CNS Antigen-Specific B Cell and Antibody Assays in Multiple Sclerosis
20190072551 ยท 2019-03-07
Assignee
Inventors
Cpc classification
G01N33/564
PHYSICS
G01N2800/52
PHYSICS
International classification
Abstract
Embodiments of this invention include methods for detecting in vitro the presence in peripheral blood mononuclear cells (PBMCs), and in serum or plasma, of antibodies reactive to and of lymphocytes that are responsive to CNS antigens associated with Multiple Sclerosis (MS). These CNS antigens include, but are not limited to whole brain lysate and the myelin antigens myelin basic protein (MBP), myelin oligodendrocyte glycoprotein (MOG), MOG peptides (MOGps), proteolipid protein (PLP), and PLP peptides (PLPps). PBMCs obtained from patients with active MS produce antibodies specific for CNS antigen, and causes T-lymphocytes to produce T-lymphocyte-specific cytokines, including interferon gamma (IFN-), interleukin-2 (IL-2), or interleukin-17 (IL-17). In contrast, PBMCs from subjects without MS do not produce such responses. The magnitude of the CNS antigen-specific response in patients with definite MS or in patients with CIS or RIS can indicate the likelihood that a given patient will develop a relapse and can indicate the responsiveness to and the success of immune modulatory treatment.
Claims
1. A method for detecting a cell that produces an antibody against a CNS-specific antigen, comprising the steps: a) providing a cell culture well having a surface and a cell culture medium therein; b) attaching a CNS-specific antigen to said surface; c) introducing a sample of peripheral blood mononuclear cells (PBMCs), CNS cells, or cell liquor from a human being into said cell culture medium; d) permitting said PBMCs to produce an antibody against said CNS-specific antigen; and e) detecting the presence of said antibody using an anti-antibody specific reagent.
2. The method of claim 1, said step of detection being carried out using a method selected from the group consisting of enzyme linked immune spot assay (ELISPOT), enzyme-linked immunoassay (ELISA), bead array, or protein array.
3. The method of claim 1, said CNS-specific antigen selected from the group consisting of whole-brain lysate, human myelin antigens, human proteolipid protein (hPLP), human myelin basic protein (hMBP), myelin oligodendrocyte glycoprotein (hMOG), neuronal antigen, a peptide from hMOG (hMOGp) containing a sequence of hMOG, and a MOG/PLP fusion protein.
4. The method of claim 1, said method performed with PBMCs or cells isolated from the CNS.
5. The method of claim 1, where said CNS-specific hMOG antigen is SEQ ID NO.1.
6. The method of claim 1, where said CNS-specific MOGp antigen is human MOG 35-55 (SEQ ID NO.2).
7. The method of claim 1, where said CNS-specific antigen MBP is MBP isoform 3, 21.5 kDa (SEQ ID NO.3).
8. The method of claim 1, where said CNS-specific proteolipid protein antigen is PLP4 (SEQ ID NO.4).
9. The method of claim 1, where said CNS-specific MOG/PLP antigen is fusion protein MP4 (SEQ ID NO.6).
10. A method for treating a patient having multiple sclerosis (MS), comprising the steps: a) providing a cell culture well having a surface and a cell culture medium therein; b) attaching a CNS-specific antigen to said surface; c) introducing a sample of peripheral blood mononuclear cells (PBMCs), CNS cells, or cell liquor from a human being into said cell culture medium; d) permitting said PBMCs to produce an antibody against said CNS-specific antigen; e) detecting the presence of said antibody using an anti-antibody specific reagent; and f) if said antibody is detected in step e), administering to said patient an immune modulating agent.
11. The method of claim 10, wherein said immune modulating agent is a B-cell depleting agent.
12. The method of claim 11, wherein said B-cell depleting agent is an anti-CD20 antibody.
13. The method of claim 10, further comprising administering to said patient a therapeutic agent selected from the group consisting of glatiramer acetate, interferon beta-1a, interferon beta-1b, mitoxantrone, natalizumab, and FTY720 fingolimod.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0006] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0007] This invention is described with respect to specific embodiments thereof. Other features of this invention can be appreciated and understood with reference to the Figures, in which:
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019] The magnitudes of the PLPp-specific IFN- and IL-17 responses were assessed in each individual mouse (
[0020]
[0021]
[0022] The magnitudes of the MOGp-specific IFN- and IL-17 responses were assessed in each individual mouse (
[0023]
[0024] These results indicate that PLPp appears to produce larger IFN- and IL-17 responses than does MOGp.
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032] In contrast, no MP4 responses were observed in PBMCs from healthy controls (
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
DETAILED DESCRIPTION
Definitions
[0045] The following definitions are included for convenience. The meanings of the following terms are to be defined immediately below, unless such term(s) are defined specifically in the sections that follow.
[0046] AP means alkaline phosphatase.
[0047] APC or APCs means antigen presenting cells.
[0048] BBB means blood brain barrier.
[0049] B-cells means B-lymphocytes, including plasmablasts, plasma cells, effector B-cells and memory B-cells.
[0050] -mercaptoethanol, 2-mercaptoethanol, 2-ME and -ME means the chemical compound with the formula HOCH.sub.2CH.sub.2SH. It can be used for the polyclonal stimulation of B lymphocytes.
[0051] B6 means the murine strain C57BL/6.
[0052] Blood antibodies means antibodies present in blood/serum, including antibodies against CNS antigen-/myelin-specific responses of white blood cells, in particular B lymphocytes.
[0053] CNS means central nervous system.
[0054] CNS antigen means proteins of the central nervous system (CNS), in particular myelin antigens such as proteolipid protein (PLP), myelin basic protein (MBP) or myelin oligodendrocyte glycoprotein (MOG), but also neuronal antigens and additionally, fusion proteins, recombinant proteins or analogues of these proteins, the analogues being defined by their cross-reactivity with the respective antigen-specific antibodies. CNS antigens also include peptides that contain sequences of the protein CNS antigens.
[0055] CNS lysate means a solution produced when the CNS tissue is disrupted in a process known as lysis. This releases the contents of the tissue. After a crude lysate has been generated, the different components can be separated such as organelles, membrane lipids, proteins and nucleic acids. In this application CNS lysate includes proteins derived from CNS tissue. CNS lysate is commercially available or can be prepared following the standard procedures. An example of such a protocol would be to remove the CNS tissue, freeze it in liquid nitrogen and keep it at 70 C. or below until further use. Ice-cold lysis buffer containing Tris, EDTA, Triton X-100 and protease inhibitors is added to the frozen tissue, which is then homogenized on ice. Subsequently, the homogenate is ultracentrifuged and the supernatant isolated. The protein concentration can be determined e.g. by Bradford assay. The supernatant is then stored at 70 C. or below until further use.
[0056] CSF means cerebrospinal fluid.
[0057] C57BL/6 means a common inbred strain of laboratory mice.
[0058] CD means cluster of differentiation and refers to cell surface molecules on a cell classifying this cell.
[0059] CFA means complete Freund's adjuvant and is a mixture of IFA and M. tuberculosis strain H37RA.
[0060] CIS means clinically-isolated syndrome.
[0061] DNA means desoxyribunucleic acid.
[0062] drLNs means draining lymph nodes.
[0063] EAE means experimental autoimmune encephalomyelitis
[0064] ELISA means enzyme-linked immunosorbent assay.
[0065] ELISPOT means enzyme-linked immunosorbent spot technique.
[0066] FBS means fetal bovine serum.
[0067] FITC means fluoresceinisothiocyanate.
[0068] HL-1 means a chemically defined culture medium containing less than 30 g protein per ml.
[0069] HRP means horseradish peroxidase.
[0070] IFA means incomplete Freund's adjuvant and is a mixture of mannide monooleate and paraffin oil.
[0071] Ig means immunoglobulin=antibody.
[0072] IL means interleukin.
[0073] J.sub.HT means a B cell-deficient strain of laboratory mice.
[0074] KO means genetic knock-out.
[0075] MBP means myelin basic protein.
[0076] MHC means major histocompatability antigens
[0077] MOG means myelin oligodendrocyte glycoprotein.
[0078] MOGp means MOG peptide 35-55.
[0079] MP4 means MBP-PLP fusion protein.
[0080] MRI means magnetic resonance imaging.
[0081] MS means multiple sclerosis.
[0082] MT means a B cell-deficient strain of laboratory mice.
[0083] NMO means neuromyelitis optica.
[0084] PBMC means peripheral blood mononuclear cells.
[0085] PBL means peripheral blood lymphocytes.
[0086] PLP means proteolipid protein.
[0087] PLPp means PLP peptide 139-151.
[0088] PPMS means primary progressive multiple sclerosis. PPMS is characterized by a gradual progression of the disease from its onset with no superimposed relapses and remissions. There may be periods of a leveling off of disease activity. PPMS differs from RRMS and SPMS in that the onset is typically in the late thirties or early forties, men are as likely women to develop it and initial disease activity is often in the spinal cord and not in the brain. Primary Progressive MS often migrates into the brain, but is less likely to damage brain areas compared to RRMS and SPMSfor example, people with PPMS are less likely to develop cognitive deficits. PPMS is the subtype of MS that is least likely to show inflammatory (gadolinium enhancing) lesions on MRI scans. The primary progressive form of the disease affects between 10 and 15% of all people with multiple sclerosis.
[0089] PTx means pertussis toxin.
[0090] R848 means an imidazoquinoline compound with potent anti-viral activity. This low molecular weight synthetic molecule activates immune cells via the TLR7/TLR8 MyD88-dependent signaling pathway. Recently, R848 was shown to trigger NF-B activation in cells expressing murine TLR8 when combined with poly(dT). It is used for the polyclonal stimulation of B lymphocytes.
[0091] RPMI-1640 means a cell culture medium for leukocytes and other cell types, RPMI stands for Roswell Park Memorial Institute, where RPMI was developed.
[0092] RIS means radiologically-isolated syndrome.
[0093] SJL means Swiss James Lambert and is a common inbred strain of laboratory mice.
[0094] T-cells means all T effector cell lineages including Th1 and/or Th2- and/or Th9- and/or Th17- and/or Th22-lymphocytes.
[0095] TCR means T cell receptor.
[0096] T.sub.H means T helper and refers to different types of T cells.
[0097] TMB means 3,3,5,5-Tetramethylbenzidine.
[0098] WT means wild type.
Multiple Sclerosis
[0099] Currently, diagnosis of MS is based on a combination of clinical findings, symptoms, and imaging methods such as magnetic resonance imaging (MRI) Polman et al., Multiple sclerosis diagnostic criteria: three year later, Multiple Sclerosis 11:5-12 (2005). Although presence of immunoglobulins in the cerebrospinal fluid (CSF) may be relevant, MRI has become perhaps the single most informative procedure to contribute to an MS diagnosis. Polman, Id. at 5. A positive MRI test is often probative alone, but the finding of CSF oligoclonal IgG bands) can decrease the stringency of MRI requirements and still fulfill diagnostic criteria. Id. at 6.
[0100] Unfortunately, MRI and obtaining CSF are associated with complications. MRI equipment is expensive and is limited to secondary or tertiary care centers, and the tests are costly, time consuming and require patients to come to hospital. Further, interpretation of MRI results requires a high degree of training and sophistication among health care professionals and remain somewhat uncertain, due to interpretation of locations and time-course of development of lesions. CSF analysis requires painful intervention into a patient's CSF compartment, typically via a spinal needle. Additionally, the accuracy of the current McDonald criteria is not ideal. False negative results are particularly difficult to address. A false negative result reflects a failure of the diagnostic method to accurately identify MS, and is reflected in a low sensitivity (sensitivity (in %)=[1false negative rate]100) One major focus in the art is upon reducing false positive diagnoses to increase selectivity (selectivity (in %)=[1false positive rate]100). In general, the lower the threshold for making a diagnosis (increase sensitivity) may lower selectivity. Thus, there is a trade-off between selectivity and sensitivity.
[0101] Therefore, we sought to produce simple, cost-effective, safe procedures for diagnosing MS with high selectivity and high sensitivity, especially of those forms of MS that are amenable to treatment (e.g., early in the disease progression), and differentiating between patients for whom immunological and other therapies are likely to be successful from those patients for whom such interventions are less likely to be successful.
[0102] We have unexpectedly found that tests of blood, plasma and/or serum for the presence of CNS-specific antibodies, T-lymphocytes, B-lymphocytes and memory B cells can be effective in diagnosing different forms of MS, predicting progression of MS, and providing guidance for therapeutic intervention.
