosure comprises DNA sequences encoding said multiple proteins for expression, for example on the surface or the infected cancer cell.

    [0419] Thus in one embodiment the virus according to the present disclosure comprises two or more transgenes, in the same or different locations in the virus genome. When located at the same position in the virus genome the multiple proteins will still be expressed independently at the surface of the cancer cell.

    [0420] In one embodiment the multiple proteins (including fusion proteins) are encoded in different locations in the virus genome, for example in E3, B.sub.X and/or B.sub.Y and are expressed separately on the surface of the infected cancer cell.

    [0421] In one embodiment the multiple proteins (including fusion proteins) are encoded in the same location in the virus genome and expressed together on the infected cancer cell surface, for example where the proteins encoded are provided as a fusion protein wherein the fusion protein comprises a B7 protein or an active fragment thereof.

    [0422] In one embodiment the B7 protein in the fusion protein is a full length protein, in particular a protein described herein, such as B7-1 and/or B7-2, fused or linked to another protein of interest or an active fragment thereof. In one embodiment, the fusion protein comprises a transmembrane from a B7 protein. In one embodiment the B7 is an active fragment excluding the transmembrane domain. In the latter embodiment a transmembrane other than one derived from a B7 protein may be employed to ensure the fusion protein is presented on the surface of the infected cancer cell.

    [0423] In one embodiment the multiple proteins are encoded in the same location in the virus and are expressed as fusion proteins together on the surface of the infected cancer cell.

    [0424] When the location in the virus is the same then the genes may, for example be linked by an IRES sequence or a 2A peptide.

    [0425] In one embodiment the virus according to the present disclosure comprises a second transgene and optionally a third transgene (i.e. one or more of said multiple proteins, for example encoding a polypeptide selected from the group comprising a cytokine, a chemokine, a ligand, an antagonistic antibody molecule, and an agonistic antibody molecule.

    [0426] In one embodiment the additional protein or proteins is/are independently selected from the group comprising an antibody, antibody fragment or protein ligand that binds CD3, CD28, CD80, CD86, 4-1BB, GITR, OX40, CD27, CD40 and combinations in forms suitable for expression on the surface of a cancer cell.

    [0427] In one embodiment where the first transgene is specific to the alpha and/or beta chain of the TCR the additional protein is an anti-CD3 antibody or binding fragment thereof, for example independently selected from a Muromonab-CD3 (also known as OKT3), otelixizumab (also known as TRX4), teplizumab (also known as hOKT3?1 (Ala-Ala)), or visilizumab.

    [0428] In one embodiment the anti-TCR antibody is in the form of an antibody fragment (such as an anti-CD3 antibody or binding fragment thereof), for example an scFv form, that is part of a fusion protein with the transmembrane region of another protein, for example the transmembrane domain from the PDGF receptor or from the cell surface form of IgG

    [0429] In one embodiment an antibody inhibitor (antagonistic antibody) is independently selected from the group comprising an inhibitor of an angiogenesis factor, such as an anti-VEGF antibody molecule, and inhibitor of T cell deactivation factors, such as an anti-CTLA-4, anti-PD1 or anti-PDL1 antibody molecule. In one embodiment antibody molecule is an agonist independently selected from the group comprising antibodies to CD40, GITR, OX40, CD27 and 4-1BB.

    [0430] In one embodiment the additional transgene encodes a cytokine, or soluble variant thereof selected from the group comprising IL-2, IFN-alpha, IFN-beta, IFN-gamma, GM-CSF, IL-15, IL-12 and fms-related tyrosine kinase 3 ligand (FLT3L). Advantageously, one or more of this group of proteins expressed by the virus, in particular as a free protein secreted from the cancer cell, may be particularly suitable for stimulating an immune response in vivo to the cancer cell.

    [0431] In one embodiment the additional transgene encodes a chemokine, selected from the group comprising MIP1-alpha, RANTES, IL-8, CCL5, CCL17, CCL20, CCL22, CXCL9, CXCL10, CXCL11, CXCL13, CXCL12, CCL2, CCL19 and CCL21. Advantageously, one or more of this group of proteins is expressed by the virus as a free protein which may be secreted from the cancer cell may be particularly suitable for attracting immune cells and stimulating an immune response to the cancer cell in vivo.

    [0432] In one embodiment the additional transgene encodes a ligand specific for a chemokine receptor, selected from the group comprising CXCR2, CCR2, CCR4, CCR5, CCR6, CCR7, CCR8, CXCR3, CXCR4, CXCR5 and CRTH2.

    [0433] In one embodiment in addition to at least the anti-TCR antibody or binding fragment thereof (such as an anti-CD3 antibody or binding fragment thereof) expressed on the surface of the infected cancer cell, one or more molecules are also expressed on the surface and/or secreted.

    [0434] Thus in one embodiment the non-adenovirus encodes B7-1, B7-2 or an active fragment of any one of the same or a combination thereof.

    [0435] Thus in one embodiment the non-adenovirus encodes B7-1, B7-2 or an active fragment of any one of the same or a combination thereof for expression on the surface of the infected cancer cell and an anti-TCR (agonist, such as CD3 agonist) antibody or antibody fragment (such as a scFv) also for expression on the cancer cell surface, in particular where the proteins are expressed as individual proteins on the cell surface.

    [0436] Thus in one embodiment the non-adenovirus encodes B7-1, B7-2 or an active fragment of any one of the same or a combination thereof for expression on the surface of the infected cancer cell and an anti-VEGF (antagonist) antibody also for expression on the cancer cell surface or for release from the cancer cell, for example by secretion or after lysis/death of the infected cancer cell.

    [0437] Thus in one embodiment the non-adenovirus encodes B7-1, B7-2 or an active fragment of any one of the same or a combination thereof for expression on the surface of the infected cancer cell and an antibody, antibody fragment or protein ligand that binds CD3, CD28, CD80, CD86, 4-1BB, GITR, OX40, CD27, CD40 also for expression on the cancer cell surface or for release from the cancer cell, for example by secretion or after lysis/death of the infected cancer cell.

    [0438] Thus in one embodiment the non-adenovirus encodes B7-1, B7-2 or an active fragment of any one of the same or a combination thereof for expression on the surface of the infected cancer cell and a cytokine selected from IL-2, IFN-alpha, IFN-beta, IFN-gamma, GM-CSF, IL-15, IL-12, and FLT3L, for example for release from the cancer cell, in particular by secretion or after cell lysis/death of the infected cancer cell.

    [0439] Thus in one embodiment the non-adenovirus encodes B7-1, B7-2 or an active fragment of any one of the same or a combination thereof for expression on the surface of the infected cancer cell and a chemokine selected from MIP1-alpha, RANTES, IL-8, CCL5, CCL17, CCL20, CCL22, CXCL9, CXCL10, CXCL11, CXCL13, CXCL12, CCL2, CCL19, CCL21, for example for release from the cancer cell, in particular by secretion or after cell lysis/death of the infected cancer cell.

    [0440] Thus in one embodiment the non-adenovirus encodes B7-1, B7-2 or an active fragment of any one of the same or a combination thereof for expression on the surface of the infected cancer cell and an anti-TCR (agonist, such as CD3 agonist) antibody or antibody fragment (such as a ScFv) also for expression on the cancer cell surface (in particular where the proteins are expressed as individual proteins on the cell surface) and further encodes a cytokine or chemokine selected from IL-2, IFN-alpha, IFN-gamma, GM-CSF, IL-15, IL-12, FLT3L, MIP1-alpha, RANTES, IL-8, CCL5, CCL17, CCL20, CCL22, CXCL9, CXCL10, CXCL11, CXCL13, CXCL12, CCL2, CCL19, CCL21 for example for release from the cancer cell, in particular by secretion or after cell lysis/death of the infected cancer cell.

    [0441] Thus in one embodiment the non-adenovirus encodes B7-1, B7-2 or an active fragment of any one of the same or a combination thereof for expression on the surface of the infected cancer cell and an anti-TCR (agonist) antibody or antibody fragment (such as a ScFv) also for expression on the cancer cell surface (in particular where the proteins are expressed as individual proteins on the cell surface) and further encodes an antibody, antibody fragment or protein ligand that binds CD28, CD80, CD86, 4-1BB, GITR, OX40, CD27, CD40 or an anti-VEGF (antagonist) antibody also for expression on the cancer cell surface or for release from the cancer cell, for example by secretion or after lysis/death of the infected cancer cell.

    [0442] Thus in one embodiment the non-adenovirus encodes B7-1, B7-2 or an active fragment of any one of the same or a combination thereof for expression on the surface of the infected cancer cell and two different cytokines or chemokines selected from IL-2, IFN-alpha, IFN-beta, IFN-gamma, GM-CSF, IL-15, and IL-12, FLT3L, MIP1-alpha, RANTES, IL-8, CCL5, CCL17, CCL20, CCL22, CXCL9, CXCL10, CXCL11, CXCL13, CXCL12, CCL2, CCL19, CCL21, for example for release from the cancer cell, in particular by secretion of after cell lysis/death of the infected cancer cell.

    [0443] Thus in one embodiment the non-adenovirus encodes B7-1, B7-2 or an active fragment of any one of the same or a combination thereof for expression on the surface of the infected cancer cell and an anti-TCR (agonist, such as CD3 agonist) antibody or antibody fragment (such as a scFv) also for expression on the cancer cell surface (in particular where the proteins are expressed as individual proteins on the cell surface) and further encodes a cytokine selected from IL-2, IFN-alpha, IFN-gamma, GM-CSF, IL-15, and IL-12, and or a chemokine selected from RANTES (CCL5), MIP1? (LD78? (CCL3) or LD78? (CCL3L1) isoforms), MIP1? which can be released from the cancer cell, in particular by secretion before and after cell lysis/death of the infected cancer cell.

    [0444] In one embodiment which in particular may be combined with any of the embodiments above the virus further encodes an anti-PD-1 antibody (an antagonist).

    [0445] In one embodiment the protein or proteins encoded in the transgene cassette for cell membrane expression may also comprise a peptide linker or spacer between the transmembrane domain and the extracellular ligand binding domain. Such linkers or spacers may add flexibility to the cell surface expressed protein that enhances the ability of the protein to interact with its target molecule on an adjacent cell. Such linkers or spacers may also be designed or selected to promote dimerisation or trimerisation of the proteins at the cell surface, via disulphide bond formation or protein-protein interactions. For example the hinge regions of immunoglobulin molecules or CD8 may be employed to enhance both flexibility and dimerisation

    [0446] In one embodiment the protein or proteins encoded in the transgene cassette may also comprise a peptide tag. The peptide tag may include c-myc, poly-histidine, V5 or FLAG tags and can be located on the N-terminus or C-terminus of the polypeptide, either intracellularly or extracellularly, or may be encoded within the protein for example in an extracellular loop or between the transmembrane domain and the extracellular domain. Peptide tags can be used as spacers or linkers between different protein domains, for example the transmembrane and the extracellular domain, and be used for detection or purification of the protein.

    [0447] In one embodiment the one or more additional transgenes (other than the gene encoding the B7 protein or fragment thereof) is under the control of an exogenous or endogenous promoter, for example an endogenous promoter. In one embodiment a transgene in the E3 region (B.sub.2) is under control of an exogenous promoter.

    [0448] In one embodiment the one or more additional transgenes genes are between the E3 region and the fibre L5 in the adenovirus genome, for example at a position B.sub.X in the construct of formula (I), in particular under the control of an exogenous promoter. In one embodiment a transgene in B.sub.X is under the control of an exogenous.

    [0449] In one embodiment the one or more additional transgenes genes are between the E4 region and the fibre L5 in the adenovirus genome, for example at a position B.sub.Y in the construct of formula (I) or (Ia), in particular under the control of an endogenous promoter, such as the major late promoter. This may be in addition to the gene encoding the anti-TCR antibody or binding fragment thereof (such as an anti-CD3 antibody or binding fragment thereof) encoded in the region B.sub.Y.

    [0450] In one embodiment there is provided a composition comprising an oncolytic virus or viral vector according to the present disclosure, for example a pharmaceutical composition, in particular comprising a pharmaceutically acceptable excipient, such as a diluent or carrier.

    [0451] In one embodiment there is provided an oncolytic virus or viral vector according to the present disclosure or a composition comprising the same, for use in treatment, in particular for use in the treatment of cancer.

    [0452] In one embodiment there is provided a method of treating a patient in need thereof comprising administering a therapeutically effective amount of an oncolytic virus or viral vector according to the present disclosure or a composition, such as a pharmaceutical composition comprising the same.

    [0453] In one embodiment there is provided use of an oncolytic virus or viral vector according to the present disclosure or a composition comprising the same for the manufacture of a medicament for the treatment of cancer, in particular carcinomas, for example colorectal, lung, bladder, renal, pancreatic, hepatic, head and neck, breast or ovarian cancer.

    [0454] In one embodiment there is provided a polynucleotide comprising genomic sequence of at least 50% of a virus according to the present disclosure (for example 55, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100%) and comprising a sequence encoding an anti-TCR antibody or binding fragment thereof (such as an anti-CD3 antibody or binding fragment thereof), for example a sequence disclosed herein. In one embodiment the polynucleotide sequence is in the form of a plasmid.

    [0455] In one embodiment there is provided a host cell, for example a mammalian cell, such as a HEK293 cell or a derivative thereof, comprising an oncolytic virus or viral vector according to the present disclosure or a polynucleotide sequence according to the present disclosure.

    [0456] In one embodiment there is provided a process for preparing an oncolytic virus or viral vector according to the present disclosure comprising a step of inserting a polynucleotide encoding an anti-TCR antibody or binding fragment thereof (such as an anti-CD3 antibody or binding fragment thereof) into an oncolytic virus or viral vector.