Immunological Findings in MS
[0103] Myelin antigen-reactive antibodies are commonly detected in MS patients (P. Dharmasaroja, J. Neurol. Sci. 206 (2003) 7-16; Y. Qin and P. Duquette, Int. MS J. 10 (2003) 110-120; T. Ziemssen and F. Ziemssen, Autoimmun Rev. 4 (2005) 460-467; P. Martin Mdel and N. L. Monson, Front. Biosci. 12 (2007) 2735-2749; K. A. McLaughlin and K. W. Wucherpfennig, Adv. Immunol. 98 (2008) 121-149; S. Kuerten et al., Fortschr. Neurol. Psychiatr. 79 (2011) 83-91). The deposition of antibodies in lesions has been found to occur alongside with fixed components of the complement system suggesting that these antibodies have activated complement in situ contributing to inflammation and phagocyte activation (I. I. Ivanov et al., Cell 126 (2006) 1121-33; C. M. Pelfrey et al., J. Immunol. 165 (2000) 1641-1651; R. Hohlfeld and H. Wekerle, Proc. Natl. Acad. Sci. U S A 101 (2004) 14599-14606; P. V. Lehmann et al., Nature 358 (1992) 155-157). So-called pattern II lesions that are characterized by the presence of antibodies and complement are the most abundant ones in MS and also found in NMO, a strongly antibody-dependent variant of the disease. Accordingly, plasma exchange showed therapeutic benefit both in type II MS and NMO patients (C. Lucchinetti et al., Ann. Neurol. 47 (2000) 707-717; B. G. Weinshenker et al., Ann. Neurol. 46 (1999) 878-886; M. Munemoto et al., J. Clin. Neurosci. (2011), epub.
[0104] Much of our current perception of the pathomechanisms involved in MS has been deduced from studies of EAE. In most EAE models CD4.sup.+ T cells have been found to be required and sufficient to mediate the disease and in many models an involvement of antibodies has been ruled out. An apparent exception is MOG-induced EAE of the B6 mouse. Human MOG protein, but not MOG peptide and rat MOG protein have been shown to entail a pathogenic autoantibody response (A. R. Oliver et al., J. Immunol. 171 (2003) 462-468; C. B. Marta et al., Proc. Natl. Acad. Sci. USA 102 (2005) 13992-13997; J. A. Lyons et al., Eur. J. Immunol.32 (2002) 1905-1913; C. Bourquin et al., J. Immunol. 171 (2003) 455-461). Our data presented herein provide evidence that MOG:35-55-induced EAE can be independent of autoantibodies. In the light of the literature MBP- and PLP-induced EAE are also CD4.sup.+ T cell mediated without a pathogenic antibody contribution (N. T. Potter and T. S. Stephens, J. Neurosci. Res. 37 (1994) 15-22; B. L. McRae and S. D. Miller, Neurochem. Res. 19 (1994) 997-1004; S. S. Zamvil et al., Nature 32.4 (1986) 258-260; R. B. Fritz et al., J. Immunol. 130 (1983) 191-194). The data we present here, using the MP4 fusion protein that contains both MBP and PLP, does not support that idea.
[0105] Proteolipid Protein (PLP) has been shown to be encephalitogenic in several mouse strains (N. T. Potter and T. S., J. Neurosci. Res. 37 (1994) 15-22). However, few studies have been performed with the native PLP protein. Due to its extreme hydrophobicity that results from four transmembraneous sequences, it is difficult to isolate and to experimentally work with (V. K. Tuohy, Neurochem. Res. 19 (1993) 935-944). Therefore and because of a relapsing-remitting disease course, PLP peptide 139-151-induced EAE in SJL mice has become the prevalent PLP model. However, because KO mice are not available on the SJL background, it is difficult to dissect the role of antibodies in this model. Also, the PLP peptide 139-151 is located in an intracellular domain of PLP and immunization with the peptide does not elicit antibodies that could bind to the surface of the intact myelin sheath (N. T. Potter and T. S. Stephens, J. Neurosci. Res. 37 (1994) 15-22; B. L. McRae and S. D. Miller, Neurochem. Res. 19 (1994) 997-1004). EAE induced by MBP protein (that is easy to purify and work with) has been studied extensively. Only little and conflicting evidence for a pathogenic role of MBP-specific antibodies has been found in the past (M. Morris-Downes et al., J. Neuroimmunol. 125 (2002) 114-124; Z. Jingwu et al., J. Neuroimmunol. 24 (1989) 87-94). The finding is perhaps not surprising since MBP is buried inside the myelin sheath and thus not accessible to autoantibodies.
[0106] In previous work we showed that immunization of MT mice with MP4 results in a MP4-specific T cell response that is comparable in magnitude to WT mice, yet the MT mice do not develop severe EAE (S. Kuerten et al., J. Neuroimmunol. 177 (2006) 99-111). Apparently, the MBP/PLP-specific T cells could not establish inflammatory lesions without the additional involvement of either B cells or antibodies. Here we show that in MP4-immunized B cell-deficient mice MBP/PLP-specific antibodies are sufficient to induce EAE of similar course and severity as in the WT mice.
[0107] The mechanisms by which MBP/PLP-specific antibodies assert the EAE sensitizing effect in MP4-immunized mice are unclear. Whatever the mechanisms of the MBP/PLP-specific antibodies may be, to our knowledge this is the first demonstration that such antibodies can have a fundamental impact on the development of EAE. In the absence of such antibodies, MBP/PLP-induced EAE does not develop in
[0108] B6 mice. These data also implicate a role of MBP and PLP as targets of autoantibody-mediated immune pathology in MS. Unlike for T cells, for antibody-mediated pathology, the abundance of the antigen can be decisive. MBP and PLP are the most abundant myelin proteins. MBP- and PLP-specific antibodies are prevalent in MS and considering the results reported herein, we conclude that such antibodies play a pathogenic role in the human disease.
Multiple Sclerosis and Experimental Autoimmune Encephalomyelitis (EAE)
[0109] Multiple Sclerosis (MS) is a human disease. It is characterized by progressively developing sensory, neurocognitive and autonomic deficits and weakness of skeletal muscle, with the attendant loss of motor function. It is widely believed that MS may be an autoimmune disorder, in which the body identifies one or more CNS proteins as foreign, and develops immune responses against the cells that express those proteins. Based on this understanding, an animal system has been widely used to study mechanisms and characteristics of the disease in animals, including mice. Such systems are generally termed Experimental Autoimmune Encephalopathy or EAE.
[0110] EAE has been widely used to mimic MS. EAE can be produced by administering to mice MOG, MBP, PLP or combinations of these antigens. Additionally fusion proteins can be used to induce EAE. Although the ways in which EAE is induced may vary, they share the common features of human MS. These include progressive sensory and autonomic deficits, muscular weakness, with the resultant loss of motor coordination and function. Thus, studies in animals with induced EAE are predictive of humans with MS.
[0111] There are two primary options for immune monitoring in MS. One involves the testing of cerebrospinal fluid itself which, however, cannot easily be done repeatedly and longitudinally in patients. The other one is testing of peripheral blood that, due to its accessibility and the availability of considerable amounts of PBMCs, is the primary site of sampling. For this reason, most data on CNS antigen-reactive T cells in MS have been obtained using PBMCs from the peripheral blood (D. J. Mahad, J. et al., Mult. Scler. 9 (2003) 189-198; B. Bielekova and R. Martin, Brain 127 (2004) 1463-1478; L. Rinaldi and P. Gallo, Neurol. Sci. 26 (2005) S215-S217; M. Reindl et al., J. Neuroimmunol. 180 (2006) 50-62; A. Lutterotti et al., Curr. Med. Chem. 14 (2007) 1956-1965; R. J. Fox et al., Mult. Scler. 14 (2008) 1036-1043; J. Drulovic et al., J. Neuroimmunol. 215 (2009) 90-95; S. Sawai et al., J. Neuroimmunol. 218 (2010) 112-115).
[0112] While EAE is generally considered a model for MS, studies of murine blood have so far been limited by the low numbers of cells that can be obtained without jeopardizing the survival of the mice. In the blood of MS patients, it has been challenging to reliably measure CNS antigen-specific T cells (C. M. Pelfrey et al., J. Immunol. 165 (2000) 1641-1651).
[0113] Therefore, we first set out to investigate whether such cells could be reliably detected in the blood of mice undergoing EAE. As shown in
[0114] In the PLPp/SJL model, we did not find a correlation between the numbers of CNS antigen-specific IFN- or IL-17 secreting T cells prior to EAE onset and the severity of the initial disease episode. This might be explained by the ease with which determinant spreading occurs in these mice: in contrast to MOGp-induced EAE, the PLPp model involves effector cells that are specific for determinants other than PLP:139-151 and that possibly need to be considered in future studies to delineate a correlation with the clinical severity (B. L. McRae et al., J. Exp. Med. 182 (1995) 75-85; C. L. Vanderlugt et al., Immunol. Rev. 164 (1998) 63-72; C. L. Vanderlugt K et al., J. Immunol. 164 (2000) 670-678).
[0115] Remarkably, however, the subsequent relapsing-remitting disease course was mirrored by dynamic frequencies of CNS antigen-specific T cells in the blood. After the acute stage of the disease, the frequencies of the first wave autoreactive T cells dropped in 10 out of 11 mice (one additional mouse died of EAE), paralleling the clinical recovery from EAE. Previous work has demonstrated that unlike during active primary disease or relapse, in such states of remission, few if any functional T cells are found in the CNS (H. H. Hofstetter et al. J. Immunol. 174 (2005) 4598-4605; W. S. Begolka et al. J. Immunol. 161 (1998) 4437-4446). Therefore, one might postulate that the drop in T cell numbers in the blood reflects an actual exhaustion of the first wave of effector cells in SJL mice rather than redistribution towards the CNS. Why this reduction in frequencies and the recovery itself occurs in SJL mice versus the B6 model is unclear. Nevertheless, these results are consistent with the primary effector cell hypothesis, provided this exhaustion of the majority of T cells also affects those cells engaged by determinant spreading during the first episode of the disease.
[0116] It was striking that in parallel to the EAE relapse, massive renewed expansions of PLPp-specific T cells were seen in 9 out of 10 mice (two additional mice died of EAE). The mechanisms that drive this renewed expansion are unclear, but this expansion could explain the occurrence of the clinical disease exacerbation well. CNS antigen expression in peripheral tissues has been observed (T. M. Pribyl et al., Proc. Natl. Acad. Sci. U S A 90 (1993) 10695-10699; T. M. Pribyl et al., J. Neurosci. Res. 45 (1996) 812-819; R. B. Fritz and I. Kalvakolanu, J. Neuroimmunol. 57 (1995) 93-99; N. Kawakami et al., J. Exp. Med. 1999 (2004) 185-197) and could boost the autoreactive T cells in addition to CNS antigen release from the injured target organ itself (P. V. Lehmann et al. Nature 358 (1992) 155-157; B. L. McRae et al., J. Exp. Med. 182 (1995) 75-85). The breakdown or dysfunction of immune regulatory mechanisms, including regulatory T cells, may also be suggested (A. L. Astier et al., J. Clin. Invest. 116 (2006) 3252-3257; A. L. Zozulya and H. Wiendl, Nat. Clin. Pract. Neurol. 4 (2008) 384-398; A. Ma et al., Int. Immunopharmacol. 9 (2009) 599-608).
[0117] The studies described herein of MOGp-induced EAE provided results that are consistent with a simple pathological mechanism. In contrast to the PLPp/SJL model, we found that the frequencies of both IFN- and IL-17 producing T cells prior to disease onset correlated with the subsequent maximal disease severity. These data correspond to the notion that the CNS antigen-specific T cells may be mediators of the disease. Accordingly, the higher the number of specific T cells present, the higher the effector potential and the more severe the resulting disease. This type of direct relationship is also known for passive EAE, in which graded numbers of CNS antigen-specific T cells are injected into nave recipients (I. M. Stromnes and J. M. Goverman, Nat. Prot. 1 (2006) 1952-1960). In the MOGp model of EAE, the frequencies of the specific T cells were stable over the observation period and so was the clinical course of the disease. These data might be interpreted to mean that even in chronic disease, the T cells engaged by immunization (as opposed to those engaged by determinant spreading) continue to be the primary effector cells. This direct relationship does not exclude more complex mechanisms. However, while there is ample evidence for determinant spreading in the PLPp-induced SJL model (C. L. Vanderlugt et al., Immunol. Rev. 164 (1998) 63-72; C. L. Vanderlugt et al., J. Immunol. 164 (2000) 670-678; V. K. Tuohy et al., Immunol. Rev. 164 (1998) 93-100), our literature search did not provide evidence for spreading in the MOGp-induced EAE of B6 mice.
[0118] We found that the limited amount of blood available from mice does not prevent systematic studies of the effector cell pool, while offering the possibility of observing the clinical disease in parallel. Thereby, we fill an important gap that has previously hampered immune diagnostic/prognostic research in EAE. This study was not intended to provide detailed insights into the complex immune mechanisms that underlie CNS antigen-induced EAE, including comprehensive studies of cytokine signatures of the effector cells and secondary repertoire dynamics involved in spreading. However, the initial experiments presented here provide a striking observation, namely, that CNS antigen-specific T cell frequencies in the blood are reflective of the clinical course of EAE. In addition, it has become increasingly clear that effector cell types are not stable, but tend to convert from T.sub.H17 to T.sub.H1 in vivo (G. Shi et al., J. Immunol. 181 (2008) 7205-7213). By offering the possibility of monitoring such dynamics, our assay can contribute to the identification of the dominant effector cell populations causing pathology in each particular disease stage. As more is learned about the CNS antigens that are actually targeted in MS, our approach should therefore also serve as valuable tool in the quest for more efficient diagnostic and prognostic options in patients where the blood is the primary material that is available for testing.
[0119] While attempts have been made to correlate disease activity and cytokine production in blood and cerebrospinal fluid (CSF) of MS patients, results were discouraging and controversy has remained One of the problems resided in the fact that in most cases cytokine levels were measured, without considering the antigen-specificity of the response. In addition, longitudinal measurements of antigen-specific T and B cell responses have not been performed in EAE and MS.
[0120] In addition to the involvement of CNS antigen-specific T cells, about 75% of MS patients show antibody depositions within demyelinative CNS lesions (pattern II according to Lucchinetti et al.). Accordingly, this patient population greatly benefits from plasma exchange, pointing to a significant pathogenic role of antibodies in the disease. B cells and the secretion of antibodies by plasma cells have so far largely been neglected as a pathogenic entity of MS. Focus has rather been laid onto the T cell component of the disease. One of the main reasons for that is that much of our current perception of the pathomechanisms involved in MS has been deduced from studies of EAE. In most EAE models CD4.sup.+ T cells have been found to be required and sufficient to mediate the disease and in many models an involvement of B cells and antibodies has been ruled out. We have recently introduced the MBP-PLP fusion protein MP4-induced EAE as a novel animal model for MS in C57BL/6 mice (Kuerten et al., 2006). We have shown that MP4-induced EAE is B cell-/antibody-dependent. B cell-deficient mice (such as the MT or J.sub.HT strain) are resistant to EAE. However, reconstitution of these mice with MP4-reactive antibodies completely restored disease susceptibility to the level of the wild-type mice (Kuerten et al., 2011; see Example 16).
Cellular and Molecular Diagnosis of MS
[0121] CNS antigen-specific B cells are present in the blood of MS patients in high numbers relative to healthy control subjects, but cannot be detected because they do not produce antibody when there is no acute immune activation and patients are in remission. There are still CNS antigen-specific antibody secreting B cells in the CNS itself, but these B cells are likely to remain in the CNS and antibodies secreted by these B cells will be directly absorbed by the CNS tissue, thus, not recirculating in the blood stream. After B cell stimulation in vitro with polyclonal activators, however, all B cells within the PBMC become activated and start producing antibodies. In a subsequent readout system that detects CNS antigen-specific B cells, one can identify the number of CNS antigen-specific B cells (indirect B cell assay). In patients with acute disease and recent immune activation, B cells secreting CNS antigen-specific antibodies can be directly detected in the blood without any polyclonal stimulation (direct B cell assay). In the experiments described herein, membranes were coated with crude CNS protein lysate containing all CNS antigens or individual recombinant CNS antigens (e.g., MOG or MBP/PLP). When activated B cells are seeded on top of the CNS antigen-coated membrane, the antibodies produced by CNS antigen-specific B cells will bind to the membrane around the secreting B cell and the individual spot forming cells can be enumerated via the ELISPOT technology thus revealing the frequency of CNS antigen-specific B cells in the cell population of activated PBMCs. Antibodies produced by B cells with other specificity are not bound to the membrane and go undetected. While we used ELISPOT detection, which is a highly quantitative and sensitive detection system, other detection systems well suited to detect antigen-specific antibodies after polyclonal stimulation of B cells can also be used. These assays include ELISA, cytokine bead arrays, immune staining, immunoblotting, immune precipitation and immune agglutination.
[0122] Because it is known that B cells produce antibodies in isolation only when they are acutely engaged in immune processes, we found that detection of such B cells can help identify flares of MS. Distinguishing the two disease stages is important for making therapeutic decisions, we found that the direct B cell assay can help identify active MS and the indirect B cell assay can be effectively used to monitor MS patients not experiencing active disease or relapse.
[0123] Therapeutic significance of the direct and indirect B cell assays is the ability to guide therapeutic decisions for people with established MS. Because B cells are also surfacing as possible mediators of the disease, the detection of such cells can help testing for the efficacy of therapies that aim to deplete B cells for treatment of MS (e.g., using anti-CD20 and anti-CD22 antibodies). However, it may be generally considered that T cells are causative in MS and B cells have been considered only marginally important.
[0124] Initial trials of anti-CD20 antibodies have been demonstrated to be effective in MS patients, leading to a 91% reduction in new enhancing lesions and a 80% reduction in relapses compared to placebo treatment. Further, such antibodies are well tolerated by patients without major side effects.
[0125] In patients with CIS, only 4 of 12 responded to the indirect B cell assay and one responded in the direct B cell assay. However, when these findings are considered in light of two additional variables, 10 of 12 patients tested positive. Therefore, the combination of these four assays can be effective in diagnosing CIS. The four tests are: (1) direct B cell assay, (2) indirect B cell assay, (3) neuroantigen-induced (CNS-antigen induced) T cell reactivity (via measurement of IFN- and IL-17), and (4) presence of serum antibodies to CNS antigen. The combination of these four assays therefore can be used to identify individuals at risk for developing MS at a stage of the disease where clinical diagnosis is still uncertain.
[0126] Furthermore, detection of CNS antigen-specific B cells and T cells can help to identify a subset of patients that benefit from immune modulatory treatment or T cell or B cell depletion therapy at any stage of the disease. Therefore, the assays of this invention are a useful companion for such treatments.
[0127] Our data show that myelin-reactive antibodies can play a significant role in the pathogenesis of EAE and due to the resemblance between EAE and the human disease it is to be assumed that this also applies to MS. It should be noted that disease occurred shortly after the injection of myelin-reactive serum delineating the role of antibodies for disease induction/outbreak. These data suggest that the correlation between the CNS antigen-specific T cell response and the disease outcome also applies to the CNS antigen-/myelin-specific B cell-/antibody response.
[0128] Our results indicate the importance of T and B cells and antibodies in the pathogenesis of the disease. We suggest that measurements of the CNS antigen-/myelin-specific T-cell responses and B cell/antibody responses permit one to predict:
(a) whether a patient presenting with CIS or RIS will develop definite MS;
(b) whether and when a patient with definite MS will develop a disease relapse; and
(c) whether and how well a patient with CIS, RIS or MS will respond to treatment with immune modulators
[0129] Statement (c) above implies that measurements of CNS antigen-/myelin-specific T and B cell/antibody responses also permit the identification of different patient subpopulations. Only if the pathogenesis has a predominant autoimmune component (meaning that T and B cells/antibodies contribute to the disease in a relevant way) immune modulatory treatment will be effective. If the pathogenesis in a patient is rather defined by e.g. primary oligodendrogliopathy immune modulatory treatment will not be as effective or even non-effective. Thus, the detection of CNS antigen-/myelin-specific T-cell responses and B cell/antibody responses cannot only be regarded as diagnostic/prognostic test for MS, but also has important therapeutic implications.
[0130] While for the simple diagnosis of whether a patient will transit from CIS/RIS to MS it is sufficient to determine whether there is a myelin-specific T cell/B cell/autoantibody response, it can be useful to determine the magnitude of this response for defining whether and when the next relapse will occur and whether treatment will be effective and how effective it will be. The detection of a CNS antigen-/myelin-specific T cell response or B cell or antibody response and determining the magnitude of this response can be useful in evaluating treatment of MS.
[0131] Prior to this disclosure, there was discussion about whether treatment with immune modulatory drugs should be initiated as soon as an individual presents with CIS or RIS. Treatment can have severe side effects and it has also been reported that treatment responsiveness can decrease over time. In addition, patient compliance to treatment varies, considering the fact that it is unclear if a patient with CIS or RIS will actually develop MS. In some cases, CIS or RIS patients may not progress into definite MS. The diagnostic or prognostic methods we invented can help to avoid unnecessary treatment where possible and to initiate treatment where necessary. In addition, by predicting which patients with CIS/RIS will actually develop MS, our approach provides new methods to aid in preventive treatment options for MS. Thus far, there are only few studies exploring ways to prevent MS since prior to this disclosure, there have been no predictive tests available. Our methods can also contribute to the development of preventive treatment targeting the disease before significant CNS damage has occurred in the patient and thereby reducing the risk for the development of irreversible functional deficits in patients that can result from each additional relapse.
[0132] All patients that have MS or that will develop MS will have a detectable myelin-specific T cell response and/or B cell/autoantibody response. Modulations in the magnitude of this response can indicate whether a relapse is likely to occur, meaning that frequencies of cytokine/antibody producing T cells/B cells will increase prior to the relapse. This increase in the magnitude of the CNS antigen-specific T cell response or B cell antibody response can be therapeutically used. Here again, early therapy before the onset or recurrence of disease can prevent the development of irreversible CNS damage and thus irreversible functional deficits in patients. In addition, the correlation between the magnitude of the CNS antigen-specific response T cell response or B cell/antibody response and treatment effectiveness can help to optimize treatment options in individual patients, in particular avoiding treatment with drugs that are not successful in that patient, but can rather cause serious adverse effects.
[0133] The methods of this invention are rapid, cost effective, and do not require very expensive equipment, such as magnetic resonance imaging (MRI) devices. Tests of this invention can be carried out as an out-patient procedure, requiring only the acquisition of a sample of a patient's blood. These tests can be carried out at the point of care (e.g., physician's office), or can be carried out in a centralized location. The texts can be automated, and results obtained rapidly, thereby rapidly enabling appropriate diagnostic and therapeutic interventions. When combined with therapies disclosed herein, the diagnostic methods can be very powerful adjuncts to more traditional, and costly methods, such as MRI.
General Methods
[0134] Bead Array Based Assays
[0135] Use of Detection Surfaces In Detection Particle Bead Array Based Assay
[0136] Bead array technology is described in U.S. Pat. Nos. 7,598,093 and 8,088,630, both herein incorporated fully by reference. Briefly, a detection surface is in a cell culture plate (e.g., 96-well or 360-well microtiter plate) to detect cellular products. First, the detection surface can be the surface of a well in the plate or a membrane, which is coated with an antibody specific for the analyte of interest as a capture reagent. After several hours of incubation (2 hrs to overnight), during which the capture reagent(s) bind(s) to the membrane, excess capture reagent is washed away. The unsaturated surfaces of the membrane are then blocked with irrelevant protein (bovine serum albumin or gelatin) to prevent subsequent nonspecific binding of analytes. Following the blocking step, the plates are washed to remove non-plate bound, excess blocking reagent.
[0137] At this point the detection substrate is properly prepared to test cells. In some embodiments, human peripheral blood mononuclear lymphocytes (PBL or PBMCs) are added at a concentration of for example, about 510.sup.5 per well. Specific antigen (e.g., hMOG) is added to the experimental wells, control wells contain no antigen or irrelevant antigen (e.g. myohemerythrin, a protein that humans have not encountered). Among all cells plated (about 510.sup.5 cells) only the antigen specific T cells will be stimulated by the antigen to release secretory products (e.g. IFN-gamma). In the control wells, in the absence of the antigen, antigen specific cells are not stimulated and do not release secretory products. During a 4-48 hr cell culture period (dependent on the product to be detected) the antigen specific cells secrete their products(s) being captured by the capture reagents around the secreting cell. Following the culture period, the cells are washed away, leaving their secretory product retained on the membrane. In some embodiments, the cells can remain on the detection surface.