    [0457] In one embodiment there is provided a process of replicating a virus or viral according to the present disclosure comprising the step of culture host cells in the presence of the virus under conditions suitable for replication. Generally the method will comprise a further step of harvesting the virus, for example from the supernatant or after lysis of the host cells.

    [0458] Transgene as employed herein refers to a gene that has been inserted into the genome sequence of the virus or viral vector, wherein the gene is unnatural to the virus (exogenous) or not normally found in that particular location in the virus. Examples of transgenes are given herein. Transgene as employed herein also includes a functional fragment of the gene that is a portion of the gene which when inserted is suitable to perform the function or most of the function of the full-length gene, for example 50% of the function or more.

    [0459] Transgene and coding sequence are used interchangeably herein in the context of inserts into the viral genome, unless the context indicates otherwise. Coding sequence as employed herein means, for example a DNA sequence encoding a functional RNA, peptide, polypeptide or protein. Typically the coding sequence is cDNA for the transgene that encodes the functional RNA, peptide, polypeptide or protein of interest. Functional RNA, peptides, polypeptide and proteins of interest are described below.

    [0460] In one embodiment transgene as employed herein refers to a segment of DNA containing a gene or cDNA sequence that has been isolated from one organism and is introduced into a different organism i.e. the virus of the present disclosure. In one embodiment this non-native segment of DNA will generally retain the ability to produce functional RNA, peptide, polypeptide or protein. Transgenes employed may for example encode a chimeric protein or a fusion protein.

    [0461] Clearly the virus genome contains coding sequences of DNA. Endogenous (naturally occurring genes) in the genomic sequence of the virus are not considered a transgene, within the context of the present specification unless then have been modified by recombinant techniques such as that they are in a non-natural location or in a non-natural environment.

    [0462] Thus in one embodiment the transgene inserted encodes a human or humanised protein, polypeptide or peptide.

    [0463] Fusion protein as employed herein refers to at least two proteins or fragments or a combination of at least one protein and at least one fragment fused directly or attached to each other, for example by a linker. In one embodiment fusion proteins of the present disclosure do not comprise a B7 protein or active fragment thereof. Fusion proteins comprising B7 fragments or protein and additional proteins are not referred to as chimeric proteins herein. Only proteins containing fragments from different B7 proteins are referred to as chimeric herein.

    [0464] The activity of a given protein fragment may be analysed in a relevant in vitro assay, for example using full-length protein as a comparator.

    [0465] A chimeric fragment as employed herein refers a fragment comprising a sequence from two or more proteins from different origins.

    [0466] B7 proteins include B7-1 (also known as CD80 uniprot number P33681), B7-2 (also known as CD86 uniprot number P42081). These proteins bind CD28 and CTLA-4.

    TABLE-US-00004 MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSC GHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLS IVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDF EIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAV SSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLLPSWAIT LISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV

    [0467] Other B7 proteins include B7-DC (also known as PDCD1LG2 and PD-L2 uniprot number Q9BQ51), B7-H1 (also known as PD-L1 and CD274 uniprot number Q9NZQ7). Both these proteins bind PD-1.

    [0468] Programmed death-ligand 1 (PD-L1) is a 40 kDa type 1 transmembrane protein that has been speculated to play a major role in suppressing the immune system. It appears that upregulation of PD-L1 may allow cancers to evade the host immune system. An analysis of 196 tumor specimens from patients with renal cell carcinoma found that high tumor expression of PD-L1 was associated with increased tumor aggressiveness and a 4.5-fold increased risk of death. Ovarian cancer patients with higher expression of PD-L1 had a significantly poorer prognosis than those with lower expression. PD-L1 expression correlated inversely with intraepithelial CD8+T-lymphocyte count, suggesting that PD-L1 on tumor cells may suppress antitumor CD8+ T cells. The effect might be tumor type dependent; a study on patients with non-small cell lung cancer showed that greater PD-L1 protein and mRNA expression is associated with increased local lymphocytic infiltrate and longer survival. A number of anti-PDL1 antibodies have been shown to be of interest for treating several cancers in clinical trials.

    [0469] In one embodiment at least the cytoplasmic (intracellular domain of B7-DC and/or B7-H1 is deleted or non-functional. Whilst not wishing to be bound by theory there is evidence to suggest that removal of the intracellular domain reduces the cancer cells resistance to lysis Blood 2008, April 1; 111(7) 3635-3643.

    [0470] In one embodiment only the transmembrane domain fragment of B7-DC and/or B7-H1 is employed. In one embodiment the following proteins are not provided as full-length proteins B7-DC and B7-H1.

    [0471] Other B7 proteins include B7-H2 (also known as ICOSLG, B7RP1, CD275 uniprot number 075144) which binds ICOS, B7-H3 (also known as CD276 uniprot number QSZPR3), B7-H4 (also known as VTCN1 uniprot number Q727D3), B7-H5 (also known as VISTA, Platelet receptor Gi24, SISP1), B7-H6 (also known as NCR3LG1, NR3L1) which binds NKp30, B7-H7 (also known as HHLA2) which binds CD28H.

    [0472] In one embodiment the fragment only comprises the transmembrane domain of any one B7-H2, B7-H3, B7-H4, B7-H5, B7-H6 and B7-H7.

    [0473] Individual proteins include single proteins, that is proteins or active fragments thereof that are not part of a fusion protein (including chimeric proteins), and also fusion proteins. In one embodiment the individual proteins are single proteins (including active fragments thereof).

    GPI anchor as employed herein refers to is a glycolipid that can be attached to the C-terminus of a protein during posttranslational modification. It is composed of a phosphatidylinositol group linked through a carbohydrate-containing linker (glucosamine and mannose glycosidically bound to the inositol residue) and via an ethanolamine phosphate (EtNP) bridge to the C-terminal amino acid of a mature protein. The two fatty acids within the hydrophobic phosphatidyl-inositol group anchor the protein to the cell membrane.

    [0474] Glypiated (GPI-linked) proteins contain a signal peptide, thus directing them into the endoplasmic reticulum (ER). The C-terminus is composed of hydrophobic amino acids that stay inserted in the ER membrane. The hydrophobic end is then cleaved off and replaced by the GPI-anchor. As the protein processes through the secretory pathway, it is transferred via vesicles to the Golgi apparatus and finally to the extracellular space where it remains attached to the exterior leaflet of the cell membrane. Since the glypiation is the sole means of attachment of such proteins to the membrane, cleavage of the group by phospholipases will result in controlled release of the protein from the membrane. The latter mechanism is used in vitro; i.e., the membrane proteins released from the membranes in the enzymatic assay are glypiated protein.

    [0475] Phospholipase C (PLC) is an enzyme that is known to cleave the phospho-glycerol bond found in GPI-anchored proteins. Treatment with PLC will cause release of GPI-linked proteins from the outer cell membrane. The T-cell marker Thy-1 and acetylcholinesterase, as well as both intestinal and placental alkaline phosphatases, are known to be GPI-linked and are released by treatment with PLC. GPI-linked proteins are thought to be preferentially located in lipid rafts, suggesting a high level of organization within plasma membrane microdomains.

    [0476] A review of GPI anchors written by Ferguson, Kinoshita and Hart is available in Chapter 11 of Essentials of Glycobiology 2.sup.nd Edition.

    [0477] Virus as employed herein refers to an oncolytic replication competent virus (or adenovirus) or a replication deficient viral vector (adenoviral vector) unless the context indicates otherwise.

    [0478] In one embodiment the adenovirus is a human adenovirus. Adenovirus, serotype or adenoviral serotype as employed herein refers to any adenovirus that can be assigned to any of the over 50 currently known adenoviral serotypes, which are classified into subgroups A-F, and further extends to any, as yet, unidentified or unclassified adenoviral serotypes. See, for example, Strauss, Adenovirus infections in humans, in The Adenoviruses, Ginsberg, ea., Plenum Press, New York, N.Y., pp. 451-596 (1984) and Shenk, Adenoviridae: The Viruses and Their Replication, in Fields Virology, Vol. 2, Fourth Edition, Knipe, 35ea., Lippincott Williams & Wilkins, pp. 2265-2267 (2001), as shown:

    TABLE-US-00005 SubGroup Adenoviral Serotype A 12, 18, 31 B 3, 7, 11, 14, 16, 21, 34, 35,51 C 1, 2, 5, 6 D 8-10, 13, 15, 17, 19, 20, 22-30, 32, 33,36-39,42-49, E 4 F 40,41

    [0479] In one embodiment the adenovirus is a subgroup B, for example independently selected from the group comprising or consisting of: Ad3, Ad7, Ad11, Ad14, Ad16, Ad21, Ad34 and Ad51, such as Ad11, in particular Ad11p (the Slobitski strain). In one embodiment the adenovirus of the invention has the capsid, such as the hexon and/or fibre of a subgroup B adenovirus, such as Ad11, in particular Ad11p. In one embodiment the adenovirus is Ad11 or has the fibre and/or hexon and/or penton of Ad11, such as Ad11p.

    [0480] A derivative of Ad11 virus as employed herein refers to a virus with at least the capsid of Ad11.

    [0481] In one embodiment it is not a group A virus.

    [0482] Enadenotucirev (EnAd) is a chimeric oncolytic adenovirus, formerly known as EnAd (WO2005/118825), with fibre, penton and hexon from Ad11p, hence it is a subgroup B virus. It has a chimeric E2B region, which comprises DNA from Ad11p and Ad3. Almost all of the E3 region and part of the E4 region is deleted in EnAd. Therefore, it has significant space in the genome to accommodate additional genetic material whilst remaining viable. Furthermore, because EnAd is a subgroup B adenovirus, pre-existing immunity in humans is less common than, for example, Ad5. Other examples of chimeric oncolytic viruses with Ad11 fibre, penton and hexon include OvAd1 and OvAd2 (see WO2006/060314).

    [0483] EnAd seems to preferentially infect tumour cells, replicates rapidly in these cells and causes cell lysis. This, in turn, can generate inflammatory immune responses thereby stimulating the body to also fight the cancer. Part of the success of EnAd is hypothesised to be related to the fast replication of the virus in vivo.

    [0484] Importantly, it has been demonstrated clinically that EnAd can be administered systemically (e.g. by intravenous or intraperitoneal injection or infusion) and then subsequently selectively infect and express proteins within tumour cells. This property of EnAd, which may be shared by Ad11p and other group B adenoviruses in particular those expressing the capsid proteins of Ad11p (such as those described herein), makes it possible to express proteins on the surface of cancer cells without having to directly inject the transgenes into the tumour which is not feasible for many cancers.

    [0485] Whilst EnAd selectively lyses tumour cells, it may be possible to introduce further beneficial properties, for example increasing the therapeutic activity of the virus or reducing side-effects of the virus by arming it with transgenes, such as a transgene which encodes a cell signalling protein or an antibody, or a transgene which encodes an entity which stimulates a cell signalling protein(s).

    [0486] Advantageously arming a virus, with DNA encoding certain proteins that can be expressed inside the cancer cell, may enable the body's own defenses to be employed to combat tumour cells more effectively, for example by making the cells more visible to the immune system or by delivering a therapeutic gene/protein preferentially to target tumour cells.

    [0487] In one embodiment the oncolytic virus or viral of the present disclosure stimulates the patient's immune system to fight the tumor, for example the anti-CD3 antibody stimulates T cells in vivo.

    [0488] In one embodiment the oncolytic virus has a fibre, hexon and penton proteins from the same serotype, for example Ad11, in particular Ad11p, for example found at positions 30812-31789, 18254-21100 and 13682-15367 of the genomic sequence of the latter wherein the nucleotide positions are relative to Genbank ID 217307399 (accession number: GC689208).

    [0489] In one embodiment the adenovirus is enadenotucirev (also known as EnAd and formerly as ColoAd1). Enadenotucirev as employed herein refers the chimeric adenovirus of SEQ ID NO: 21. It is a replication competent oncolytic chimeric adenovirus which has enhanced therapeutic properties compared to wild type adenoviruses (see WO2005/118825). EnAd has a chimeric E2B region, which features DNA from Ad11p and Ad3, and deletions in E3/E4. The structural changes in enadenotucirev result in a genome that is approximately 3.5 kb smaller than Ad11p thereby providing additional space for the insertion of transgenes.

    [0490] Linkers suitable for use in fusion proteins of the present disclosure include: [0491] hinge linker sequences shown in SEQ ID NO: 22 to 30 (see associated sequence listing); [0492] flexible linker sequences GS and also the sequences shown in SEQ ID NO: 31 to 70 (see associated sequence listing); [0493] linker sequences shown in SEQ ID NO: 73 to 86

    [0494] Examples of rigid linkers include the peptide sequences GAPAPAAPAPA (SEQ ID NO: 71), PPPP (SEQ ID NO: 72) and PPP.

    Definitions Relevant to Formula (I) and (Ia)

    [0495] A bond refers to a covalent bond connecting the one DNA sequence to another DNA sequence, for example connecting one section of the virus genome to another. Thus when a variable in formula (I) and (Ia) herein represents a bond the feature or element represented by the bond is absent i.e. deleted.

    [0496] As the structure of adenoviruses is, in general, similar the elements below are discussed in terms of the structural elements and the commonly used nomenclature referring thereto, which are known to the skilled person. When an element is referred to herein then we refer to the DNA sequence encoding the element or a DNA sequence encoding the same structural protein of the element in an adenovirus. The latter is relevant because of the redundancy of the DNA code. The viruses' preference for codon usage may need to be considered for optimised results.

    [0497] Any structural element from an adenovirus employed in the viruses of the present disclosure may comprise or consist of the natural sequence or may have similarity over the given length of at least 95%, such as 96%, 97%, 98%, 99% or 100%. The original sequence may be modified to omit 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% or 1% of the genetic material. The skilled person is aware that when making changes the reading frames of the virus must be not disrupted such that the expression of structural proteins is disrupted.

    [0498] In one embodiment the given element is a full-length sequence i.e. the full-length gene.

    [0499] In one embodiment the given element is less than a full-length and retains the same or corresponding function as the full-length sequence.

    [0500] In one embodiment for a given element which is optional in the constructs of the present disclosure, the DNA sequence may be less than a full-length and have no functionality, for example the E3 region may be totally or partly deleted.

    [0501] The structural genes encoding structural or functional proteins of the adenovirus are generally linked by non-coding regions of DNA. Thus there is some flexibility about where to cut the genomic sequence of the structural element of interest (especially non-coding regions thereof) for the purpose of inserting a transgene into the viruses of the present disclosure. Thus for the purposes of the present specification, the element will be considered a structural element of reference to the extent that it is fit for purpose and does not encode extraneous material. Thus, if appropriate the gene will be associated with suitable non-coding regions, for example as found in the natural structure of the virus.

    [0502] Thus in one embodiment an insert, such as DNA encoding a restriction site and/or transgene, is inserted into a non-coding region of genomic virus DNA, such as an intron or intergenic sequence. Having said this some non-coding regions of adenovirus may have a function, for example in alternative splicing, transcription regulation or translation regulation, and this may need to be taken into consideration.

    [0503] The sites identified herein, that are associated with the L5 region, are suitable for accommodating a variety of DNA sequences encoding complex entities such as RNAi, cytokines, single chain or multimeric proteins, such as antibodies.

    [0504] Gene as employed herein refers to coding and any non-coding sequences associated therewith, for example introns and associated exons. In one embodiment a gene comprises or consists of only essential structural components, for example coding region.

    Below follows a discussion relating to specific structural elements of adenoviruses.

    [0505] The Inverted Terminal Repeat (ITR) sequences are common to all known adenoviruses and were so named because of their symmetry, and are the viral chromosome origins of replication. Another property of these sequences is their ability to form a hairpin.

    [0506] The 5ITR as employed herein refers to part or all of an ITR from the 5 end of an adenovirus, which retains the function of the ITR when incorporated into an adenovirus in an appropriate location. In one embodiment the 5ITR comprises or consists of the sequence from about 1 bp to 138 bp of SEQ ID NO: 82 or a sequence 90, 95, 96, 97, 98 or 99% identical thereto along the whole length, in particular the sequence consisting of from about 1 bp to 138 bp of SEQ ID NO: 21.

    [0507] The 3ITR as employed herein refers to part or all of an ITR from 3 end of an adenovirus which retains the function of the ITR when incorporated into an adenovirus in an appropriate location. In one embodiment the 3ITR comprises or consists of the sequence from about 32189 bp to 32326 bp of SEQ ID NO: 82 or a sequence 90, 95, 96, 97, 98 or 99% identical thereto along the whole length, in particular the sequence consisting of from about 32189 bp to 32326 bp of SEQ ID NO: 21.

    [0508] B1 as employed herein refers to the DNA sequence encoding: part or all of an E1A from an adenovirus, part or all of the E1B region of an adenovirus, and independently part or all of E1A and E1B region of an adenovirus.

    [0509] When B1 is a bond then E1A and E1B sequences will be omitted from the virus. In one embodiment B1 is a bond and thus the virus is a vector.

    [0510] In one embodiment B1 further comprises a transgene. It is known in the art that the E1 region can accommodate a transgene which may be inserted in a disruptive way into the E1 region (i.e. in the middle of the sequence) or part or all of the E1 region may be deleted to provide more room to accommodate genetic material.

    [0511] E1A as employed herein refers to the DNA sequence encoding part or all of an adenovirus E1A region. The latter here is referring to the polypeptide/protein E1A. It may be mutated such that the protein encoded by the E1A gene has conservative or non-conservative amino acid changes, such that it has: the same function as wild-type (i.e. the corresponding non-mutated protein); increased function in comparison to wild-type protein; decreased function, such as no function in comparison to wild-type protein; or has a new function in comparison to wild-type protein or a combination of the same as appropriate.

    [0512] E1B as employed herein refers to the DNA sequence encoding part or all of an adenovirus E1B region (i.e. polypeptide or protein), it may be mutated such that the protein encoded by the E1B gene/region has conservative or non-conservative amino acid changes, such that it has: the same function as wild-type (i.e. the corresponding non-mutated protein); increased function in comparison to wild-type protein; decreased function, such as no function in comparison to wild-type protein; or has a new function in comparison to wild-type protein or a combination of the same as appropriate.

    [0513] Thus B1 can be modified or unmodified relative to a wild-type E1 region, such as a wild-type E1A and/or E1B. The skilled person can easily identify whether E1A and/or E1B are present or (part) deleted or mutated.

    [0514] Wild-type as employed herein refers to a known adenovirus. A known adenovirus is one that has been identified and named, regardless of whether the sequence is available.

    [0515] In one embodiment B1 has the sequence from 139 bp to 3932 bp of SEQ ID NO: 21.

    [0516] B.sub.A as employed herein refers to the DNA sequence encoding the E2B-L1-L2-L3-E2A-L4 regions including any non-coding sequences, as appropriate (in particular corresponding to the natural sequence from an adenovirus). Generally this sequence will not comprise a transgene. In one embodiment the sequence is substantially similar or identical to a contiguous sequence from a known adenovirus, for example a serotype shown in Table 1, in particular a group B virus, for example Ad3, Ad7, Ad11, Ad14, Ad16, Ad21, Ad34, Ad35, Ad51 or a combination thereof, such as Ad3, Ad11 or a combination thereof. In one embodiment is E2B-L1-L2-L3-E2A-L4 refers to comprising these elements and other structural elements associated with the region, for example BA will generally include the sequence encoding the protein IV2a, for example as follows: IV2A IV2a-E2B-L1-L2-L3-E2A-L4.

    [0517] In one embodiment the E2B region is chimeric. That is, comprises DNA sequences from two or more different adenoviral serotypes, for example from Ad3 and Ad11, such as Ad11p. In one embodiment the E2B region has the sequence from 5068 bp to 10355 bp of SEQ ID NO: 21 or a sequence 95%, 96%, 97%, 98% or 99% identical thereto over the whole length.

    [0518] In one embodiment the E2B in component B.sub.A comprises the sequences shown in SEQ ID NO: 87 (which corresponds to SEQ ID NO: 3 disclosed in WO2005/118825).

    [0519] In one embodiment BA has the sequence from 3933 bp to 27184 bp of SEQ ID NO: 21.

    [0520] E3 as employed herein refers to the DNA sequence encoding part or all of an adenovirus E3 region (i.e. protein/polypeptide), it may be mutated such that the protein encoded by the E3 gene has conservative or non-conservative amino acid changes, such that it has the same function as wild-type (the corresponding unmutated protein); increased function in comparison to wild-type protein; decreased function, such as no function in comparison to wild-type protein or has a new function in comparison to wild-type protein or a combination of the same, as appropriate.

    [0521] In one embodiment the E3 region is form an adenovirus serotype given in Table 1 or a combination thereof, in particular a group B serotype, for example Ad3, Ad7, Ad11 (in particular Ad11p), Ad14, Ad16, Ad21, Ad34, Ad35, Ad51 or a combination thereof, such as Ad3, Ad11 (in particular Ad11p) or a combination thereof.

    [0522] In one embodiment the E3 region is partially deleted, for example is 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 5% deleted.

    [0523] In one embodiment B.sub.2 is a bond, wherein the DNA encoding the E3 region is absent.

    [0524] In one embodiment the DNA encoding the E3 region can be replaced or interrupted by a transgene. As employed herein E3 region replaced by a transgene as employed herein includes part or all of the E3 region is replaced with a transgene.

    [0525] In one embodiment the B.sub.2 region comprises the sequence from 27185 bp to 28165 bp of SEQ ID NO: 21.

    [0526] In one embodiment B.sub.2 consists of the sequence from 27185 bp to 28165 bp of SEQ ID NO: 21.

    [0527] B.sub.X as employed herein refers to the DNA sequence in the vicinity of the 5 end of the L5 gene in BB. In the vicinity of or proximal to the 5 end of the L5 gene as employed herein refers to: adjacent (contiguous) to the 5 end of the L5 gene or a non-coding region inherently associated herewith i.e. abutting or contiguous to the 5 prime end of the L5 gene or a non-coding region inherently associated therewith. Alternatively, in the vicinity of or proximal to may refer to being close the L5 gene, such that there are no coding sequences between the BX region and the 5 end of L5 gene.

    [0528] Thus in one embodiment B.sub.X is joined directly to a base of L5 which represents, for example the start of a coding sequence of the L5 gene.

    [0529] Thus in one embodiment B.sub.X is joined directly to a base of L5 which represents, for example the start of a non-coding sequence, or joined directly to a non-coding region naturally associated with L5. A non-coding region naturally associated L5 as employed herein refers to part of all of a non-coding regions which is part of the L5 gene or contiguous therewith but not part of another gene.

    [0530] In one embodiment B.sub.X comprises the sequence of SEQ ID NO: 88. This sequence is an artificial non-coding sequence wherein a DNA sequence, for example comprising a transgene (or transgene cassette), a restriction site or a combination thereof may be inserted therein. This sequence is advantageous because it acts as a buffer in that allows some flexibility on the exact location of the transgene whilst minimising the disruptive effects on virus stability and viability.

    [0531] The insert(s) can occur anywhere within SEQ ID NO: 82 from the 5 end, the 3 end or at any point between bp 1 to 201, for example between base pairs 1/2, 2/3, 3/4, 4/5, 5/6, 6/7, 7/8, 8/9, 9/10, 10/11, 11/12, 12/13, 13/14, 14/15, 15/16, 16/17, 17/18, 18/19, 19/20, 20/21, 21/22, 22/23, 23/24, 24/25, 25/26, 26/27, 27/28, 28/29, 29/30, 30/31, 31/32, 32/33, 33/34, 34/35, 35/36, 36/37, 37/38, 38/39, 39/40, 40/41, 41/42, 42/43, 43/44, 44/45, 45/46, 46/47, 47/48, 48/49, 49/50, 50/51, 51/52, 52/53, 53/54, 54/55, 55/56, 56/57, 57/58, 58/59, 59/60, 60/61, 61/62, 62/63, 63/64, 64/65, 65/66, 66/67, 67/68, 68/69, 69/70, 70/71, 71/72, 72/73, 73/74, 74/75, 75/76, 76/77, 77/78, 78/79, 79/80, 80/81, 81/82, 82/83, 83/84, 84/85, 85/86, 86/87, 87/88, 88/89, 89/90, 90/91, 91/92, 92/93, 93/94, 94/95, 95/96, 96/97, 97/98, 98/99, 99/100, 100/101, 101/102, 102/103, 103/104, 104/105, 105/106, 106/107, 107/108, 108/109, 109/110, 110/111, 111/112, 112/113, 113/114, 114/115, 115/116, 116/117, 117/118, 118/119, 119/120, 120/121, 121/122, 122/123, 123/124, 124/125, 125/126, 126/127, 127/128, 128/129, 129/130, 130/131, 131/132, 132/133, 133/134, 134/135, 135/136, 136/137, 137/138, 138/139, 139/140, 140/141, 141/142, 142/143, 143/144, 144/145, 145/146, 146/147, 147/148, 148/149, 150/151, 151/152, 152/153, 153/154, 154/155, 155/156, 156/157, 157/158, 158/159, 159/160, 160/161, 161/162, 162/163, 163/164, 164/165, 165/166, 166/167, 167/168, 168/169, 169/170, 170/171, 171/172, 172/173, 173/174, 174/175, 175/176, 176/177, 177/178, 178/179, 179/180, 180/181, 181/182, 182/183, 183/184, 184/185, 185/186, 186/187, 187/188, 189/190, 190/191, 191/192, 192/193, 193/194, 194/195, 195/196, 196/197, 197/198, 198/199, 199/200 or 200/201.

    [0532] In one embodiment B.sub.X comprises SEQ ID NO: 21 with a DNA sequence inserted between bp 27 and bp 28 or a place corresponding to between positions 28192 bp and 28193 bp of SEQ ID NO: 21.

    [0533] In one embodiment B.sub.X has the sequence from 28166 bp to 28366 bp of SEQ ID NO: 21. In one embodiment B.sub.X is a bond.

    [0534] B.sub.B as employed herein refers to the DNA sequence encoding the L5 region. As employed herein the L5 region refers to the DNA sequence containing the gene encoding the fibre polypeptide/protein, as appropriate in the context. The fibre gene/region encodes the fibre protein which is a major capsid component of adenoviruses. The fibre functions in receptor recognition and contributes to the adenovirus' ability to selectively bind and infect cells.

    [0535] In viruses of the present disclosure the fibre can be from any adenovirus serotype and adenoviruses which are chimeric as result of changing the fibre for one of a different serotype are known. In one embodiment the fibre is from a group B virus, in particular Ad11, such as Ad11p.

    [0536] DNA sequence in relation to B.sub.Y as employed herein refers to the DNA sequence in the vicinity of the 3 end of the L5 gene of B.sub.B. In the vicinity of or proximal to the 3 end of the L5 gene as employed herein refers to: adjacent (contiguous) to the 3 end of the L5 gene or a non-coding region inherently associated therewith i.e. abutting or contiguous to the 3 prime end of the L5 gene or a non-coding region inherently associated therewith (i.e. all or part of an non-coding sequence endogenous to L5). Alternatively, in the vicinity of or proximal to may refer to being close the L5 gene, such that there are no coding sequences between the B.sub.Y region and the 3 end of the L5 gene.