[0138] A detection reagent bound to a detection particle is added to bind to the plate-bound secretory product (the detection and capture antibodies specific for secretory products, e.g., IFN-have to recognize different parts of the molecule such as not to interfere with each other's binding). The detection particle is either directly labeled with a fluorochrome (e.g., FITC, PE or texas red) or has a characteristic spectral feature. (e.g., different spectral features for different cellular products). Directly labeled detection antibodies associated with detection particles are particularly useful. Alternatively, an antibody is added that is specific for the analyte and a secondary antibody is attached to the detection particle. Coupling of detection antibody to the detection particle by biotin-streptavidin can also be used.
[0139] There are a variety of means for visualizing the detection particles using a detection reagent such as: a) immune fluorescence if the secondary (or tertiary) reagent was a fluorochrome or b) a characteristic spectral feature (e.g., different colors for different analytes) visualized by light microscopy. Each spot of colored substrate corresponds to one cell producing or secreting the product. The difference in number of spots between antigen stimulated wells and the number of spots in the negative control wells (with medium alone or irrelevant antigen) establishes the signal to be analyzed (usually there is no spot formation in the negative control). Sizes of the spots correspond to the quantity of product secreted, the number of spots establishes the frequency of antigen specific cells in the cell population tested (i.e. cells that were induced by the antigen to secrete the product among all cells plated, e.g., 20 IFN-gamma spots in HIV antigen challenged PBL represent a frequency of 40/million, if 510.sup.5 cells were plated).
[0140] To carry out peptide screening, microwells are employed to screen and identify the antigenic determinants that T cells recognize, using peptides. Usually, in studies that involved peptides, a few randomly chosen sequences of the antigen are tested as peptides. However, even overlapping sequences that walk down the molecule in steps of 5 to 10 amino acids do not necessarily detect all determinants. By contrast, in this example overlapping sets of peptides are employed that walk the molecule amino acid by amino acid. This peptide scan includes every possible determinant on an antigen and provides an exact mapping of the T cell repertoire. In some cases, a protein (hMOG, MBP, MP4 or other CNS antigen), or a peptide (e.g., hMOGp, MBPp and the like) can be used to screen for MS, CIS, RIS and related conditions.
[0141] While an assay system has been employed to test for antigen specific CD4 cells [G. Gammon et al., T Cell Determinant Structure: Cores and Determinant Envelopes in Three Mouse Major Histocompatibility Complex Haplotypes J. Exp. Med. 173: 609-617 (1991)], the bead array methods allow for testing of CD8 cells. CD8 determinant mapping for HIV identifies possible peptides for vaccines. Determinant mapping for autoantigens in autoimmune disease has prognostic and possible therapeutic consequences.
[0142] For determinant mapping, Myelin Basic Protein (MBP) peptides that walk the MBP molecule amino acids by amino acid are used. These peptides produce clear data in SHIVERER mice. The peptides can be frozen without losing bioactivity at 14 M concentration in HL-1 medium, which is 2 the optimal concentration for the bioassay. Thus, the large number of peptides involved do not have to be diluted and plated for each experiment, but can be freshly thawed from storage. The entire peptide series is diluted, pipetted and frozen series in advance and, on the day of experiment, the required number of plates are prepared.
[0143] The number of cells available from patients can be limiting; one million cells can be obtained from one milliliter of blood and usually fifty milliliters of blood is available per patient (i.e., fifty million cells may be the total cells available for the assay). Because 210.sup.5 cells per well provides clear results, this is sufficient for testing 250 peptides, which constitutes an average size protein. However, by miniaturizing the plates (e.g. to 50 microliter wells), one can test for 1000 peptides, which can cover even the larger proteins. The entire peptide series can be tested on an individual. The plating of the cells can be performed with 12 channel pipettors into the freshly prepared plates, reducing the time involvement on the first day of the assay to a couple of hours.
[0144] PBL cells (PBMCs) were plated at 210.sup.5 cells per well into 96 well microtiter plates containing the hydrophobic membrane precoated with an antibody as capture reagent. The cells are incubated in the wells with antigen for 24 h at 37 C., 8% CO.sub.2. During this culture period, T cells with specificity for a given peptide are be activated and start secreting cytokines and other cellular products, which are captured by the appropriate antibody on the plate around producing cells. Thus, secreting cells (antigen specific memory cells) are surrounded by a spot of the cytokine.
[0145] After an additional culture (24 hours), the cells can then be washed away and the bound cytokine is detected by a biotinylated second antibody that is specific for the same cytokine but recognizes a different determinant on it. The plate bound second antibody is attached to a microsphere with a characteristic marker thereon.
[0146] The numbers of spots in antigen containing wells vs. wells containing medium alone or irrelevant antigens establish the number of antigen specific cells in the culture. Since 210.sup.5 cells are plated to each well, the absolute frequency represents the frequency of antigen reactive T cells in 210.sup.5 T cells of the given specificity within the cell pool tested.
[0147] For a two color detection particle based assay, a capture surface is prepared as above, except that a second capture reagent and a second detection reagent/microsphere is used as well. To prepare the surface for a two-color assay, two (2) capture reagents (e.g., anti-IFN- and anti-IL-17 antibodies) are used simultaneously (for additional capabilities, still additional capture reagents can be employed for a multicolor assay).
[0148] Cells can be plated (about 510.sup.5 cells) and only the antigen specific T cells are stimulated by the antigen to release secretory products. In other embodiments, B-cell products (e.g., antibodies) can be detected. However, in the case of T cells, the surface is capable of detecting both IFN- and IL-17. It can be appreciated that to detect antibodies secreted by B cells, the surface of the plate can be coated with an antigen against which the B cells produce antibodies. Thus, to use bead array assays to detect MS and related conditions, a plate can be coated with hMOG, hMBP, MP4 or a peptide thereof. When a B cell is placed on the antigen, the cell can produce and secrete the anti-hMOG, anti-MBP, or anti-MP4 antibodies, which then can bind to the antigen and remain bound to the plate to enable detection using bead array methods.
[0149] After the culture period and washing described above, a second detection reagent attached to a second detection particle is employed together with the first detection reagent attached to a first detection particle. In this case, detection particles labeled with anti-IL-17 is added (alternatively, fluorochromes emitting different colors when excited by UV light permit two or multicolor assays e.g., FITC:green, PE:red). Spots originating from cells that secreted one of the products only, will appear as a single color (e.g., red or blue), while cells secreting both will have the both colors represented by different detection particles.
[0150] The detection particle based assay can be evaluated visually using a microscope or other optical device. Quantitative analysis (spots per 10.sup.6 splenocytes) for each cytokine reveals 180-250 spots per million cells. In order to verify that the assay is quantitatively reliable, a similar detection particle based analysis is performed on serially diluted samples, and we found that the number of responding cells falls linearly in relation to the serial dilution. Thus, the detection particle based assay yields reproducible quantitative and qualitative information regarding the alloimmune response. While it is not intended that the assays be limited by the use of particular antibodies, work with human PBLs has resulted in the determination that the antibody combinations set forth in Table 1 below can effectively detect human cytokines in recall responses to common antigens. It can be appreciated that the list in the Table is only exemplary. Many other capture reagents and detection reagents can be effectively used with bead based assays.
TABLE-US-00001 TABLE 1 Cytokines and Detection Reagents Coating Antibody Detection Antibody Cytokine (Capture Reagent) (Detection Reagent) IL-2 BG-5 (Serotec) Rabbit polyclonal (BD) IL-4 8D4-8 (PHRM) MP4-25D2 (PHRM) IL-5 JES1-39D10 (PHRM) JES1-5A10 (PHRM) IL-10 JES3-9D7 (PHRM) JES3-12G8 (PHRM) IFN MA700 (ENDO) MA701 (ENDO)
[0151] In some instances, T cells can be enriched from PBLs using human T cell isolation columns (R and D Systems), as per manufacturer's recommendations. In other instances, depletion of T cell subtypes is desired. Depletion of T cell subtypes can be performed by standard methods, using OKT3 (anti-CD3), OKT4 (anti-CD4), or OKT8 (anti-CD8), and rabbit complement (Cedarlane, Hornsby Ont). Aliquots of the resultant cells can be washed and stained with FITC conjugated antibodies for phenotyping by FACS. The antibodies are isolated from hydriboma supernatants grown in our laboratory by standard methods.
[0152] In other embodiments, methods can be used to use particles directly labeled with detection secondary antibodies. It is analogous to the indirect method described here, with the difference that interaction of the streptavidin-labeled particles with biotinylated secondary antibodies takes place prior to their interaction with the cytokine-primary coating antibody complex on the surface. The method is based on the fact that interaction of streptavidin with its natural ligand, biotin, is practically irreversible; the equilibrium binding constant for this interaction exceeds the magnitude of 10.sup.11 M.sup.1.
[0153] Particles of each individual type (color) covalently conjugated with streptavidin or its analog, avidin, are premixed with the biotin-labeled secondary detection antibody (reagent) specific to each secreted product. After the reaction is completed, the excess of unbound biotinylated antibodies is removed by the addition of agarose beads coated with streptavidin. Agarose beads with the bound excessive biotinylated antibodies are then removed by centrifugation. Particles of different color, each labeled with single type of the secondary detection antibody (reagent) through streptavidin-biotin interaction, are incubated with the surface-bound secreted product similar to the way directly conjugated particles are used. Several particle types can be used either simultaneously or in a number of consecutive steps.
Specific Embodiments
[0154] Materials
[0155] B Cell ELISPOT
[0156] 1) MultiScreen.sub.HTS Filter Plates for ELISPOT (Millipore, Billerica, Mass. Cat. No. MSIPS4W)
[0157] 2) hMOG (Synthesized and kindly provided by Prof. Nancy H. Ruddle; Yale University, New Haven, Conn.)
[0158] 3) Whole human brain lysate (Novus Biologicals, Littleton, Colo. Cat. No. NB820-59177)
[0159] 4) MP4=MBP-PLP fusion protein (provided by Alexion Pharmaceuticals, Inc., Chesire, Conn.)
[0160] 5) Recombinant human IL-2 for polyclonal stimulation: Synonyms: T-cell growth factor (TCGF), Aldesleukin. IL-2 is a powerful immunoregulatory lymphokine produced by T-cells in response to antigenic or mitogenic stimulation. IL-2/IL-2R signaling is required for T-cell proliferation and other fundamental functions which are essential for the immune response. IL-2 stimulates growth and differentiation of B-cells, NK cells, lymphokine activated killer cells, monocytes, macrophages and oligodendrocytes. (Peprotech, Rocky Hill, N.J.; Cat. No. 200-02)
[0161] 6) R848 for polyclonal stimulation: R848 is an imidazoquinoline compound with potent anti-viral activity. This low molecular weight synthetic molecule activates immune cells via the TLR7/TLR8 MyD88-dependent signaling pathway. Recently, R848 was shown to trigger NF-B activation in cells expressing murine TLR8 when combined with poly(dT) (Enzo Life Sciences, Farmingdale, N.Y.; Cat. No. ALX-420-038)
[0162] 7) 2-mercaptoethanol for polyclonal stimulation: (Sigma-Aldrich, St. Louis, Mo.; Cat. No. M7154)
[0163] 8) Detection antibodies for B cell ELISPOTAnti-Human IgG Fc PAN (1,2,3,4), biotin-conjugated (Hybridoma Reagent Laboratory, Baltimore, Md.; Cat. No. HP6043B)
[0164] 9) Detection antibodies for B cell ELISPOTAnti-Human IgM, biotin-conjugated (Hybridoma Reagent Laboratory, Baltimore, Md. Cat. No. HP6083B)
[0165] 10) Streptavidin-AP (Alkaline Phosphatase) (Sigma-Aldrich, St. Louis, Mo.; Cat. No. 52890)
[0166] 11) Vector Blue Alkaline Phosphatase Substrate Kit; (Vector Laboratories, Burlingame, Calif.; Cat. No. SK-5300)
[0167] 12) RPMI Media 1640 for cell culture with L-Glutamine: (Invitrogen, Grand Island, N.Y.; Cat. No. 11875)
[0168] 13) Fetal bovine serum (FBS): (Invitrogen, Grand Island, N.Y.; Cat. No. 16140)
[0169] T Cell ELISPOT
[0170] 1) MultiScreen.sub.HTS Filter Plates for ELISPOT: (Millipore, Billerica, Mass.; Cat. No. MSIPS4W)
[0171] 2) Whole human brain lysate: (Novus Biologicals, Littleton, Colo.; Cat. No. NB820-59177)
[0172] 3) MP4=MBP-PLP fusion protein: (Provided by Alexion Pharmaceuticals, Inc., Chesire, Conn.)
[0173] 4) hMOG peptide library (synthesized by JPT Peptide Technologies GmbH, Berlin, Germany)
[0174] 5) Anti-Human Interleukin-17A mAb MT44.6; purified (ELISPOT coating): (Mabtech, Nacka Strand, Sweden; Cat. No. 3520-3
[0175] 6) Anti-Human Interleukin-17A mAb MT504; biotinylated (ELISPOT detection): (Mabtech, Nacka Strand, Sweden; Cat. No. 3520-6
[0176] 7) Anti-Human Interferon- mAb 1-D1K; purified (ELISPOT coating) (Mabtech, Nacka Strand, Sweden; Cat. No. 3420-3)
[0177] 8) Anti-Human Interferon- mAb 1-D1K; biotinylated (ELISPOT detection): (Mabtech, Nacka Strand, Sweden; Cat. No. 3420-6)
[0178] 9) Streptavidin-AP (Alkaline Phosphatase): (Sigma-Aldrich, St. Louis, Mo.; Cat. No. 52890)
[0179] 10) Vector Blue Alkaline Phosphatase Substrate Kit: (Vector Laboratories, Burlingame, Calif.; Cat. No. SK-5300
[0180] 11) RPMI Media 1640 for cell culture with L-Glutamine: (Invitrogen, Grand Island, N.Y.; Cat. No. 11875
[0181] 12) Fetal bovine serum (FBS): (Invitrogen, Grand Island, N.Y.; Cat. No. 16140)
[0182] Antibody ELISA
[0183] 1) Immuno 96 MicroWell Solid Plates: (Thermo Scientific, Nunc, Rochester, N.Y.; Cat. No. 456537)
[0184] 2) Whole human brain lysate: (Novus Biologicals, Littleton, Colo.; Cat. No. NB820-59177)
[0185] 3) MP4=MBP-PLP fusion protein: (Provided by Alexion Pharmaceuticals, Inc., Chesire, Conn.)
[0186] 4) Detection antibodies for B cell ELISPOTAnti-Human IgG Fc PAN (1,2,3,4), biotin-conjugated: (Hybridoma Reagent Laboratory, Baltimore, Md.; Cat. No. HP6043B)
[0187] 5) Fetal bovine serum (FBS): (Invitrogen, Grand Island, N.Y.; Cat. No. 16140)
[0188] 6) Streptavidin-HRP (Horseradish Peroxidase): (BD Pharmingen, San Jose, Calif.; Cat. No. 557630)
[0189] 7) TMB (3,3,5,5-Tetramethylbenzidine) substrate: (eBioscience, San Diego, Calif.; Cat. No. 00-4201-56)
[0190] 1. Direct B Cell Test
[0191] Plasmablasts, also known as plasma cells or effector B cells are characterized by the production of antibodies. If plasmablasts/plasma cells/effector B cells are specific for CNS/myelin antigen they will produce antibodies against their specific CNS/myelin antigen, which can be directly measured in the blood. Measurement of such antibodies arising from the CNS can be detected using methods developed by Cellular Technology Ltd. (Neurospot is a trademark of Cellular Technology Ltd, Shaker Heights Ohio).
[0192] Approach
[0193] Filter or ELISA plates are coated with CNS/myelin antigen. PBMCs are isolated from the blood, e.g. by density gradient centrifugation and transferred to the plates as described in U.S. Pat. No. 7,598,093. After suitable incubation time, allowing sufficient secretion and binding of antibodies to the coated antigen, the production of CNS/myelin-specific antibodies is detected by either fluorescent or enzyme detection. Antibodies measured include IgM, IgD, IgG and IgG isotypes.
[0194] Therapeutic Significance for the Patient
[0195] B cells will produce antibodies at isolation only when they are acutely engaged in immune processes (were recently activated). Therefore, detection of such B cells will identify flares of MS (MS is known to progress in phases of clinical activity followed by periods of partial or complete remission). Clinically, this implies that patients with MS or at high risk to develop MS have to be monitored to detect the upcoming relapse before the patient has developed clinical symptoms. With each relapse there is a risk of remaining irreversible symptoms. Thus, the immune activity leading to the clinical relapse can desirably be attenuated before the patient develops clinically evident symptoms. The Direct B Cell assay of this invention therefore can advantageously be used as an immune monitoring tool with direct therapeutic implications for the patient. A positive B Cell assay response indicates that treatment has to be initiated. Because immune activity needs to be suppressed at this stage, immunosuppressive treatment such as the administration of corticosteroids (which are commonly used for the treatment of acute disease in MS patients) or other immunosuppressive agents such as azathioprine, cyclophosphamide or mitoxantrone can be used when a positive B Cell assay response is observed.
[0196] 2. Indirect Memory B Cell Test
[0197] Memory B cells may require several days of stimulation with polyclonal activators before they start secreting antibodies. We therefore developed an in vitro indirect B cell test to identify such cells from the blood. Polyclonal stimulation can be done in a pre-incubation step, in which B cells are stimulated with polyclonal activators for 3-8 days in culture. Polyclonal stimulation may include pre-incubation with IL-2, R-848 and -mercaptoethanol and other protocols that are commonly used to polyclonally stimulate B cells. Consecutively, the production of CNS antigen-/myelin-specific antibodies by polyclonally activated B cells can be performed as described in Section 1 above for Direct B Cell assays.
[0198] Approach
[0199] Peripheral blood mononuclear cells (PBMCs) are isolated from the blood, e.g. by density gradient centrifugation. The B cells contained in the sample are polyclonally stimulated e.g. with IL-2, R-848 and -mercaptoethanol and subsequently transferred to filter plates or ELISA plates that have been coated with CNS antigen (that is whole brain lysate, MBP/PLP or human MOG). The polyclonally stimulated cells are then incubated on the plate. After suitable incubation time, allowing sufficient binding of secreted antibodies to the antigen on the plate, the production of CNS/myelin-specific antibodies is detected by either fluorescent or colorimetric enzyme detection. Antibodies measured include IgM, IgD, IgG and IgG isotypes.
[0200] Therapeutic Significance for the Patient
[0201] Therapeutic significance of the indirect memory B cell test is the ability to guide therapeutic decisions for people with established MS.
[0202] 1) The Indirect memory B cell test can be used for verifying the diagnosis of definite MS. Our data show that 100% of definite MS patients tested positive in using the Indirect Memory B Cell Test. The current diagnostic tool for diagnosing MS is mainly MRI. However, as a systematic literature review revealed Magnetic resonance imaging (MRI) is not particularly useful in ruling in or ruling out multiple sclerosis (MS). Relying on it will result in overdiagnosis; using it to rule out MS will cause you to miss about half of those eventually clinically diagnosed. (Whitting et al., 2006). With a sensitivity and specificity of 100%, the Indirect Memory B Cell Test of this invention is a reliable tool for the diagnosis of MS, while being more cost-effective and easy to perform at the same time since only a blood sample is needed.
[0203] 2) In our studies, the indirect memory B cell test shows that B cells are importantly involved in the pathogenesis of MS. This finding has direct therapeutic consequences for the treatment of MS patients. Currently, treatment relies on immune modulatory strategies that do not specifically target individual immune cell populations, but rather show a more general mode of activation. These drugs comprise glatirameracetate, interferon-beta, natalizumab and fingolimod. The therapeutic strength of anti-B cell treatment via B cell depleting agents such as anti-CD20 or anti-CD22 antibodies (e.g. rituximab, ocrelizumab, ofatumumab) or via agents targeting the survival of B cells such as atacicept and belimumab has been shown in initial trials leading to a 91% reduction in new enhancing lesions and a 50% reduction in relapses compared to placebo treatment. However, so far, none of these highly potent drugs has been approved for the treatment of MS, partly due to the fact that there is currently no highly sensitive and specific monitoring tool available allowing the reliable diagnosis of whether a patient has B cell-dependent MS. The indirect memory B cell test of this invention will allow a practitioner to determine whether a patient has B cell-dependent MS. Following a positive indirect memory B cell test in these patients, B cell therapy is to be initiated, and is highly likely to be very effective. Therefore, a positive indirect memory B cell test response has direct therapeutic consequences for the individual patient and will justify B cell-specific therapy.
[0204] 3) The magnitude of the positive test response in the indirect memory B cell test is related to the magnitude of the autoimmune B cell response in individual patients. Thus, once either B cell-specific or immune modulatory treatment has been initiated the treatment success can be monitored via the indirect memory B cell test. Treatment success is likely to be related to a diminution of the magnitude of the positive response in the indirect memory B cell test (i.e., a decrease in spot number, spot size or spot intensity).
[0205] 3. Detection of CNS Antigen-Specific Antibodies in the Serum or Plasma
[0206] Despite detecting CNS antigen-specific lymphocytes in the blood, antibodies that have already been secreted by these cells in vivo can be detected in the serum/plasma.
[0207] Approach
[0208] ELISA plates are coated with CNS/myelin antigen. A sample of serum or plasma is collected and applied to the coated plates. After suitable incubation time allowing for sufficient binding of antibodies to the coated antigen, the presence of CNS/myelin-specific antibodies is detected by enzyme detection. Antibodies measured include IgM, IgD, IgG and IgG isotypes.
[0209] 4. Combined Detection of B Cells and T Cells
[0210] In other embodiments, this invention includes methods to combine measurements of CNS antigen-/myelin-specific B cells and the production of CNS antigen-/myelin-specific antibodies by these B cells with the detection of, IFN- and IL-17 production by CNS antigen-/myelin-specific T cells in the blood. Both CNS antigen-/myelin-specific B cells/antibodies and T cells can contribute to the pathogenesis of MS. While in one subset of patients CNS antigen-/myelin-reactive B cells/antibodies may be the main pathogenic correlate, CNS antigen-/myelin-reactive T cells can be the main pathogenic correlate in another subset of patients. Also, there is a subset of patients, in which both CNS antigen-/myelin-specific B cells/antibodies and T cells equally contribute to the pathogenesis. As mentioned above, there can also be a subset of patients, in which both CNS antigen-/myelin-reactive B cells/antibodies and T cells are not crucially involved. The combined measurement of CNS antigen-/myelin-specific B cells/antibodies and T cells is necessary to cover the full pathogenic spectrum evident in patients, thus increasing diagnostic/predictive efficiency and precision of the assay and also permitting the distinction between different patient subpopulations.
[0211] 5. Detection of B-Lymphocyte or T-Lymphocyte Products
[0212] In certain embodiments of this invention, detection of B-lymphocyte or T-lymphocyte products can be carried out using one of a variety of methods. Such methods include fluorometric spot assays (Fluorospot, Cellular Technology Ltd. Shaker Heights, Ohio), enzyme-linked spot (ELISPOT) assays, enzyme-linked immunosorbent assays (ELISA), immunoblotting (e.g., dot blot technique), polymerase chain reaction (PCR), and real-time PCR (RT-PCR), Radioimmunoassays (RIA), cytokine bead arrays, protein arrays, bead aggregation assays, intracellular cytokine staining, immunoprecipitation assays, immunohistochemistry, in situ cytokine detection on slides, cell screening or ultrasensitive densitometry by nanoparticle-modified aptamers.
[0213] ELISPOT Assays
[0214] According to embodiments of this invention, enzyme linked immune spot (ELISPOT assays can be carried out using methods described in U.S. Pat. Nos. 7,598,093 and 8,088,630, (incorporated herein fully by reference. Analyzers and methods from Celleular Technology Ltd (Immunospot is a Registered Trademark of Cellular Technology Ltd. (CTL), Shaker Heights, Ohio). Analyzers and methods can be obtained from CTL.
[0215] CNS antigen-specific antibodies can be detected and measured in serum using ELISA, cytokine bead arrays, protein arrays and test strips. Antibodies detected can include IgA, IgD, IgE, IgG and IgM and their isotypes. Detection of B-lymphocytes in the blood includes measuring spontaneous production of antibodies by white blood cells after their isolation from the blood. B-lymphocyte ELISPOT assays, ELISA, cytokine bead arrays and protein array assays can be used. B-lymphocyte stimulation can be carried out by exposing B-cells to CNS antigens or by polyclonal stimulation by IL-2, R-848 and -mercaptoethanol or other method commonly used to stimulate polyclonal production of B-lymphocytes.