    [0537] Thus in one embodiment B.sub.Y is joined directly to a base of L5 which represents the end of a coding sequence.

    [0538] Thus in one embodiment B.sub.Y is joined directly to a base of L5 which represents the end of a non-coding sequence, or joined directly to a non-coding region naturally associated with L5.

    [0539] Inherently and naturally are used interchangeably herein. In one embodiment B.sub.Y comprises the sequence of SEQ ID NO: 89. This sequence is a non-coding sequence wherein a DNA sequence, for example comprising a transgene (or transgene cassette), a restriction site or a combination thereof may be inserted. This sequence is advantageous because it acts a buffer in that allows some flexibility on the exact location of the transgene whilst minimising the disruptive effects on virus stability and viability.

    [0540] The insert(s) can occur anywhere within SEQ ID NO: 88 from the 5 end, the 3 end or at any point between bp 1 to 35, for example between base pairs 1/2, 2/3, 3/4, 4/5, 5/6, 6/7, 7/8, 8/9, 9/10, 10/11, 11/12, 12/13, 13/14, 14/15, 15/16, 16/17, 17/18, 18/19, 19/20, 20/21, 21/22, 22/23, 23/24, 24/25, 25/26, 26/27, 27/28, 28/29, 29/30, 30/31, 31/32, 32/33, 33/34, or 34/35.

    [0541] In one embodiment B.sub.Y comprises SEQ ID NO: 89 with a DNA sequence inserted between positions bp 12 and 13 or a place corresponding to 29356 bp and 29357 bp in SEQ ID NO: 21. In one embodiment the insert is a restriction site insert. In one embodiment the restriction site insert comprises one or two restriction sites. In one embodiment the restriction site is a 19 bp restriction site insert comprising 2 restriction sites. In one embodiment the restriction site insert is a 9 bp restriction site insert comprising 1 restriction site. In one embodiment the restriction site insert comprises one or two restriction sites and at least one transgene, for example one or two or three transgenes, such as one or two transgenes. In one embodiment the restriction site is a 19 bp restriction site insert comprising 2 restriction sites and at least one transgene, for example one or two transgenes. In one embodiment the restriction site insert is a 9 bp restriction site insert comprising 1 restriction site and at least one transgene, for example one or two transgenes. In one embodiment two restriction sites sandwich one or more, such as two transgenes (for example in a transgene cassette). In one embodiment when BY comprises two restrictions sites the said restriction sites are different from each other. In one embodiment said one or more restrictions sites in B.sub.Y are non-naturally occurring (such as unique) in the particular adenovirus genome into which they have been inserted. In one embodiment said one or more restrictions sites in BY are different to other restrictions sites located elsewhere in the adenovirus genome, for example different to naturally occurring restrictions sites or restriction sites introduced into other parts of the genome, such as BX. Thus in one embodiment the restriction site or sites allow the DNA in the section to be cut specifically.

    [0542] In one embodiment B.sub.Y has the sequence from 29345 bp to 29379 bp of SEQ ID NO: 21. In one embodiment B.sub.Y is a bond.

    [0543] In one embodiment the insert is after bp 12 in SEQ ID NO: 89.

    [0544] In one embodiment the insert is at about position 29356 bp of SEQ ID NO: 21.

    [0545] In one embodiment the insert is a transgene cassette comprising one or more transgenes, for example 1, 2 or 3, such as 1 or 2.

    [0546] E4 as employed herein refers to the DNA sequence encoding part or all of an adenovirus E4 region (i.e. polypeptide/protein region), which may be mutated such that the protein encoded by the E4 gene has conservative or non-conservative amino acid changes, and has the same function as wild-type (the corresponding non-mutated protein); increased function in comparison to wild-type protein; decreased function, such as no function in comparison to wild-type protein or has a new function in comparison to wild-type protein or a combination of the same as appropriate.

    [0547] In one embodiment the E4 region is partially deleted, for example is 95%, 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10% or 5% deleted. In one embodiment the E4 region has the sequence from 32188 bp to 29380 bp of SEQ ID NO: 21.

    [0548] In one embodiment E4 is present except for the E4orf4 region which is deleted.

    [0549] In one embodiment B.sub.3 is a bond, i.e. wherein E4 is absent.

    [0550] In one embodiment B.sub.3 has the sequence consisting of from 32188 bp to 29380 bp of SEQ ID NO: 21.

    [0551] As employed herein number ranges are inclusive of the end points.

    [0552] The skilled person will appreciate that the elements in the formulas herein, such as formula (I), (Ia) are contiguous and may embody non-coding DNA sequences as well as the genes and coding DNA sequences (structural features) mentioned herein. In one or more embodiments the formulas of the present disclosure are attempting to describe a naturally occurring sequence in the adenovirus genome. In this context it will be clear to the skilled person that the formula is referring to the major elements characterising the relevant section of genome and is not intended to be an exhaustive description of the genomic stretch of DNA.

    [0553] E1A, E1B, E3 and E4 as employed herein each independently refer to the wild-type and equivalents thereof, mutated or partially deleted forms of each region as described herein, in particular a wild-type sequence from a known adenovirus.

    [0554] Insert as employed herein refers to a DNA sequence that is incorporated either at the 5 end, the 3 end or within a given DNA sequence reference segment such that it interrupts the reference sequence. The latter is a reference sequence employed as a reference point relative to which the insert is located. In the context of the present disclosure inserts generally occur within either SEQ ID NO: 88 or SEQ ID NO: 89. An insert can be either a restriction site insert, a transgene cassette or both. When the sequence is interrupted the virus will still comprise the original sequence, but generally it will be as two fragments sandwiching the insert.

    [0555] In one embodiment the transgene or transgene cassette does not comprise a non-biased inserting transposon, such as a TN7 transposon or part thereof. Tn7 transposon as employed herein refers to a non-biased insertion transposon as described in WO2008/080003.

    [0556] In one embodiment the transgene or transgene cassette further comprises a regulatory element or sequence.

    Other Regulatory Sequences

    [0557] Regulator of gene expression (or regulator/regulatory element) as employed herein refers to a genetic feature, such as a promoter, enhancer or a splice acceptor sequence that plays a role in gene expression, typically by initiating or enhancing transcription or translation.

    [0558] Splice acceptor sequence, splice acceptor or splice site as employed herein refers to a regulatory sequence determining when an mRNA molecule will be recognised by small nuclear ribonucleoproteins of the spliceosome complex. Once assembled the spliceosome catalyses splicing between the splice acceptor site of the mRNA molecule to an upstream splice donor site producing a mature mRNA molecule that can be translated to produce a single polypeptide or protein.

    [0559] Different sized splice acceptor sequences may be employed in the present invention and these can be described as short splice acceptor (small), splice acceptor (medium) and branched splice acceptor (large).

    [0560] SSA as employed herein means a short splice acceptor, typically comprising just the splice site, for example 4 bp. SA as employed herein means a splice acceptor, typically comprising the short splice acceptor and the polypyrimidine tract, for example 16 bp. bSA as employed herein means a branched splice acceptor, typically comprising the short splice acceptor, polypyrimidine tract and the branch point, for example 26 bp.

    [0561] In one embodiment the splice acceptor employed in the constructs of the disclosure are CAGG or SEQ ID NO: 90 or 91. In one embodiment the SSA has the nucleotide sequence CAGG. In one embodiment the SA has the nucleotide sequence of SEQ ID NO: 90. In one embodiment the SA has the nucleotide sequence of SEQ ID NO: 91.

    [0562] In one embodiment the splice site is immediately proceeded (i.e. followed in a 5 to 3 direction) by a consensus Kozak sequence comprising CCACC. In one embodiment the splice site and the Kozak sequence are interspersed by up to 100 or less bp. In one embodiment the Kozak sequence has the nucleotide sequence of CCACC.

    [0563] Typically, when under the control of an endogenous or exogenous promoter (such as an endogenous promoter), the coding sequence will be immediately preceded by a Kozak sequence. The start of the coding region is indicated by the initiation codon (AUG), for example is in the context of the sequence (gcc)gccRccAUGg [SEQ ID NO: 92] the start of the start of the coding sequences is indicated by the bases in bold. A lower case letter denotes common bases at this position (which can nevertheless vary) and upper case letters indicate highly-conserved bases, i.e. the AUGG sequence is constant or rarely, if ever, changes; R indicates that a purine (adenine or guanine) is usually observed at this position and the sequence in brackets (gcc) is of uncertain significance. Thus in one embodiment the initiation codon AUG is incorporated into a Kozak sequence.

    [0564] Internal Ribosome Entry DNA Sequence as employed herein refers to a DNA sequence encoding an Internal Ribosome Entry Sequence (IRES). IRES as employed herein means a nucleotide sequence that allows for initiation of translation a messenger RNA (mRNA) sequence, including initiation starting within an mRNA sequence. This is particularly useful when the cassette encodes polycistronic mRNA. Using an IRES results in a polycistronic mRNA that is translated into multiple individual proteins or peptides. In one embodiment the Internal Ribosome Entry DNA sequence has the nucleotide sequence of SEQ ID NO: 93. In one embodiment a particular IRES is only used once in the genome. This may have benefits with respect to stability of the genome.

    [0565] High self-cleavage efficiency 2A peptide or 2A peptide as employed herein refers to a peptide which is efficiently cleaved following translation. Suitable 2A peptides include P2A, F2A, E2A and T2A. The present inventors have noted that once a specific DNA sequence encoding a given 2A peptide is used once, the same specific DNA sequence may not be used a second time. However, redundancy in the DNA code may be utilised to generate a DNA sequence that is translated into the same 2A peptide. Using 2A peptides is particularly useful when the cassette encodes polycistronic mRNA. Using 2A peptides results in a single polypeptide chain being translated which is modified post-translation to generate multiple individual proteins or peptides.

    [0566] In one embodiment the encoded P2A peptide employed has the amino acid sequence of SEQ ID NO: 94. In one embodiment the encoded F2A peptide employed has the amino acid sequence of SEQ ID NO: 95. In one embodiment the encoded E2A peptide employed has the amino acid sequence of SEQ ID NO: 96. In one embodiment the encoded T2A peptide employed has the amino acid sequence of SEQ ID NO: 97.

    [0567] In one embodiment an mRNA or each mRNA encoded by transgene is/are comprise a polyadenylation signal sequence, such as typically at the end of an mRNA sequence. Thus one embodiment the transgene or the transgene cassette comprises at least one sequence encoding a polyadenylation signal sequence.

    [0568] PolyA, Polyadenylation signal or polyadenylation sequence as employed herein means a DNA sequence, usually containing an AATAAA site, that once transcribed can be recognised by a multiprotein complex that cleaves and polyadenylates the nascent mRNA molecule.

    [0569] In one embodiment the construct does not include a polyadenylation sequence. In one embodiment the regulator of gene expression is a splice acceptor sequence.

    [0570] In one embodiment the sequence encoding a protein/polypeptide/peptide, such as an antibody or antibody fragment further comprises a polyadenylation signal.

    [0571] In one embodiment there is provided a virus or construct with a sequence disclosed herein.

    Antibodies

    [0572] Antibody molecule as employed herein includes any construct comprising a full length antibody or a binding fragment thereof, multispecific antibody formats. Thus the antibody molecules of the present invention include a complete antibody molecule having full length heavy and light chains or a fragment thereof and may be, but are not limited to Fab, modified Fab, Fab, modified Fab, F(ab)2, Fv, Fab-Fv, Fab-dsFv, single domain antibodies (e.g. VH or VL or VHH), scFv, bi, tri or tetra-valent antibodies, Bis-scFv, diabodies, triabodies, tetrabodies and epitope-binding fragments of any of the above (see for example Holliger and Hudson, 2005, Nature Biotech. 23(9):1126-1136; Adair and Lawson, 2005, Drug Design ReviewsOnline 2(3), 209-217). The methods for creating and manufacturing these antibody fragments are well known in the art (see for example Verma et al., 1998, Journal of Immunological Methods, 216, 165-181). Other antibody fragments for use in the present invention include the Fab and Fab fragments described in International patent applications WO2005/003169, WO2005/003170 and WO2005/003171. Multi-valent antibodies may comprise multiple specificities e.g. bispecific or may be monospecific (see for example WO 92/22853 and WO05/113605). Bispecific and multispecific antibody variants are especially considered in this example since the aim is to neutralise two independent target proteins:

    Unless the context indicates otherwise antibody will generally refer to a full length antibody.

    [0573] Antibody binding fragment as employed herein refers to less than a full-length antibody, which retains specificity for the target antigen. Antibody binding fragments may include a Fab, Fab, modified Fab, F(ab)2, Fv, Fab-Fv, Fab-dsFv, single domain antibodies (e.g. VH or VL or VHH), scFv, ds-scFv.

    [0574] In one embodiment antibodies or binding fragments thereof employed in the technology of the present disclosure are monoclonal.

    [0575] Monoclonal antibodies for use in the present disclosure may be prepared by any method known in the art such as the hybridoma technique (Kohler & Milstein, 1975, Nature, 256:495-497), the trioma technique, the human B-cell hybridoma technique (Kozbor et al., 1983, Immunology Today, 4:72) and the EBV-hybridoma technique (Cole et al., Monoclonal Antibodies and Cancer Therapy, pp 77-96, Alan R Liss, Inc., 1985).

    [0576] Antibodies for use in the invention may also be generated using single lymphocyte antibody methods by cloning and expressing immunoglobulin variable region cDNAs generated from single lymphocytes selected for the production of specific antibodies by, for example, the methods described by Babcook, J. et al., 1996, Proc. Natl. Acad. Sci. USA 93(15):7843-78481; WO92/02551; WO2004/051268 and International Patent Application number WO2004/106377. Binding domains employed in antibody molecules of the present disclosure may be humanised. Humanised antibodies (which include CDR-grafted antibodies) are antibody molecules having one or more complementarity determining regions (CDRs) from a non-human species and a framework region from a human immunoglobulin molecule (see, e.g. U.S. Pat. No. 5,585,089; WO91/09967). It will be appreciated that it may only be necessary to transfer the specificity determining residues of the CDRs rather than the entire CDR (see for example, Kashmiri et al., 2005, Methods, 36, 25-34). Humanised antibodies may optionally further comprise one or more framework residues derived from the non-human species from which the CDRs were derived.

    [0577] When the CDRs or specificity determining residues are grafted, any appropriate acceptor variable region framework sequence may be used having regard to the class/type of the donor antibody from which the CDRs are derived, including mouse, primate and human framework regions. Suitably, the humanised antibody according to the present invention has a variable domain comprising human acceptor framework regions as well as one or more of the CDRs provided herein.

    [0578] Examples of human frameworks which can be used in the present invention are KOL, NEWM, REI, EU, TUR, TEI, LAY and POM (Kabat et al., supra). For example, KOL and NEWM can be used for the heavy chain, REI can be used for the light chain and EU, LAY and POM can be used for both the heavy chain and the light chain. Alternatively, human germline sequences may be used; these are available at: http://vbase.mrc-cpe.cam.ac.uk/

    [0579] In a humanised antibody of the present invention, the acceptor heavy and light chains do not necessarily need to be derived from the same antibody and may, if desired, comprise composite chains having framework regions derived from different chains.

    Also, in a humanised antibody of the present invention, the framework regions need not have exactly the same sequence as those of the acceptor antibody. For instance, unusual residues may be changed to more frequently-occurring residues for that acceptor chain class or type. Alternatively, selected residues in the acceptor framework regions may be changed so that they correspond to the residue found at the same position in the donor antibody (see Reichmann et al., 1998, Nature, 332, 323-324). Such changes should be kept to the minimum necessary to recover the affinity of the donor antibody. A protocol for selecting residues in the acceptor framework regions which may need to be changed is set forth in WO 91/09967.

    [0580] The constant region domains of the antibody molecule of the present invention, if present, may be selected having regard to the proposed function of the antibody molecule, and in particular the effector functions which may be required. For example, the constant region domains may be human IgA, IgD, IgE, IgG or IgM domains. In particular, human IgG constant region domains may be used, especially of the IgG1 and IgG3 isotypes when the antibody molecule is intended for therapeutic uses and antibody effector functions are required. Alternatively, IgG2 and IgG4 isotypes may be used when the antibody molecule is intended for therapeutic purposes and antibody effector functions are not required, e.g. for simply neutralising or agonising an antigen. It will be appreciated that sequence variants of these constant region domains may also be used. For example IgG4 molecules in which the serine at position 241 has been changed to proline as described in Angal et al., Molecular Immunology, 1993, 30 (1), 105-108 may be used. It will also be understood by one skilled in the art that antibodies may undergo a variety of posttranslational modifications. The type and extent of these modifications often depends on the host cell line used to express the antibody as well as the culture conditions. Such modifications may include variations in glycosylation, methionine oxidation, diketopiperazine formation, aspartate isomerization and asparagine deamidation. A frequent modification is the loss of a carboxy-terminal basic residue (such as lysine or arginine) due to the action of carboxypeptidases (as described in Harris, R J. Journal of Chromatography 705:129-134, 1995).

    Formulations

    [0581] The present disclosure relates also extends to a pharmaceutical formulation of a virus as described herein.

    [0582] In one embodiment there is provided a liquid parenteral formulation, for example for infusion or injection, of a replication capable oncolytic virus or replication deficient viral vector according to the present disclosure wherein the formulation provides a dose in the range of 1?10.sup.10 to 1?10.sup.14 viral particles per volume of dose.

    [0583] Parenteral formulation means a formulation designed not to be delivered through the GI tract. Typical parenteral delivery routes include injection, implantation or infusion. In one embodiment the formulation is provided in a form for bolus delivery.

    [0584] In one embodiment the parenteral formulation is in the form of an injection. Injection includes intravenous, subcutaneous, intra-tumoral or intramuscular injection. Injection as employed herein means the insertion of liquid into the body via a syringe. In one embodiment the method of the present disclosure does not involve intra-tumoral injection.

    [0585] In one embodiment the parenteral formulation is in the form of an infusion.

    [0586] Infusion as employed herein means the administration of fluids at a slower rate by drip, infusion pump, syringe driver or equivalent device. In one embodiment the infusion is administered over a period in the range of 1.5 minutes to 120 minutes, such as about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14 15, 16, 17, 18, 19 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 65, 80, 85, 90, 95, 100, 105, 110 or 115 minutes.

    [0587] In one embodiment one dose of the formulation less than 100 mls, for example 30 mls, such as administered by a syringe driver.

    [0588] In one embodiment the injection is administered as a slow injection, for example over a period of 1.5 to 30 minutes.

    [0589] In one embodiment the formulation is for intravenous (i.v.) administration. This route is particularly effective for delivery of oncolytic virus because it allows rapid access to the majority of the organs and tissue and is particular useful for the treatment of metastases, for example established metastases especially those located in highly vascularised regions such as the liver and lungs.

    [0590] Therapeutic formulations typically will be sterile and stable under the conditions of manufacture and storage. The composition can be formulated as a solution, microemulsion, liposome, or other parenteral formulation suitable for administration to a human and may be formulated as a pre-filled device such as a syringe or vial, particular as a single dose.

    [0591] The formulation will generally comprise a pharmaceutically acceptable diluent or carrier, for example a non-toxic, isotonic carrier that is compatible with the virus, and in which the virus is stable for the requisite period of time.

    [0592] The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a dispersant or surfactant such as lecithin or a non-ionic surfactant such as polysorbate 80 or 40. In dispersions the maintenance of the required particle size may be assisted by the presence of a surfactant. Examples of isotonic agents include sugars, polyalcohols such as mannitol, sorbitol, or sodium chloride in the composition.

    [0593] In one embodiment parenteral formulations employed may comprise one or more of the following a buffer, for example 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid, a phosphate buffer and/or a Tris buffer, a sugar for example dextrose, mannose, sucrose or similar, a salt such as sodium chloride, magnesium chloride or potassium chloride, a detergent such as a non-ionic surfactant such as brij, PS-80, PS-40 or similar. The formulation may also comprise a preservative such as EDTA or ethanol or a combination of EDTA and ethanol, which are thought to prevent one or more pathways of possible degradation.

    [0594] In one embodiment the formulation will comprise purified oncolytic virus according to the present disclosure, for example 1?10.sup.18 to 1?10.sup.14 viral particles per dose, such as 1?10.sup.18 to 1?10.sup.12 viral particles per dose. In one embodiment the concentration of virus in the formulation is in the range 2?10.sup.8 to 2?10.sup.14 vp/mL, such as 2?10.sup.12 vp/ml.

    [0595] In one embodiment the parenteral formulation comprises glycerol.

    [0596] In one embodiment the formulation comprises oncolytic adenovirus as described herein, HEPES (N-2-hydroxyethylpiperazine-N-2-ethanesulfonic acid), glycerol and buffer.

    In one embodiment the parenteral formulation consists of virus of the disclosure, HEPES for example 5 mM, glycerol for example 5-20% (v/v), hydrochloric acid, for example to adjust the pH into the range 7-8 and water for injection.

    [0597] In one embodiment 0.7 mL of virus of the disclosure at a concentration of 2?10.sup.12 vp/mL is formulated in 5 mM HEPES, 20% glycerol with a final pH of 7.8.

    [0598] A thorough discussion of pharmaceutically acceptable carriers is available in Remington's Pharmaceutical Sciences (Mack Publishing Company, N.J. 1991).

    [0599] In one embodiment the formulation is provided as a formulation for topical administrations including inhalation.

    [0600] Suitable inhalable preparations include inhalable powders, metering aerosols containing propellant gases or inhalable solutions free from propellant gases. Inhalable powders according to the disclosure will generally contain a virus as described herein with a physiologically acceptable excipient.

    [0601] These inhalable powders may include monosaccharides (e.g. glucose or arabinose), disaccharides (e.g. lactose, saccharose, maltose), oligo- and polysaccharides (e.g. dextranes), polyalcohols (e.g. sorbitol, mannitol, xylitol), salts (e.g. sodium chloride, calcium carbonate) or mixtures of these with one another. Mono- or disaccharides are suitably used, the use of lactose or glucose, particularly but not exclusively in the form of their hydrates.

    [0602] Particles for deposition in the lung require a particle size less than 10 microns, such as 1-9 microns for example from 0.1 to 5 ?m, in particular from 1 to 5 ?m. The particle size of the carrying the virus is of primary importance and thus in one embodiment the virus according to the present disclosure may be adsorbed or absorbed onto a particle, such as a lactose particle of the given size.

    [0603] The propellant gases which can be used to prepare the inhalable aerosols are known in the art. Suitable propellant gases are selected from among hydrocarbons such as n-propane, n-butane or isobutane and halohydrocarbons such as chlorinated and/or fluorinated derivatives of methane, ethane, propane, butane, cyclopropane or cyclobutane. The above-mentioned propellant gases may be used on their own or in mixtures thereof.

    [0604] Particularly suitable propellant gases are halogenated alkane derivatives selected from among TG 11, TG 12, TG 134a and TG227. Of the abovementioned halogenated hydrocarbons, TG134a (1,1,1,2-tetrafluoroethane) and TG227 (1,1,1,2,3,3,3-heptafluoropropane) and mixtures thereof are particularly suitable.

    [0605] The propellant gas-containing inhalable aerosols may also contain other ingredients, such as co-solvents, stabilisers, surface-active agents (surfactants), antioxidants, lubricants and means for adjusting the pH. All these ingredients are known in the art.

    [0606] The propellant gas-containing inhalable aerosols according to the invention may contain up to 5% by weight of active substance. Aerosols according to the invention contain, for example, 0.002 to 5% by weight, 0.01 to 3% by weight, 0.015 to 2% by weight, 0.1 to 2% by weight, 0.5 to 2% by weight or 0.5 to 1% by weight of active ingredient.

    [0607] Alternatively topical administrations to the lung may also be by administration of a liquid solution or suspension formulation, for example employing a device such as a nebulizer, for example, a nebulizer connected to a compressor (e.g., the Pari LC-Jet Plus? nebulizer connected to a Pari Master? compressor manufactured by Pari Respiratory Equipment, Inc., Richmond, Va.).

    [0608] The virus of the invention can be delivered dispersed in a solvent, e.g. in the form of a solution or a suspension, for example as already described above for parenteral formulations. It can be suspended in an appropriate physiological solution, e.g., saline or other pharmacologically acceptable solvent or a buffered solution. Buffered solutions known in the art may contain 0.05 mg to 0.15 mg disodium edetate, 8.0 mg to 9.0 mg NaCl, 0.15 mg to 0.25 mg polysorbate, 0.25 mg to 0.30 mg anhydrous citric acid, and 0.45 mg to 0.55 mg sodium citrate per 1 ml of water so as to achieve a pH of about 4.0 to 5.0.

    [0609] The therapeutic suspensions or solution formulations can also contain one or more excipients. Excipients are well known in the art and include buffers (e.g., citrate buffer, phosphate buffer, acetate buffer and bicarbonate buffer), amino acids, urea, alcohols, ascorbic acid, phospholipids, proteins (e.g., serum albumin), EDTA, sodium chloride, liposomes, mannitol, sorbitol, and glycerol. Solutions or suspensions can be encapsulated in liposomes or biodegradable microspheres. The formulation will generally be provided in a substantially sterile form employing sterile manufacture processes.

    [0610] This may include production and sterilization by filtration of the buffered solvent/solution used for the formulation, aseptic suspension of the antibody in the sterile buffered solvent solution and dispensing of the formulation into sterile receptacles by methods familiar to those of ordinary skill in the art.

    [0611] Nebulisable formulation according to the present disclosure may be provided, for example, as single dose units (e.g., sealed plastic containers or vials) packed in foil envelopes. Each vial contains a unit dose in a volume, e.g., 2 mL, of solvent/solution buffer.

    Treatment

    [0612] In a further aspect the present disclosure extends to a virus or viral vector or a formulation thereof as described herein for use in treatment, in particular for the treatment of cancer.

    [0613] In one embodiment the method of treatment is for use in the treatment of a tumour.

    [0614] Tumour as employed herein is intended to refer to an abnormal mass of tissue that results from excessive cell division that is uncontrolled and progressive, also called a neoplasm. Tumours may be either benign (not cancerous) or malignant. Tumour encompasses all forms of cancer and metastases.

    [0615] In one embodiment the tumour is a solid tumour. The solid tumour may be localised or metastasised.

    [0616] In one embodiment the tumour is of epithelial origin.

    [0617] In one embodiment the tumour is a malignancy, such as colorectal cancer, hepatoma, prostate cancer, pancreatic cancer, breast cancer, ovarian cancer, thyroid cancer, renal cancer, bladder cancer, head and neck cancer or lung cancer.

    [0618] In one embodiment the tumour is a colorectal malignancy.

    [0619] Malignancy as employed herein means cancerous cells.

    [0620] In one embodiment the oncolytic virus or viral vector is employed in the treatment or prevention of metastasis.