[0216] T-lymphocyte measurements also include antigen-induced cellular proliferation, as assayed, for example, by thymidine incorporation assays. Assays using MTT or similar compounds can also be used. MTT (3-(4,5-Dimethyl-2-yl)-2,5-diphenyltetrazolium bromide, a yellow tetrazole), is reduced to purple formazan in living cells. A solubilization solution (usually either dimethyl sulfoxide, an acidified ethanol solution, or a solution of the sodium dodecyl sulfate is added to dissolve the insoluble purple formazan product into a colored solution the absorbance of this colored solution can be quantified by measuring at a certain wavelength. The absorption maximum is dependent on the solvent employed.
[0217] XTT (2,3-bis-(2-methoxy-4-nitro-5-sulfophenyl)-2H-tetrazolium-5-carboxanilide) can also be used. The formed formazan dyes is water soluble, avoiding a final solubilization step. Water soluble tetrazolium salts were developed by introducing positive or negative charges and hydroxyl groups to the phenyl ring of the tetrazolium salt, or better with sulfonate groups added directly or indirectly to the phenyl ring.
[0218] MTS (3-(4,5-dimethylthiazol-2-yl)-5 -(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium), in the presence of phenazine methosulfate (PMS), produces a formazan product that has an absorbance maximum at 490-500 nm in phosphate-buffered saline.
[0219] WSTs (Water Soluble Tetrazolium salts) are a series of other water soluble dyes for MTT Assays, developed to give different absorption spectra of the formed formazans. WST-1 and in particular WST-8 (2-(2-methoxy-4-nitrophenyl)-3-(4-nitrophenyl)-5-(2,4-disulfophenyl)-2H-tetrazolium), are advantageous over MTT in that they are reduced outside cells, combined with PMS electron mediator, and yield a water-soluble formazan. Finally, WST assays (1) can be read directly (unlike MTT that needs a solubilization step), (2) give a more effective signal than MTT, and (3) decrease toxicity to cells (unlike cell-permeable MTT, and its insoluble formazan that accumulate inside cells).
[0220] Additionally, T-lymphocyte response can be assayed by measuring adenosine tri-phosphate (ATP) production and CFSE methods.
[0221] Therapeutic Significance for the Patient
[0222] Clinical significance of combining the above described B or T Cell approaches with the detection of CNS antigen-reactive T.sub.H1/T.sub.H17 responses and serum or plasma measurements of CNS antigen-specific antibodies resides in the effectiveness to solidify the diagnosis of MS in patients with clinically-isolated syndrome or radiologically-isolated syndrome (CIS/RIS). As mentioned above, basing the diagnosis of MS solely on MRI is not reliable. As shown by our data, 10 of 12 patients who were suspected to have MS tested positive in the combined approach. For all of these patients, the diagnosis of MS has subsequently been confirmed due to the emergence of a new clinical relapse and the occurrence of additional CNS lesions. For the two patients that had negative test results the diagnosis of MS was not confirmed. Thus, a combined test approach of this invention is a highly sensitive and specific test for diagnosing MS at an early stage. This has broad therapeutic implications for the patients since a positive test response determines the need for initiating immune modulatory therapy. At the current stage, it is unclear whether patients with CIS/RIS should be treated for MS and a significant amount of patients refuses therapy at this stage, since immune modulatory treatment has adverse side effects. However, it has been shown that in case a patient has definite MS, early treatment is important to prevent long-term CNS atrophy and functional deficits. In many patients, treatment is only initiated once a second relapse has occurred, always bearing the risk to lead to irreversible symptoms. Thus, a positive result in our combined test will directly indicate a therapeutic decision to initiate immune modulatory treatment.
[0223] In addition, our data show that with disease progression to the secondary-progressive stage of MS, patients increasingly become negative in the combined B Cell-T Cell-antibody test. This result is indicative of a transition from a primary autoimmune pathogenesis of MS to primary neurodegeneration that occurs in the CNS itself. Once a state of prevailing neurodegeneration has been reached, immune modulatory treatment is likely to become ineffective. On the one hand, our combined test allows one to monitor disease activity in individual patients. The transition from a positive to a negative test result will indicate that cessation of treatment is prudent because therapy is unlikely to be effective. Should there be the option for neuroregenerative treatment in the future (so far, such drugs are not available) negative test results will indicate that such options are likely to be more effective than immune modulatory treatment. However, our data also show that 5/12 patients with secondary progressive MS retained a positive Indirect Memory B Cell Test response. These patients are likely to still benefit from immune modulatory treatment, in particular anti-B cell therapy and can be identified by our test.
EXAMPLES
[0224] This invention is further illustrated by the following examples, which are not considered limiting to the scope of this invention. Rather, they are used to point out certain embodiments. Persons of skill in the art can use the descriptions and teachings herein to produce other embodiments that are within the scope of this invention. All such embodiments are considered to be part of this invention.
Example 1: Detection of Myelin-Specific B Cells and Antibodies from Human Patients with Multiple Sclerosis I
[0225] Methods:
[0226] Filter plates were coated with MBP/PLP antigen. PBMC were isolated from the blood by density gradient centrifugation and transferred to the plates as described in U.S. Pat. No. 7,598,093. After a suitable incubation time, allowing sufficient secretion and binding of antibodies to the coated antigen, the production of CNS/myelin-specific antibodies was detected by enzyme-linked immunoassay detection. Antibodies measured included IgM and IgG.
[0227] Results:
[0228]
Example 2: Detection of Myelin-Specific Immune Cells from a Human Patient with Multiple Sclerosis II
[0229] Peripheral blood mononuclear cells (PBMCs) were isolated from the blood by density gradient centrifugation. The B cells contained in the sample were polyclonally stimulated with IL-2, R-848 and -mercaptoethanol for 3 days and subsequently transferred to filter plates that have been coated with CNS antigen (that is whole brain lysate or human MOG). The polyclonally stimulated cells were then incubated on the plate for 24 h. The production of CNS/myelin-specific antibodies and binding to the antigen on the plate was detected by colorimetric enzyme detection. Antibodies measured included IgG.
[0230]
[0231]
Example 3: CNS Antigen-Specific IFN- and IL-17 Responses Detected In the Blood of Immunized Mice
[0232] To determine whether CNS antigen-specific IFN- and IL-17 responses could be detected in the blood of mice, n=16 SJL mice were immunized with 100 g PLPp in CFA, and n=14 B6 mice with 100 g MOGp in CFA. In addition, n=8 SJL and n=8 B6 mice received PBS in the absence of antigen in CFA. PTx was given on the day of immunization and 48 h later. On day 10 after immunization, mice were bled and PBMCs were isolated as described above and tested for their respective CNS antigen-specific IFN- and IL-17 response in double-color ELISPOT assays.
[0233]
[0234]
[0235] We conclude from this study that assays of this invention provide the ability for the first time, to detect T-cell responses reflective of their ability to produce cytokines in response to stimulation by CNS antigens. We further conclude that assays of this invention can be useful to detect T cell responses in disorders involving CNS antigen sensitivity in human beings. In particular, we conclude that assays of this invention can be useful in detecting MS in human beings, and can be useful in monitoring state of relapse, recurrence, and responses to therapy for MS.
Example 4: Double-Color Assay
[0236] To validate use of a double-color assay for INF- and I(L-17 as described above in Example 3, we compared results of assays carried out using either a single color assay for INF- or IL-17, and compared the results with those obtained using a double-color assay for both cytokines.
[0237]
Example 5: EAE and CNS Antigen-Specific T Cells in Mice Correlate with Disease Severity
[0238] Due to the limited numbers of PBMCs that can be obtained from the blood of individual mice, a key question whether central disease parameters such as onset, progression and severity correlate with the magnitude and cytokine quality of the T cell response in experimental autoimmune encephalomyelitis (EAE) has remained unanswered.
[0239] In embodiments of this invention, we developed an ELISPOT-based PBMC test system in which as little as 150 l of murine blood are sufficient, allowing to bleed mice repeatedly while continuing to observe the clinical course of EAE. Using this technique, we demonstrate that longitudinal measurements of antigen-specific IFN- and IL-17 production in the blood are a highly suitable approach to predict the disease outcome in remitting-relapsing PLP:139-151- and chronic MOG:35-55-induced EAE of SJL/J and C57BL/6 mice, respectively. We demonstrated low volume cytokine monitoring as useful in for efficient diagnostic and prognostic options in human multiple sclerosis and other autoimmune diseases.
[0240] Experimental autoimmune encephalomyelitis (EAE) is a common model for multiple sclerosis (J. Goverman and T. Brab, Lab. Anim Sci. 46 (1996) 482-492; M. Sospedra and R. Martin, Annu. Rev. Immunol. 23 (2005) 683-747; L. Steinman and S. S Zamvil, Ann. Neurol. 60 (2006) 12-21; R. Gold et al., Brain 129 (2006) 1953-1971). EAE is induced by immunization with CNS antigens that trigger an autoimmune T cell response. For example, the proteolipid protein (PLP) peptide 139-151-induced EAE in SJL mice (V. K. Tuohy et al., J. Immunol. 142 (1989) 1523-1527; R. A. Sobel et al., J. Neuropathol. Exp. Neurol. 49 (1990) 468-479) and the myelin oligodendrotcyte glycoprotein (MOG) peptide 35-55-triggered disease in C57BL/6 (B6) mice (I. Mendel et al., Eur. J. Immunol. 25 (1995) 1951-1959; I. Mendel et al., Eur. J. Immunol. 26 (1996) 2470-2479) have evolved as prevalent murine models. Whereas the former is characterized by a predictable relapsing-remitting course, the disease is chronic in the latter. In both models, the respective CNS antigen-specific CD4.sup.+ T cells are known to cause the immunopathology in the absence of antibodies playing a significant role (N. T. Potter and T. S. Stephens, J. Neurosci. Res. 37 (1994) 15-22; B. L. McRae and S. D. Miller, Neurochem. Res. 19 (1994) 997-1004;] P. Hjelmstrom et al., J. Immuno1.161 (1998) 4480-4483; A. R. Oliver et al., J. Immunol. 171 (2003) 462-468).
[0241] Sequences of immunogens are shown below in single letter code.
TABLE-US-00002 1)HumanMyelinOligodendrocyteGlyoprotein(hMOG) SEQIDNO.1 MASLSRPSLPSCLCSFLLLLLLQVSSSYAGQFRVIGPRHPIRALVGDEVELPCRISPGKN 60 ATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFS 120 DEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLVFLCLQY 180 RLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYNWLHRRLAGQFL 240 EELRNPF 247 2)HumanMOG35-55 SEQIDNO.2 SSYAGQFRVIGPRHPIRALV 20 3)HumanMyelinBasicProtein(MBP),Isoform3,21.5kDa SEQIDNO.3 MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKV 60 PWLKPGRSPLPSHARSQPGLCNMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNI 120 VTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKI 180 FKLGGRDSRSGSPMARR 197 4)HumanProteolipidProtein(APLP4) SEQIDNO.4 MGLLECCARCLVGAPFASLVATGLCFFGVALFCGCGHEALTGTEKLIETYFSKNYQDYEY 60 LINVIHAFQYVIYGTASFFFLYGALLLAEGFYTTGAVEQIFGDYKTTICGKGLSATVTGG 120 QKGRGSRGQHQAHSLERVCHCLGKWLGHPDKFVGITYALTVVWLLVFACSAVPVYITFNT 180 PWNAFPGKVCGSNLLSICKTAEFQMTFHLFIAAFVGAAATLVSLLTFMIAATYNFAVLKL 220 MGRGTKF 227 5)PLPpeptide139-151(PLPp) SEQIDNO.5 HCLGKWLGHPDKF 13 6)TheLinkerforMBPandPLP4(MP4) SEQIDNO.6 LLGGLEDP 8 7)MP4 SEQIDNO.7 MASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKV 60 PWLKPGRSPLPSHARSQPGLCNMYKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNI 120 VTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKI 180 FKLGGRDSRSGSPMARRLLGGLEDPMGLLECCARCLVGAPFASLVATGLCFFGVA 235 LFCGCGHEALTGTEKLIETYFSKNYQDYEYLINVIHAFQYVIYGTASFFFLYGALLLAEG 295 FYTTGAVEQIFGDYKTTICGKGLSATVTGGQKGRGSRGQHQAHSLERVCHCLGKWLGHPD 355 KFVGITYALTVVWLLVFACSAVPVYITFNTPWNAFPGKVCGSNLLSICKTAEFQMTFHLF 415 IAAFVGAAATLVSLLTFMIAATYNFAVLKLMGRGTKF 452
[0242] CD4.sup.+ T cells can mediate the immune pathology by secreting cytokines that activate and attract cells of the innate immune system, primarily macrophages, into delayed-type hypersensitivity (DTH)-like reaction. For many years, the mediation of DTH in the CNS was attributed to IFN- secreting T.sub.H1 type cells and subsequently, most efforts of immune monitoring focused on measuring IFN- to identify the autoreactive effector cells (J. E. Merrill et al., Proc. Natl. Acad. Sci. U S A 89 (1992) 574-578; V. Navikas and H. Link, J. Neurosci. Res. 45 (1996) 322-333; H. H. Hofstetter et al., J. Neuroimmunol. 170 (2005) 105-114; H. H. Hofstetter and T. G. Forsthuber, Neurosci. Lett. 476 (2010) 150-15). More recently though, the pathogenic/encephalitogenic quality of autoreactive cells was linked to the ability to produce IL-17, accounting for a T.sub.H lineage independent of the IFN- producing T.sub.H1 cell and termed T.sub.H17 (H. H. Hofstetter et al., Cell. Immunol. 237 (2005) 123-130; I. I. Ivanov et al., Cell 126 (2006) 1121-33; Y. Komiyama et al., J. Immunol. 177 (2006) 566-73). In line with this basic understanding of the immune pathology of EAE, we suspected that the magnitude of the CNS antigen-specific T cell response might be reflected by the frequencies of the IFN- or IL-17 producing T cells is the primary criterion that defines the severity of the disease.