    [0621] In one embodiment the method or formulation herein is employed in the treatment of drug resistant cancers.

    [0622] In one embodiment the virus or viral vector is administered in combination with the administration of a further cancer treatment or therapy.

    [0623] In one embodiment there is provided a virus, viral vector or formulation according to the present disclosure for use in the manufacture of a medicament for the treatment of cancer, for example a cancer described above.

    [0624] In a further aspect there is provide a method of treating cancer comprising administering a therapeutically effective amount of a virus or formulation according to the present disclosure to a patient in need thereof, for example a human patient.

    [0625] In one embodiment the oncolytic virus or formulation herein is administered in combination with another therapy.

    [0626] In combination as employed herein is intended to encompass where the oncolytic virus or viral vector is administered before, concurrently and/or post cancer treatment or therapy.

    [0627] Cancer therapy includes surgery, radiation therapy, targeted therapy and/or chemotherapy.

    [0628] Cancer treatment as employed herein refers to treatment with a therapeutic compound or biological agent, for example an antibody intended to treat the cancer and/or maintenance therapy thereof.

    [0629] In one embodiment the cancer treatment is selected from any other anti-cancer therapy including a chemotherapeutic agent, a targeted anticancer agent, radiotherapy, radio-isotope therapy or any combination thereof.

    [0630] In one embodiment the virus or viral vector of the present disclosure ay be used as a pre-treatment to the therapy, such as a surgery (neoadjuvant therapy), to shrink the tumour, to treat metastasis and/or prevent metastasis or further metastasis. The oncolytic virus or viral vector may be used after the therapy, such as a surgery (adjuvant therapy), to treat metastasis and/or prevent metastasis or further metastasis.

    [0631] Concurrently as employed herein is the administration of the additional cancer treatment at the same time or approximately the same time as the oncolytic virus or viral vector formulation. The treatment may be contained within the same formulation or administered as a separate formulation.

    [0632] In one embodiment the virus or viral vector is administered in combination with the administration of a chemotherapeutic agent.

    [0633] Chemotherapeutic agent as employed herein is intended to refer to specific antineoplastic chemical agents or drugs that are selectively destructive to malignant cells and tissues. For example, alkylating agents, antimetabolites, anthracyclines, plant alkaloids, topoisomerase inhibitors, and other antitumour agents. Other examples of chemotherapy include doxorubicin, 5-fluorouracil (5-FU), paclitaxel, capecitabine, irinotecan, and platins such as cisplatin and oxaliplatin. The preferred dose may be chosen by the practitioner based on the nature of the cancer being treated.

    [0634] In one embodiment the therapeutic agent is ganciclovir, which may assist in controlling immune responses and/or tumour vascularisation.

    [0635] In one embodiment the therapeutic agent is a check-point inhibitor, such as PD-1 inhibitor, a PD-L1 inhibitor, in particular wherein the inhibitor is a monoclonal antibody or antibody fragment.

    [0636] In one embodiment one or more therapies employed in the method herein are metronomic, that is a continuous or frequent treatment with low doses of anticancer drugs, often given concomitant with other methods of therapy.

    [0637] Subgroup B oncolytic adenoviruses, in particular Ad11 and those derived therefrom such as EnAd may be particularly synergistic with chemotherapeutics because they seem to have a mechanism of action that is largely independent of apoptosis, killing cancer cells by a predominantly necrolytic mechanism. Moreover, the immunosuppression that occurs during chemotherapy may allow the oncolytic virus to function with greater efficiency.

    [0638] Therapeutic dose as employed herein refers to the amount of virus or viral vector that is suitable for achieving the intended therapeutic effect when employed in a suitable treatment regimen, for example ameliorates symptoms or conditions of a disease. A dose may be considered a therapeutic dose in the treatment of cancer or metastases when the number of viral particles may be sufficient to result in the following: tumour or metastatic growth is slowed or stopped, or the tumour or metastasis is found to shrink in size, and/or the life span of the patient is extended. Suitable therapeutic doses are generally a balance between therapeutic effect and tolerable toxicity, for example where the side-effect and toxicity are tolerable given the benefit achieved by the therapy.

    [0639] In one embodiment there is provided systemically administering multiple doses of a parenteral formulation of an oncolytic adenovirus according to the present disclosure in a single treatment cycle, for example wherein the total dose given in each administration is in the range of 1?10.sup.10 to 1?10.sup.14 viral particles per dose.

    [0640] In one embodiment one or more doses (for example each dose) of virus or viral vector is administered such that the rate of viral particle delivery is in the range of 2?10.sup.10 particles per minute to 2?10.sup.12 particles per minute.

    [0641] In one embodiment a virus or therapeutic construct according to the present disclosure (including a formulation comprising same) is administered weekly, for example one week 1 the dose is administered on day 1, 3, 5, followed by one dose each subsequent week.

    In one embodiment a virus or therapeutic construct according to the present disclosure (including a formulation comprising same) is administered bi-weekly or tri-weekly, for example is administered in week 1 one on days 1, 3 and 5, and on week 2 or 3 is also administered on days 1, 3 and 5 thereof. This dosing regimen may be repeated as many times as appropriate.

    [0642] In one embodiment a virus or therapeutic construct according to the present disclosure (including a formulation comprising same) is administered monthly.

    [0643] In one embodiment the viruses, viral vectors and constructs of the present disclosure are prepared by recombinant techniques. The skilled person will appreciate that the armed virus or viral vector genome can be manufactured by other technical means, including entirely synthesising the genome or a plasmid comprising part of all of the genome. The skilled person will appreciate that in the event of synthesising the genome the region of insertion may not comprise the restriction site nucleotides as the latter are artefacts following insertion of genes using cloning methods.

    [0644] In one embodiment the armed virus or viral vector genome is entirely synthetically manufactured,

    [0645] The disclosure herein further extends to a virus of formula (I) or a subformula thereof, obtained or obtainable from inserting a transgene or transgene cassette.

    [0646] Is as employed herein means comprising.

    [0647] In the context of this specification comprising is to be interpreted as including.

    [0648] Embodiments of the invention comprising certain features/elements are also intended to extend to alternative embodiments consisting or consisting essentially of the relevant elements/features.

    [0649] Where technically appropriate, embodiments of the invention may be combined. Technical references such as patents and applications are incorporated herein by reference.

    [0650] Any embodiments specifically and explicitly recited herein may form the basis of a disclaimer either alone or in combination with one or more further embodiments.

    [0651] The present invention is further described by way of illustration only in the following examples.

    EXAMPLES

    Example 1: Production of EnAd Viruses Expressing the T Cell Activating Antigen CD80 and a Membrane-Anchored Single Chain Fv Fragment Antibody to the ? Chain of the Human CD3 Complex (CD3?)

    [0652] The plasmid pEnAd2.4 was used to generate the plasmids pNG-348 by direct insertion of a cassette encoding the human T cell activating antigen CD80 (SEQ ID NO 98) and a membrane-anchored chimeric form of the single chain Fv anti-human CD3e (SEQ ID NO 4). The pNG-348 cassette contains; a 5 short splice acceptor sequence (CAGG); membrane-anchored anti-human CD3e ScFv cDNA; a high efficiency self-cleavable P2A peptide sequence (SEQ ID NO. 94); human CD80 cDNA sequence and a 3 polyadenylation sequence (SEQ ID NO. 99. A Schematic of the inserted transgene cassette is shown in FIG. 2C. Construction of the plasmid is confirmed by DNA sequencing.

    Virus Production and Characterisation

    [0653] The plasmid pNG-348 is linearised by restriction digest with the enzyme AscI to produce the virus genome NG-348 (SEQ ID NO: 100). The virus NG-348 is amplified and purified according to methods given below.

    [0654] Digested DNA was purified by phenol/chloroform extraction and precipitated for 16 hrs, ?20? C. in 300 ?l>95% molecular biology grade ethanol and 10 ?l 3M Sodium Acetate. The precipitated DNA was pelleted by centrifuging at 14000 rpm, 5 mins and was washed in 500 ?l 70% ethanol, before centrifuging again, 14000 rpm, 5 mins. The clean DNA pellet was air dried, resuspended in 500 ?l OptiMEM containing 15 ?l lipofectamine transfection reagent and incubated for 30 mins, RT. The transfection mixture was then added drop wise to a T-25 flask containing 293 cells grown to 70% confluency. After incubation of the cells with the transfection mix for 2 hrs at 37? C., 5% CO.sub.2 4 mls of cell media (DMEM high glucose with glutamine supplemented with 2% FBS) was added to the cells and the flasks was incubated 37? C., 5% CO.sub.2.

    [0655] The transfected 293 cells were monitored every 24 hrs and were supplemented with additional media every 48-72 hrs. The production of virus was monitored by observation of a significant cytopathic effect (CPE) in the cell monolayer. Once extensive CPE was observed the virus was harvested from 293 cells by three freeze-thaw cycles. The harvested viruses were used to re-infect 293 cells in order to amplify the virus stocks. Viable virus production during amplification was confirmed by observation of significant CPE in the cell monolayer. Once CPE was observed the virus was harvested from 293 cells by three freeze-thaw cycles. The amplified stock was used for further amplification before the virus was purified by double caesium chloride banding to produce a NG-330 virus stock.

    Example 2: Production of EnAd Viruses Expressing the T Cell Activating Antigen CD80 and a Membrane-Anchored Single Chain Fv Fragment Antibody to the ? Chain of the Human CD3 Complex (CD3?)

    [0656] The plasmid pEnAd2.4 was used to generate the plasmids pNG-348A by direct insertion of a cassette encoding the human T cell activating antigen CD80 (SEQ ID NO 98) and a membrane-anchored chimeric form of the single chain Fv anti-human CD3e with a C-terminal V5 tag (SEQ ID NO: 5). The pNG-348 cassette contains; a 5 short splice acceptor sequence (CAGG); membrane-anchored anti-human CD3e ScFv cDNA; a C-terminal V5 tag (SEQ ID NO: 101); a high efficiency self-cleavable P2A peptide sequence (SEQ ID NO: 94); human CD80 cDNA sequence and a 3 polyadenylation sequence (SEQ ID NO: 99). A Schematic of the NG-348A transgene cassettes is shown in FIG. 26A. Construction of the plasmid is confirmed by DNA sequencing.

    Virus Production and Characterisation

    [0657] The plasmid pNG-348A is linearised by restriction digest with the enzyme AscI to produce the virus genome NG-348A (SEQ ID NO: 102). The virus NG-348A is amplified and purified according to methods detailed in Example 1.

    Example 3: Production of EnAd Viruses Expressing a Membrane-Anchored Single Chain Fv Fragment Antibody to the ? Chain of the Human CD3 Complex (CD3?)

    [0658] The plasmid pEnAd2.4 was used to generate the plasmids pNG-420 and pNG-420A by direct insertion of a cassettes encoding a membrane-anchored chimeric form of the single chain Fv anti-human CD3e with a C-terminal V5 tag (SEQ ID NO: 5) or without a V5 tag (SEQ ID NO: 4). The pNG-420 cassette contains; a 5 short splice acceptor sequence (CAGG); membrane-anchored anti-human CD3e ScFv cDNA and a 3 polyadenylation sequence (SEQ ID NO: 99). The pNG-420A cassette contains; a 5 short splice acceptor sequence (CAGG); membrane-anchored anti-human CD3e scFv cDNA; a C-terminal V5 tag (SEQ ID NO: 101) and a 3 polyadenylation sequence (SEQ ID NO: 99). Schematics of the NG-420 and NG-420A transgene cassettes are shown in FIGS. 3B and 3C. Construction of each plasmid is confirmed by DNA sequencing.

    Virus Production and Characterisation

    [0659] The plasmids pNG-420 and pNG-420A are linearised by restriction digest with the enzyme AscI to produce the virus genomes NG-420 (SEQ ID NO: 103) and NG-420A (SEQ ID NO: 104). The viruses NG-420 and NG-420A are amplified and purified according to methods detailed in Example 1.

    Example 4: Oncolytic Activity and Infectivity of NG-347 and NG-348 Viruses in Colon Carcinoma Cells

    Virus Oncolytic Potency

    [0660] HT-29 colon carcinoma cells were seeded in 96 well plates at a cell density of 2.5e4 cells/well. Plates were incubated for 4 hrs, 37? C., 5% CO.sub.2, before cells were either infected with EnAd, NG-347 or NG-348 virus particles at an infection density range of 100-0.39 particles per cell (ppc). HT-29 cell viability was assessed using Cell Titre 96 MTS Reagent (Promega: G3581) 72 hrs post infection. Quantification of the % cell survival at each infection density demonstrated that NG-348 oncolytic potency was comparable to EnAd (FIG. 43).

    Viral Particle Infectivity

    [0661] HT-29 colon carcinoma cells were seeded in 12 well plates at a cell density of 4e5 cells/well. Plates were incubated for 24 hrs, 37? C., 5% CO.sub.2, before cells were either infected with EnAd, NG-347 or NG-348 virus particles at an infection density range of 1.6e7-2e6 vp/mL. Infection of HT-29 cells was detected by antibody staining of the virus protein hexon. Stained cells were quantified by manual counting of 6 fields of view per well, across 6 replicate wells for each dilution tested. The particle to infectivity ratio (P:I) was calculated for each virus from the viral titre and demonstrated NG-348 has similar infectivity ratios to EnAd reference controls (FIG. 43 Table).

    Example 5: Cell Surface Expression of the T Cell Activating Antigen, CD80, in NG-347 and NG-348 Infected Carcinoma Cell Lines

    [0662] CD80 transgene expression (assessed by flow cytometry) was compared in NG-348 and EnAd treated colon carcinoma cell line, DLD-1 or lung carcinoma cell line, A549. A549 or DLD-1 carcinoma cell lines were seeded in 12 well plates at cell densities of 7.5e5 cells/well. Plates were incubated for 18 hrs, 37? C., 5% CO.sub.2, before cells were either infected with, 10 EnAd, NG-348 virus particles per cell (ppc) or were left uninfected. CD80 protein expression was compared on the surface of A549 or DLD-1 cells at 24, 48, 72 or 96 hrs post-infection. At each time point cells were harvested and stained according to methods detailed below.

    [0663] For CD80 cell surface expression, cells were then either incubated at 5? C. for 1 hr with buffer, mouse isotype control antibody conjugated to Cy5 or anti-human CD80 antibody conjugated to Cy5 (clone 2D10). All samples were also co-stained with Zombie Aqua live/dead to differentiate viable cells. Samples were washed 3 times with 1% BSA/PBS before analysis by flow cytometry (FACS, Attune) for cell viability and CD80 protein expression on the cell surface. In keeping with the IFN? expression data, CD80 expression could only be detected on HT-29 cells, with no detectable expression on either the fibroblast or bronchial epithelial cell lines.

    [0664] Cells were analysed for cell viability and CD80 protein expression at the cell surface by flow cytometry. Analysis of CD80 expression at 72 hrs post infection in A549 cells showed CD80 could be detected on the surface of >95% of NG-348 treated cells (FIGS. 4A and 4B). At 96 hrs post infection the virus treatments had lysed the majority of A549 cells therefore FACs analysis was not carried out. For DLD-1 cells expression could be detected on >50% of cells by 96 hrs post-treatment with NG-348 (FIGS. 5A and 5B). Staining was not detected on EnAd or untreated controls.

    Example 6: T Cell Activation and Degranulation Mediated by NG-348 Infected Carcinoma Cell Lines

    [0665] A549 lung carcinoma cells, either infected with NG-348 or EnAd virus particles or left uninfected, were co-cultured with T cells isolated from human PBMC donors. The selectivity of expression of NG-348 virus encoded CD80 was assessed on the surface of both A549 and T cells by flow cytometry. T cell activation was assessed by analysing cell surface activation markers (by Flow cytometry), CD107a cell surface expression as a marker for degranulation (by Flow cytometry) and secretion of stimulatory cytokines, IL-2 and IFN? (by ELISA).

    [0666] A549 cells were seeded into 12 well plates at a density of 5e5 cells/well. Plates were incubated for 18 hrs, 37? C., 5% CO.sub.2, before cells were either infected with 10 EnAd or NG-348 virus particles per cell (ppc) or were left uninfected. At 48 hrs post-infection CD3.sup.+ T cells, isolated by negative selection from PBMCs (MACs) were added to the A549 cell monolayers at a ratio of 8 T cells:1 tumour cell. The co-culture was carried out for 16 hrs, after which point cellular supernatants were collected for ELISA analysis and tumour cells and T cells harvested for Flow cytometry analysis. Culture media containing non-adherent cells was removed from co-culture wells and centrifuged (300?g). The supernatant was carefully removed, diluted 1 in 2 with PBS 5% BSA and stored for ELISA analysis. The adherent cell monolayers were washed once with PBS and then detached using trypsin. The trypsin was inactivated using complete media and the cells were added to the cell pellets that had been collected from the culture supernatants. The cells were centrifuged (300?g), the supernatant discarded and the cell pellet washed in 200 ?L of PBS. The cells were centrifuged again then resuspended in 50 ?L of FACs buffer (5% BSA PBS) containing Live/Dead Aqua (Life tech) for 15 minutes at RT. The cells were washed once in FACs buffer before staining with panels of directly conjugated antibodies: anti-CD3 conjugated to BV605; anti-CD25 conjugated to BV421; anti-CD107a conjugated to FITC; anti-EpCam conjugated to PE or anti-CD4 conjugated to PE; and either anti-CD80 conjugated to PE/Cy5 or anti-HLA-DR conjugated to PE/Cy5. A sample of cells from each co-culture condition was also stained with relevant isotype control antibodies. All staining was carried out in FACs buffer in a total volume of 504/well for 15 minutes, 4? C. Cells were then washed with FACs buffer (2004) before resuspension in 2004 of FACs buffer and analysis by Flow cytometry (Attune).

    Selective Expression of CD80

    [0667] Similar to results shown in example 14, CD80 expression was detectable at the surface of >80% of NG-348 infected EpCam.sup.+ A549 cells but not EnAd infected or uninfected control cells (FIG. 6). In contrast CD3.sup.+ T cells showed no detectable expression of CD80 at the cell surface indicating, at least under these experimental conditions, transgene expression is selective for tumour cells in the co-culture.

    Upregulation of T Cell Activation Markers

    [0668] Flow cytometry analysis of T cell activation was assessed by expression of the T cell activation markers CD25 and HLA-DR on live, CD3+, single cells. These data showed that both the number of T cells expressing CD25 (FIGS. 7A and 7B) and the average level of CD25 expression on the T cell surface (FIG. 7C) were significantly higher for T cells cultured with NG-348 infected A549 cells than EnAd or uninfected controls. Specifically, there was no difference in T cell activation status when comparing untreated controls to EnAd (26.9%?3.4% and 25.3?3.5% of T cells expressing CD25, respectively) whereas CD25 was upregulated on the majority of cells co-cultured with NG-348 (83.2?1.5%). CD25 expression was also analysed on CD4 and CD8 T cell subsets by gating the CD3.sup.+ T cells based on their expression of CD4. These analyses showed that CD25 expression is significantly upregulated on both CD4+ and CD4? T cell subsets in NG-348 treated co-cultures compared to EnAd and uninfected controls (FIG. 8).

    [0669] In contrast to CD25 the number of cells expressing HLA-DR was low, <5%, for all conditions tested (FIG. 9A). This is likely due to the early time point after co-culture at which flow cytometry analysis was carried out. However, there was a slight but significant increase in the mean fluorescence intensity of HLA-DR staining CD3.sup.+HLA-DR.sup.+ cells from NG-348 treated co-cultures compared to controls (FIG. 9B).

    Stimulation of T Cell Degranulation

    [0670] Analysis of CD107a expression on the surface of live, CD3.sup.+ T cells showed a significant increase in the number of T cells which had degranulated and were therefore stained with CD107a, when A549 cells were infected with NG-348 (8.3%?1.7% of cells) compared to either EnAd (0.6%?0.2% of cells) or untreated controls (0.1%?0.02% of cells) (FIG. 10). Similar to CD25 upregulation, both CD4.sup.+ and CD4? T cell subsets showed significantly increased CD107a expression compared to EnAd or A549 controls (FIG. 11).

    Secretion of the Stimulatory Cytokines IL-2 and IFN?

    [0671] For detection of IL-2 or IFN? expression, co-culture supernatants were diluted into 5% BSA/PBS assay buffer (in a range of 1:100 to 1:1000) and ELISA was carried out using the Human IL-2 Ready Set go Kit (Affymetrix) or Human IFN gamma Ready set go kit (Affymetrix) according to the manufacturer's protocol.

    [0672] The concentrations of secreted IL-2 or IFN? were determined by interpolating from the standard curves. Expression of IL-2 could only be detected in the supernatants of co-cultures using NG-348 infected A549 cells and was not detectable in either the EnAd, or untreated controls (FIG. 12A). Expression of IFN? could also be detected, at very high levels (>300 ng/mL) in supernatants of co-cultures from NG-348 infected A549 cells, which was significantly higher that either EnAd or untreated controls (FIG. 12B).

    Example 7: T Cell Activation of CD4 and CD8 T Cells can be Independently Mediated by NG-348 Infected Carcinoma Cell Lines

    [0673] A549 lung carcinoma cells infected with NG-348 or EnAd virus particles or left uninfected, were co-cultured with either CD4.sup.+ T cells or CD8.sup.+ T cells isolated from human PBMC donors. T cell activation was assessed by the secretion of the stimulatory IFN? into culture supernatants.

    A549 cells were seeded and infected with NG-348 or EnAd virus particles or left uninfected according to the methods detailed in Example 14. 48 hrs post infection CD4.sup.+ T cells or CD8.sup.+ T cells isolated by negative selection from a PBMC donor were added to the A549 cell monolayer at a ratio of 8 T cells to 1 tumour cells. After 16 hrs of co-culture supernatants were harvested and assessed for IFN? according to the methods detailed.

    Analysis of IFN? Expression by ELISA

    [0674] Supernatants of HT-29 or A549 cell lines infected for 24, 48 or 72 hrs with 10 ppc of EnAd or NG-343 or left uninfected were analysed for expression of secreted IFN? by ELISA.

    [0675] Culture supernatants were removed from each well and centrifuged for 5 mins, 1200 rpm to remove cell debris. Supernatants were diluted into 5% BSA/PBS assay buffer (1:2 or 1:50 or 1:100) and ELISA was carried out using the Verikine Human IFN alpha Kit (Pbl assay science) according to the manufacturer's protocol.

    [0676] The concentrations of secreted IFN? were determined by interpolating from the standard curves. IFN? expression which increased in the cellular supernatants over the course of infection was detected in both HT-29 and A549 cells lines

    [0677] For CD4.sup.+ T cells Expression of IFN? was only detected in supernatants of co-cultures from NG-348 infected A549 cells and was not detectable in either the EnAd or untreated controls (FIG. 13A). For CD8.sup.+ T cells expression of IFN? was detected at significantly higher levels for NG-348 infected A549 cells than for EnAd or untreated controls (FIG. 13B), demonstrating that both CD8 and CD4 cells can be activated to secret IFN? by NG-348 virus activity in tumour cell lines.

    Example 8

    [0678] A549 human lung carcinoma cells and MRC5 human fibroblast cells were cultured with EnAd, NG-347 or NG-348 viruses (at 10 ppc) to compare virus genome replication, virus hexon and transgene expression by these cell types. After 72 hours culture, cells were either stained for FACS analyses of surface markers or supernatants and cell lysates prepared for virus genome replication (qPCR) or mRNA (RT-qPCR) analyses of hexon or transgene expression.

    [0679] Virus genome replication and hexon mRNA expression for the two transgene bearing viruses, NG-347 and NG-348 were equivalent to those for the parental virus, EnAd (FIG. 14). For NG-348 (FIG. 15), CD80 and anti-human CD3-ScFv transgene mRNA expression levels were high with A549 tumour cells, with only a low level signal for the non-tumour MRC5 cells. CD80 protein expression on the surface of cells assessed by FACS was detected on the majority of NG-348 treated A549 cells but was not detectable on MRC5 cells, with no CD80 detected on either cell type left untreated or treated with EnAd. Similarly, CD80 transgene mRNA and protein expression following NG-347 treatment was selectively detected in A549 tumour cells not MRC5 cells (FIG. 16). For EnAd and NG-347 treated cell cultures, levels of MIP1? and IFN? mRNA in cell lysates and secreted proteins in supernatants were measured by RT-qPCR and specific ELISAs, respectively. Data (FIG. 17) show selective expression of both transgenes by A549 tumour cells, with no detectable MIP1? chemokine or IFN? cytokine in MRC5 supernatants.

    Example 9

    [0680] The selectivity/activity of EnAd, NG-347 and NG-348 viruses with human T-cells was evaluated by culturing isolated CD3.sup.+ T cells for 3 days with either 500 ppc or 5000 ppc of each virus. Selectivity/activity was assessed by a) flow cytometry analysis of T cells stained with antibodies targeting CD69, CD4, CD80, CD25 and CD3, b) ELISA analysis of human MIP1?, IFN? and IFN? protein secretion, c) qPCR analysis of virus replication and d) RT-qPCR analysis of gene expression As shown in FIG. 18, T-cells were not supportive of virus genome replication for any of the viruses tested with only background signals in the virus hexon RT-qPCR assay. A549 tumour cells supported high levels of hexon mRNA expression. RT-qPCR analyses for transgene mRNA expression by T-cells showed only background signals (<1 copy/cell) for CD80 by both NG-347 and NG-348, and a similar lack of significant expression of anti-CD3-ScFv mRNA by NG-348, despite the high virus exposure (5000 ppc). High levels of expression of both transgenes were detected with treated (10 ppc) A549 tumour cells (FIGS. 19 & 20). Expression of IFN? and MIP1? transgene mRNA was also selectively detected by NG-347 (not EnAd) treated A549 tumour cells (at 10 ppc) and not by T-cells treated with 5000 ppc (FIG. 21). In addition, CD80 cell surface protein expression was only detectable with A549 cells not T-cells for both NG-347 and NG-348 (FIGS. 19 & 20). EnAd treatment did not lead to CD80 expression by either cell type, and A549 cell death (as assessed by dye uptake) was similarly high for all three viruses; a low level of non-specific T-cell death was induced by all viruses due to the very high levels of virus particles used in the experiment (FIGS. 19 & 20). Similar transgene mRNA and protein expression data were obtained when viruses were used at 500 ppc (data not shown).

    [0681] In the absence of tumour cells, purified human T-cells were not activated to upregulate activation markers CD25 or CD69 when cultured with any of the viruses.