[0243] It has been established that after immunization with CNS antigen including PLP peptide (PLPp) and MOG peptide (MOGp), the frequencies of IFN- and IL-17 producing cells in draining lymph nodes (drLNs) and spleen are highly variable, ranging from very low to rather high (H. H. Hofstetter et al., J. Immunol. 174 (2005) 4598-4605). It is also well known that the severity of the disease shows considerable interindividual fluctuations, ranging from mild to lethal, even when keeping the variables that could influence the disease outcome constant (e.g. age of the mice at immunization, gender, genetic background, colony etc.) (H. H. Hofstetter et al., J. Immunol. 174 (2005) 4598-4605; S. Kuerten et al., J. Neuroimmunol. 189 (2007) 31-40). Taking the causative relationship between CD4.sup.+ T cells producing IFN- and IL-17 and the development of EAE into account, we suggest that the magnitude of the T cell response and the disease severity will be in direct correlation to each other. In other words, those mice that do not develop severe disease, for example, due to their T cell repertoires, will not display a high frequency of effector cells, whereas a high effector cell mass will accumulate in those mice, in which the pathology is severe enough to cause lethality.
[0244] However, this hypothesis has previously not been tested in mice. This is because T cell assays typically require 510.sup.5 to 110.sup.6 cells per test condition, and if one includes control and experimental sets in replicates, then 3 to 610.sup.6 cells may be needed for a single measurement. For this reason, most immune monitoring in mice has been performed with lymphoid tissue such as drLNs and spleen, from which sufficient cell numbers can be obtained for testing. Needless to say, mice have to be sacrificed for such tests. Therefore, no information can be obtained as to what clinical disease would have looked like if they had been permitted to live longer.
[0245] We introduced an ELISPOT assay for testing mouse blood in order to move closer to the human standard where blood is the primary sampling site for measuring T cell reactivity (H. H. Hofstetter et al., J. Immunol. 174 (2005) 4598-4605). For these first generation murine blood assays, a sufficient amount of blood was obtained for examining individual mice, but only if the mice were sacrificed. Thus, these assays were not suited for longitudinal studies. Here we developed a variant of the assay that functioned with only 150 l of blood and thereby permitted repeated bleeding of individual mice, while the clinical course of EAE could be observed over time.
[0246] To study both IFN- and IL-17, we performed double-color measurements. These technical advances enabled us to experimentally address one of the weighty outstanding questions in autoimmune research, that is, how the T cell reactivity in the blood is reflective of the clinical course of disease in individual mice.
Example 6: Materials and Methods
[0247] Mice
[0248] Female SJL/J and C57BL/6 (B6) mice (6-8 weeks old) were purchased from the Jackson Laboratory (Bar Harbor, Me.) and maintained, at the animal facilities of Case Western Reserve University, Cleveland, Ohio, USA under specific pathogen-free conditions. All treatments were performed according to an approved IACUC protocol and complied with the institutional guidelines.
[0249] Induction and Clinical Assessment of EAE
[0250] Incomplete Freund's Adjuvant (WA) was prepared as a mixture of mannide monooleate (Sigma-Aldrich Corp., St. Louis, Mo.) and paraffin oil (EMScience, Gibbstown, N.J.), CFA was obtained by mixing Mycobacterium tuberculosis H37RA (Difco Laboratories, Franklin Lakes, N.J.) at 5 mg/ml into IFA. For disease induction, mice were immunized subcutaneously in both sides of the flank with a total dose of 100 g PLP peptide 139-151 (SJL/J) or 100 g MOG peptide 35-55 (136). Both peptides were obtained from Princeton Biomolecules, Langhorne, Pa. 200 ng pertussis toxin (PTx; List Biological Laboratories, Hornby, ONT, Canada) in 500 l sterile PBS was given on the day of immunization and 48 h later. Control mice received both CFA and PTx, however in the absence of CNS antigen. Clinical assessment of EAE was performed daily according to the following criteria: (0), no disease; (1), floppy tail; (2), hind limb weakness; (3), full hind limb paralysis; (4), quadriplegia; (5), death. Mice that were in between the clear-cut gradations of clinical signs were scored intermediate in increments of 0.5.
[0251] Cell Preparations from Various Organs
[0252] Mouse blood (150 l per mouse and time point) was collected by tail vein bleeding using heparin as anti-coagulant. The blood was diluted at 1:2 with sterile calcium-free PBS. After centrifugation, red blood cells were lysed with ammonium chloride. Cells were then washed thoroughly with HL-1. Single cell suspensions from spleen and draining lymph nodes were prepared as previously described (H. H. Hofstetter et al., J. Neuroimmunol. 170 (2005) 105-114). All cells were counted using acridine orange/ethidium bromide (Sigma-Aldrich Corp.).
[0253] ELISPOT Assays and Image Analysis
[0254] Whatman Unifilter low-volume plates (Whatman Inc., Florham Park, N.J.) were coated overnight with the capture antibodies in sterile PBS. AN-18 (eBioscience, San Diego, Calif.) was used at 3 for capturing IFN- and TC-11-18H10 (BD Pharmingen, San Jose, Calif.) at 4 g/ml for IL-17. For double-color assays, anti-IFN- antibody was applied to the plate 10 min before the addition of anti-IL-17 antibody. The plates were blocked for 2 h at room temperature with sterile PBS containing 1% bovine serum albumin (Sigma-Aldrich Corp.). The cells were plated in HL-1 supplemented with 1 nM glutamine without (medium) or with antigen (final concentration of 15 g/ml for both MOG:35-55 and PLP:139-151). The plates were cultured at 37 C. and 7% C.sub.2O for 24 h. Subsequently, the detection antibodies were added for overnight incubation. FITC-labelled rat anti-mouse R4-6A2 (purified and FITC-labelled in our laboratory) was used at 0.5 g/ml for detecting IFN-, while rat anti-mouse TC11-8H4.1-biotin was used for the detection of IL-17 (BD-Pharmingen; 0.5 g/ml). For double-color assays, both antibodies were added at the same time. As a third reagent for IFN- anti-FITC-AP (Dako North America, Inc., Carpinteria, Calif.) was added at 1:500 dilution in PBS containing 1% BSA and 0.025% Tween 20, and Streptavidin-HRP (Dako) was added at 1:1000 for IL-17. After incubation for 2 h at room temperature, plates were developed using the Vector Blue substrate kit (Vector Laboratories, Inc., Burlingame, Calif.) for visualizing IFN- and AEC substrate solution (Cellular Technology Limited, Cleveland, Ohio) for IL-17. For double-color assays, blue spots were developed prior to red spots. The plates were analyzed on an ImmunoSpot Series 5 Analyzer (ImmunoSpot is a Registered Trademark of Cellular Technology Limited, Shaker Heights, Ohio). All results were normalized to 10.sup.6 cells, and the difference between stimulated and non-stimulated cells was calculated.
[0255] Statistical Analysis
[0256] SigmaStat software (Version 7.0; SPSS, Chicago, Ill.) was used to assess correlation coefficients and the statistical significance of the differences between two groups using Student's t-test. Statistical significance was set at P 0.05.
Example 7: PLPp-Specific and MOGp-Specific IFN- and IL-17 Producing T cells and Initial Disease Severity
[0257] Given that the primary variable that defines the immune pathology of EAE is the CNS antigen-specific T cell response, we carried out studies to determine if the magnitude of this response is correlated with the severity of the disease. This hypothesis was assessed in n=16 SJL mice that were immunized with PLPp in CFA, with PTx given on the day of immunization and 48 h later. We also studied B6 mice immunized using MOGp.
[0258] All mice were bled on day 10 after immunization and the magnitude of the PLPp-specific T cell response was determined in double-color IFN-/IL-17 ELISPOT assays. The resulting IFN- and IL-17 spot numbers were then correlated with the maximal severity of the following initial disease episode that typically occurred on day 13 after immunization in the SJL model.
[0259]
[0260]
[0261]
Example 8: Clinical Recovery From Initial EAE is Accompanied by a Drop in PLPp-Specific T Cells in PLPp-Induced EAE
[0262] The double-color ELISPOT assay that we developed functioned with as little as 150 l of murine blood. This allowed us to repeatedly measure the CNS antigen-specific T cell responses in individual mice while following up on the clinical course of EAE. N=12 SJL mice were immunized with PLP peptide 139-151 in CFA, with PTx given on the day of immunization and 48 h later. On days 10 and 20 after immunization, corresponding to the acute stage of EAE and remission, mice were bled and the PLPp-specific IFN- and IL-17 responses were assessed.
[0263] Results are shown in
[0264] The magnitudes of the PLPp-specific IFN- and IL-17 responses were assessed in each individual mouse (
Example 9: Relapse and Increase of PLPp-Specific T Cells in PLPp-Induced EAE
[0265] The dynamics of PLPp-specific T cell frequencies relative to the clinical course of EAE were further assessed by comparing remission and relapse. The same n=12 SJL mice shown in Example 8 as above were additionally bled on day 30 after immunization corresponding to the clinical relapse. PBMCs were isolated and again tested for their PLPp-specific IFN-/IL-17 responses in double-color ELISPOT assays.
[0266]
[0267] In one mouse the frequencies remained unchanged (
Example 10: Course of Disease in MOGp-Induced EAE Parallels MOGp-Specific T Cell Response
[0268] As the dynamics of clinical disease were reflected by fluctuations in the T cell compartment in PLPp-induced EAE of SJL mice, we assessed whether the chronic course of the disease was equally accompanied by stable frequencies of MOGp-specific T cells in MOGp-induced EAE of B6 mice. N=10 B6 mice were immunized with MOGp in CFA and PTx was given on the day of immunization and 48 h later. Mice were bled on days 10, 25 and 40 after immunization. PBMCs were isolated and tested for their MOGp-specific IFN- and IL-17 response in double-color ELISPOT assays while we followed up on the clinical course of EAE.
[0269] Results are shown in
[0270] In 10 out of 10 mice, the chronic non-remitting-relapsing course of EAE was reflected by stable frequencies of MOGp-specific IFN- producing T cells (means of 64.7, 60.2 and 72.7 for days 10, 25 and 40 with p=0.81 and p=0.45 respectively). The same applied to IL-17 (means of 69.2, 60.3 and 67.2 for days 10, 25 and 40 with p=0.63 and p=0.77, respectively). Again, both cytokinesIFN- and IL-17followed a similar trend.
[0271]
[0272] These results indicate that under the conditions of this study, PLPp appeared to produce greater severity of EAE and larger IFN- and IL-17 responses than did MOGp.