    Lack of Expression of Activation Markers CD25 and CD69 by Purified Human CD3.sup.+ T-Cells Treated with 5000 ppc of Different Viruses

    TABLE-US-00006 Untreated EnAd NG-347 NG-348 CD25.sup.+ CD4 T-cells 30.7 24.6 23.4 23.3 CD69.sup.+ CD4 T-cells 0.1 0.4 0.3 0.7 CD25.sup.+ CD8 T-cells 5.9 4.7 4.1 4.1 CD69.sup.+ CD8 T-cells 0.5 1.0 0.9 1.3

    Example 10

    [0682] A similar virus selectivity experiment to that described in Example 9 was carried out using unseparated human PBMCs rather than purified T-cells, including making the same activity assessments. As with human T-cells in example 9, the data from this study collectively demonstrate lack of virus replication and transgene expression by human PBMCs. FIGS. 12-14 show data using 5000 ppc of EnAd, NG-347 or NG-348, but similar data was generated using 500 ppc (not shown). FIG. 12 shows virus genome replication and hexon mRNA expression and FIGS. 13 & 14 show transgene mRNA expression. Assay backgrounds were set according to signals generated in the assay with the respective virus spiked into culture media and then processed in the same way as for the cell lysate samples. There was no detectable expression of CD80 transgene on CD3.sup.+ T-cells or CD40+ cells (primarily B-cells) in these PBMC cultures with any of the viruses (not shown).

    [0683] NG-347 and NG-348 virus particle-mediated activation of innate immune cells (monocytes, DCs) in the PBMC cultures were similar to those of EnAd, as shown in FIGS. 15 and 16 for downregulation of CD14 expression and upregulation of HLA-DR and endogenous cell surface CD80, as well as secretion of MIP1? and IFN? (note that despite NG-347 encoding both of these molecules in its genome there was no increase in production levels over those for EnAd and NG-348 which do not encode the transgenes).

    Example 11

    [0684] This example is similar in design to experiments in examples 9 and 22 10 in these studies, the human PBMCs or purified T-cells were co-cultured with virus pre-treated (48 hours) A549 tumour cells or MRC5 fibroblasts. A549 or MRC5 cells were treated with 10 ppc of EnAd, NG-347, NG-348 or left untreated (UTC) and cultured for 48 hours to allow sufficient time for virus replication and any transgene expression. PBMCs or T-cells were then added to the cultures and left for 24 or 48 hours to evaluate the ability of virus treated cells to activate T-cells.

    [0685] FIG. 17 shows virus genome replication data showing comparable replication of the three viruses in PBMC or T-cell co-cultures with both cell types, replication levels being high with A549 tumour cells and low with MRC5 fibroblasts.

    [0686] T-cell activation as measured by upregulation of CD25 surface expression and CD8 effector T-cell degranulation, as measured by upregulation of CD107a on the cell surface, and IFN? production measured by intracellular cytokine staining were all selectively stimulated by NG-348 treated A549 cells compared to EnAd, with no stimulation mediated with MRC co-cultures.

    Flow Cytometry Analyses of Activation of Human CD3.sup.+ T-Cells in T-Cell and PBMC Co-Cultures with Viruses

    TABLE-US-00007 Cells Treatment % CD25.sup.+ % CD8.sup.+CD107a.sup.+ % IFN custom-character A549 + T-cells Untreated 37.5 0.1 0.1 A549 + T-cells EnAd 38.4 0.1 0.2 A549 + T-cells NG-348 88.2 17.9 12.0 MRC5 + T-cells Untreated 38.8 0.3 0.4 MRC5 + T-cells EnAd 38.9 0.2 0.4 MRC5 + T-cells NG-348 39.1 0.3 0.3 A549 + PBMCs Untreated 28.3 ND ND A549 + PBMCs EnAd 29.4 ND ND A549 + PBMCs NG-348 73.7 ND ND MRC5 + PBMCs Untreated 23.0 ND ND MRC5 + PBMCs EnAd 23.3 ND ND MRC5 + PBMCs NG-348 21.7 ND ND ND = Not determined

    [0687] IFN? secretion into co-culture supernatants was also quantified by ELISA. The data (FIG. 28) similarly demonstrate selective activation of T-cells co-cultured with NG-348 treated A549 tumour cells not MRC5 fibroblasts, with either purified T-cells or PBMCs used in the assays.

    [0688] Ability of NG-347 to activate T-cells was also assessed by measuring CD69 levels on T-cells from co-cultures of either purified T-cells or PBMCs with A549 tumour cells or MRC5 fibroblasts. As shown in Table 8, a small enhancement in CD69 positive T-cells was seen with NG-347 treatment of A549 tumour cells compared to EnAd, which itself leads to upregulation of this early activation marker. These effects were not seen in MRC5 co-cultures. No CD80 expression was detected on the T-cells (not shown).

    CD69 Expression on T-Cells from NG-347 or EnAd Treated Cocultures

    [0689]

    TABLE-US-00008 Cells Treatment % CD69+ A549 + T-cells Untreated 2.1 A549 + T-cells EnAd 18.7 A549 + T-cells NG-348 35.0 MRC5 + T-cells Untreated 3.8 MRC5 + T-cells EnAd 3.6 MRC5 + T-cells NG-348 4.4 A549 + PBMCs Untreated 1.2 A549 + PBMCs EnAd 19.1 A549 + PBMCs NG-348 28.7 MRC5 + PBMCs Untreated 2.6 MRC5 + PBMCs EnAd 2.7 MRC5 + PBMCs NG-348 3.9

    [0690] In a separate experiment, A549 cells treated with NG-347 and co-cultured with human CD3+ T-cells led to upregulation of CD69 activation marker on the T-cells and secretion of IFN? (see FIGS. 41 & 42).

    Example 12

    [0691] CD14+ monocytic cells were isolated from PBMCs by antibody coated magnetic bead separation and cultured with human IL-4 and GM-CSF to differentiate them into dendritic cells. After 3 days of culture, the cells were treated with EnAd, NG-347 or NG-348 at 5000 ppc or left untreated. As a positive activation control, some cells were stimulated with LPS. Two days later supernatants were taken for cytokine ELISAs and cells were stained for surface activation marker expression and analysed by flow cytometry. As shown in table 9, all viruses induced upregulation of the costimulatory molecules CD80 and CD86, indicating that this previously identified particle-mediated innate immune cell activation effect was not altered by the transgene incorporation into the genomes of NG-347 and NG-348. All viruses also stimulated secretion of similar levels of MIP1? and IFN? (FIG. 29).

    Particle-Mediated Activation of Human Dendritic Cells by EnAd, NG-347 and NG-348

    [0692]

    TABLE-US-00009 DC treatment % CD80.sup.+ % CD86.sup.+ Untreated 3.0 10.4 EnAd 81.6 99.3 NG-347 82.1 99.4 NG-348 62.5 99.5 LPS positive control 97.5 98.5

    Example 13

    [0693] In a set of experiments, JurkatDual cells were used in co-cultures with tumour cells as a T-cell activation reporter assay for assessing functionality of transgene expression by NG-347, NG-348 and NG-420 viruses, with EnAd serving as a negative control. JurkatDual cells stably express two different reporter genes: an NF?B reporter gene producing a secreted form of luciferase which is responsive to signalling via the T-cell receptor complex and an IFN?-responsive secreted alkaline phosphatase (SEAP) reporter gene. A549 cells were pre-cultured with viruses at '10 ppc for two days, and then JurkatDual cells were added for overnight co-culture (18-24h) and then supernatants collected for assay of luciferase and SEAP activities. As shown in FIG. 43, NG-347 infected A549 cells selectively induced SEAP production, which aligns with their production of IFN? (see FIG. 7) but did not induce luciferase activity. In contrast, NG-348 which expresses the membrane anti-CD3-ScFv to activate the T-cell receptor complex induced luciferase but not SEAP. In another experiment A549 lung carcinoma cells and HCT-116, HT-29 & DLD colon carcinoma cells were pre-cultured for 48 hours with 10 ppc of EnAd, NG-347, NG-348 or NG-420 viruses before co-culturing with JurkatDual cells overnight, with supernatants tested for levels of luciferase to indicate level of activation induced. As shown in FIG. 31, all four tumour cell types cultured with NG-348 or NG-420 viruses, which encode cell surface anti-CD3-ScFv, activated the JurkatDual cells whereas EnAd and NG-347 did not, with levels of luciferase similar to that of uninfected tumour cell controls (UIC).

    [0694] In another experiment, A549 or HT-29 tumour cells were pre-cultured with different amounts of either NG-348 or NG-420 before adding the JurkatDual cells and measuring their luciferase secretion. The data in FIG. 32 show that activation of the NF?B activity in JurkatDual cells is dependent on the dose of virus used to treat the tumour cells with.

    Example 14

    [0695] The in vivo pharmacokinetic, biodistribution and particle-mediated systemic cytokine induction activities of EnAd and NG-348 following IV dosing in immunocompetent CD1 mice were compared, Mice were dosed intravenously with 5?10.sup.9 particles of either EnAd or NG-348 and bled 2, 10, 30, 60 and 120 minutes post dosing. Whole blood was DNA extracted and analysed by qPCR for levels of virus genome (FIG. 33). Clearance of both viruses from the blood followed similar kinetics. Similarly, the induction of MCP-1 cytokine response (a measure of particle-mediated activation of innate immune such as liver Kupffer cells) was also similar for both viruses, as were the tissue biodistribution patterns (FIG. 33).

    Example 15

    [0696] CB17 SCID mice were implanted subcutaneously with HCT116 cells and injected intratumourally (IT) or intravenously (IV) with EnAd, NG-347 or NG-348 viruses (5?10.sup.9 virus particles), or control, once tumours were greater than 70 mm.sup.3. For the IV dosed mice, blood samples were taken from three mice from each group 3, 15 and 30 minutes after IV dosing, DNA extracted and the level of virus genomes in the blood assessed by qPCR (pharmacokinetics [PK] analysis). Data (FIG. 34) show that NG-347 and NG-348 have similar PK to EnAd (and to each other). After 6 hours, tumours, livers, lungs and spleens were resected from 3 mice from each group. Homogenised tissues were DNA extracted and analysed for level of virus genomes by qPCR (biodistribution analysis). Data (FIG. 35A) show similar tissue biodistribution for the three viruses. After 7 days or 14-21 days, tumours were excised from three mice from each group and homogenized to produce a tumour lysate which was used to prepare both DNA and RNA. Level of virus genomes in the tumours at the two time points were measured by qPCR analyses of the extracted DNA. Data (FIG. 35B) show that tumours from both IV and IT dosed mice have levels of virus genomes higher than the amount of virus dosed, indicating virus replication in the tissue, with IT dosing giving higher genome levels than IV at day 7, but both being similarly high at the 14-21 day timeframe. All three viruses replicated to similar levels.

    [0697] Similarly, levels of virus hexon mRNA in tumour lysates detected by RT-qPCR were comparable between EnAd, NG-347 and NG-348 at both time points tested (FIGS. 36 and 37). Similar levels of anti-CD3-ScFv and CD80 mRNA were detected at both time points and both dosing routes for NG-348 treatment, with only assay background readings with EnAd dosing (FIGS. 37 & 38). MIP1? and IFN? mRNA levels were also selectively detected following NG-347 dosing, either IT or IV (FIG. 39).

    [0698] Levels of CD80 protein encoded by both NG-347 and NG-348, and MIP1? protein encoded by NG-347 were measured in tumour lysates using specific ELISAs. The data in FIG. 40 show that following the single IV virus dose, both proteins could also be detected selectively in tumour extracts. Neither protein was detected in blood samples from the same mice.

    Example 16

    [0699] To evaluate the activity and tumour cell dependency of NG-348 virus in vivo, different combination of human PBMCs (5?10.sup.7 cells), A549 human tumour cells (5?10.sup.6) and either EnAd or NG-348 (at 5?10.sup.9 ppc) were injected into the peritoneum of immunodeficient SCID-beige mice, with viruses or control (saline) being dosed within 15 minutes after injection of the cells. After 3 days, the peritoneal cavity was lavaged with 5 mL of saline and recovered cells were analysed by flow cytometric analyses with a panel of T-cell activation markers (CD25, CD69 and HLA-DR) to assess levels of T-cell activation, following gating on the CD3.sup.+ T-cell population. Data from two separate experiments demonstrate that NG-348 selectively leads to human T-cell activation in vivo in a tumour cell dependent manner.

    In Vivo Activation of Human T-Cells in A549 Tumour Bearing Mice by NG-348

    [0700]

    TABLE-US-00010 % CD25.sup.+, % CD25.sup.+, Group Virus Tumour N % CD25.sup.+ % CD69.sup.+ % DR.sup.+ CD69.sup.+ DR.sup.+ Experiment 1 1 EnAd Saline 2 1.9 1.6 7.7 0.2 0.3 2.3 3.0 9.1 0.5 0.6 2 EnAd 5 ? 10.sup.6 2 4.2 6.2 8.4 0.8 1.4 A549 cells 2.9 5.5 8.4 0.3 0.4 3 NG-348 Saline 1 3.4 2.6 9.2 0.5 0.8 4 NG-348 5 ? 10.sup.6 2 35.8, 50.4 26.3 22.4 16.4 A549 cells 36.6 42.2 19.2 18.0 12.2 Experiment 2 1 Saline Saline 1 25.6 37.3 14.8 14.1 7.08 2 EnAd Saline 2 6.5 17.8 5.50 3.58 1.01 7.3 18.2 6.1 3.46 1.49 3 NG-348 Saline 2 10.2 26.7, 7.7 6.73 2.16 6.5 18.3 6.0 3.61 1.44 4 Saline 5 ? 10.sup.6 2 28.4 54.4, 13.3 22.3 8.54 A549 cells 22.7 51.1 15.0 17.5 7.72 5 EnAd 5 ? 10.sup.6 1 13.2 29.4 5.1 7.84 1.62 A549 cells 6 NG-348 5 ? 10.sup.6 3 34.4 58.9, 12.5 27.2 9.07 A549 cells 29.6 59.2, 9.8 23.3 7.5 56.4 85.0 17.0 52.7 14.2