Example 11: B Cell-Deficient MT and J.SUB.H.T Mice Are Resistant to MP4-Induced EAE
[0273] In our initial characterization of the MP4 model we found that MP4-immunized MT mice did not develop clinically severe EAE. Here we additionally performed histological analysis. Moreover, we included J.sub.HT mice, a different B cell-deficient strain. WT B6 and B cell-deficient MT and J.sub.HT mice were immunized with 150 g MP4 in CFA. PTX was injected on days 0 and 2. The clinical course of the disease was assessed over a period of 40 days and is shown in
[0274] As depicted in
[0275] In contrast, in the B cell-deficient mice, no pathological changes were detected (
Example 12: Myelin-Reactive Antibodies Mediate the Pathology of MBP-PLP Fusion Protein MP4-Induced EAE
[0276] Introduction
[0277] Experimental autoimmune encephalomyelitis (EAE) is generally considered a model for multiple sclerosis (MS) (M. Sospedra and R. Martin, Annu. Rev. Immunol. 23 (2005) 683-747; R. Gold et al., Brain 129 (2006) 1953-1971). EAE can be induced by immunization with various myelin antigens. The initial EAE models entailed inoculation of crude spinal cord (E. A. Kabat et al., Res. Publ. Assoc. Res. Ner. Ment. Dis. 28 (1950) 113-132; J. Freund et al., Arch. Pathol. (Chic.) 50 (1950) 108-121; S. Levine and R. Sowinski, J. Immunol. 110 (1973) 139-143). Over the decades, they were replaced by increasingly defined systems, in which disease was elicited with purified antigens. At first, these antigens were proteins isolated from the brain and included myelin basic protein (MBP), proteolipid protein (PLP) and later myelin oligodendrocyte glycoprotein (MOG). Because such protein preparations are not necessarily pure and frequently not easy to obtain, the field progressed towards work with synthetic peptides.
[0278] In all EAE models studied so far it has become evident that CNS antigen-specific antibodies alone are insufficient to cause CNS pathology that is reminiscent of MS: injection of serum from myelin antigen- or antigenic peptide-immunized mice into nave recipients does not induce EAE (S. H. Appel and M. B. Bornstein, J. Exp. Med. 119 (1964) 303-312; D. O. Willenborg, Scand. J. Immunol. 16 (1982) 437-441). Because the immunization of wild-type (WT) animals typically elicits T and B cell responses in parallel, it cannot be mechanistically dissected whether the accompanying antibody response is merely a bystander phenomenon or plays an additional role in accelerating the disease. Only the introduction of B cell knock-out (KO) mice has enabled progress with studies that clearly distinguish between the T and B cell contribution to the disease process. These KO mice are on the C57BL/6 (B6) background that is particularly susceptible to MOG- and MOG peptide-induced EAE (while being relatively resistant to MBP or MBP peptide immunizations). A milestone paper demonstrated that immunization of B cell-deficient MT mice on the B6 background with MOG peptide 35-55 causes EAE that is similar to WT mice in course and severity (P. Hjelmstrom et al., J. Immunol. 161 (1998) 4480-4483). These results supported the prevailing thought that antibodies/B cells are not required for EAE pathogenesis. A later extension of these studies modified this notion showing that antibodies induced by immunization with human MOG protein (as opposed to rat MOG) contribute to EAE (while being not pathogenic on their own) [9-12]. These data provided the first direct evidence that MOG-specific antibodies can play a role in MOG-induced EAE. However, they have left the questions open if autoantibodies to other myelin antigens can be pathogenic in EAE and possibly also in MS.
[0279] The question of the pathogenetic significance of myelin-specific autoantibodies is of particular interest because in MS such autoantibodies can be regularly detected in the serum and cerebrospinal fluid (CSF) and in CNS lesions of patients (P. Dharmasaroja, J. Neurol. Sci. 206 (2003) 7-16; Y. Qin and P. Duquette, Int. MS J. 10 (2003) 110-120; T. Ziemssen and F. Ziemssen, Autoimmun Rev. 4 (2005) 460-467; P. Martin Mdel and N. L. Monson, Front. Biosci. 12 (2007) 2735-2749; K. A. McLaughlin and K. W. Wucherpfennig, Adv. Immunol. 98 (2008) 121-149; S. Kuerten et al., Fortschr. Neurol. Psychiatr. 79 (2011) 83-91). The same applies to Devic's disease, also known as neuromyelitis optica (NMO), which is frequently considered a variant of MS. NMO primarily affects the optic nerve and spinal cord and is focused on an autoantibody response, in particular against aquaporin-4. Similar to MS, many aspects of the pathogenesis of NMO have remained unclear (S. Jarius et al., Nat. Clin. Pract. Neurol. 4 (2008) 202-214.
[0280] Among the autoantigens for which EAE models are available, MBP and PLP are frequently targeted by autoantibodies in MS. In humans it is impossible to experimentally establish whether antibodies against MBP and PLP indeed play a pathogenic role or occur as epiphenomena of the disease. MBP-specific antibodies are unlikely to be pathogenic at least in the initial stages of the disease since MBP is an intracellular protein and as such not accessible to antibodies on intact myelin. In EAE there is little and controversial evidence for a pathogenic role of MBP-specific antibodies (M. Morris-Downes et al., J. Neuroimmunol. 125 (2002) 114-124; Z. Jingwu et al., J. Neuroimmunol. 24 (1989) 87-94).
[0281] PLP is a more likely candidate for antibody-mediated pathology. PLP is a transmembraneous protein. Two of its seven domains are located on the myelin surface readily accessible to antibodies (V. K. Tuohy, Neurochem. Res. 19 (1993) 935-944). Presently, it is not established whether PLP specific antibodies can contribute to EAE pathogenesis. Addressing this question was hampered by the extreme hydrophobicity of the PLP molecule, which made experimental work with the native protein rather difficult. Among PLP peptides, the sequence 139-151 is strongly pathogenic in SJL mice and hence this peptide and mouse strain combination has become the classic PLP model. In this model antibodies do not play a pathogenic role (N. T. Potter and T. S. Stephens, J. Neurosci. Res. 37 (1994) 15-22; B. L. McRae and S. D. Miller, Neurochem. Res. 19 (1994) 997-1004). It should be noted, however, that the 139-151 PLP peptide sequence occurs intracellularly, leaving the question open whether antibodies that recognize extracellular PLP domains could participate in the disease.
[0282] The role of PLP-specific autoantibodies can be studied using the MP4-induced EAE model. MP4 is a fusion protein of human MBP and an engineered form of PLP, which contains the three hydrophilic domains including the two extracellular loops (while the hydrophobic parts have been omitted) (E. A. Elliott et al., J. Clin. Invest. 98 (1996) 1602-1612; S. Kuerten et al., J. Neuroimmunol. 177 (2006) 99-111). B6 mice are weak responders to MBP (C. C. Bernard, J. Immunogenet. 3 (1976) 263-274; S. S. Zamvil et al, Nature 324 (1986) 258-260; R. B. Fritz and M. L. J. Neurosci. Res 5 (1996) 471-474), and due to the intracellular localization of MBP, the PLP-specific component of the MP4-induced antibody response should prevail if indeed MP4-induced antibodies contribute to the disease.
[0283] We established that B6 are susceptible to MP4-induced disease. Therefore, the MP4 model in WT versus congenic B cell KO mice provides a new system for studying the pathogenic role of MBP/PLP-specific antibodies. In our initial characterization testing B cell-deficient mice, we demonstrated that MP4-induced EAE was B cell-dependent. B cells can play various roles in the disease process. On the one hand, they could be useful as antigen presenting cells triggering the MBP-PLP-specific T cell response in MP4-immunized mice. On the other hand, MBP-PLP-specific antibodies could be involved in disease development. The experiments reported herein were designed to directly address the latter hypothesis. We showed that MBP/PLP-specific autoantibodies, when transferred into MP4-immunized B cell-deficient mice, can convert such mice from resistant to fully EAE susceptible. These data establish that MBP-PLP-specific antibodies do not only contribute to the disease, but are a significant component of MBP/PLP-induced EAE in B6 mice. The demonstration of a pathogenic role of MBP-PLP-specific antibodies in mice indicates that such antibodies can also play a role in human patients with MS.
[0284] Materials and Methods
[0285] Mice
[0286] Female B6 and B cell-deficient MT mice on a C57BL/6 background were purchased from the Jackson Laboratory (Bar Harbor, Me.), J.sub.HT mice were a kind gift from Ari Waisman (University of Mainz, Germany). All mice were 6-8 weeks old at the time of treatment. The mice were maintained at our local animal facilities under specific pathogen-free conditions. All treatments were performed according to an approved protocol and complied with the institutional guidelines.
Example 13: Immunizations
[0287] The MBP-PLP fusion protein MP4/Apogen (SEQ ID NO. 6; containing the 21.5 kD isoform of human MBP and the three hydrophilic domains of PLP) was obtained from Alexion Pharmaceuticals (Cheshire, Conn.). Incomplete Freund's adjuvant (IFA) was prepared as a mixture of Mannide Monooleate (Sigma-Aldrich, St. Louis, Mo.) and Paraffin Oil (EMScience, Gibbstown, N.J.), complete Freund's adjuvant (CFA) was obtained by mixing Mycobacterium tuberculosis H37 RA (Difco Laboratories, Franklin Lakes, N.J.) at 5 mg/ml into IFA. For active immunization, B6, MT or J.sub.HT mice were immunized subcutaneously in both sides of the flank with a total dose of 150 g MP4, 100 g MOG:35-55 or 200 g OVA in CFA. Control-immunized mice received PBS in CFA. Pertussis toxin (PTX; List Biological Laboratories, Hornby, ONT, Canada) was given at 200 ng per mouse on the day of immunization and 48 h later. For passive transfer experiments, the protocol of Lyons et al. (Eur. J. Immunol. 32 (2002) 1905-1913) was used with MT or J.sub.HT mice receiving four 150 l-injections of pooled antisera at 3-day intervals for a total of 600 l. The donor sera had been obtained from WT B6 mice 20, 30, 40 and 50 days after immunization with MP4, OVA or PBS in CFA. In addition, serum was obtained from nave WT B6 mice. The presence or absence of antigen-specific antibodies in the serum samples was confirmed by ELISA. Clinical assessment of EAE was performed daily according to the following criteria: (0), no disease; (1), floppy tail; (2), hind limb weakness; (3), full hind limb paralysis;
[0288] (4), quadriplegia; (5), death. Mice that were in between the clear-cut gradations of clinical signs were scored intermediate in increments of 0.5.
Example 14: MP4-Immunized B6 Mice Develop MP4-Specific IgG1 and IgG2a Antibodies
[0289] Because MP4-induced EAE was bound to be B cell-dependent, the question arose whether MP4-specific antibodies were present in the serum of MP4-immunized WT B6 mice. To this end, ELISAs were performed measuring MP4-specific IgG, IgG1 and IgG2a in MOG:35-55-immunized WT B6 and MP4-immunized WT B6 and MT mice. In MOG peptide-immunized mice there was only a slight elevation in MOG:35-55-specific antibody titers starting on day 32 after immunization (
[0290]
[0291] From
Example 15: MP4-Specific Antibodies Are Myelin-Reactive
[0292] In another study, we investigated whether the antibody responses from mice with EAE are specific for CNS antigen. We removed spinal cords from mice using standard methods. We then compared the staining of longitudinal sections of spinal cords from different strains of mice immunized with CNS antigens.
[0293]
[0294]
[0295] We tested whether WT B6 mice immunized with MP4 have antibody depositions in vivo and if such depositions are colocalized with demyelinated plaques. WT B6 mice (n=6) were either immunized with MOG peptide 35-55 or MP4 in CFA as above to develop EAE. Mice were sacrificed on day 40 after immunization, spinal cord sections obtained and stained with anti-mouse IgG to detect antibody depositions in the tissue. SMI-99 anti-MBP antibody was used to visualize myelin.
[0296]
Example 16: Serum From MP4-Immunized WT Mice Renders MP4-Immunized B Cell-Deficient Mice Susceptible To EAE
[0297] In a first set of experiments naive MT (
[0298] We herein demonstrated transfer of MP4-reactive serum restores disease susceptibility in B cell-deficient MP4-immunized mice. B cell-deficient MT (
[0299] As shown in
Example 17: Measurements of MP4-, MOG:35-55- and OVA-Specific Antibodies
[0300] ELISA plates (Nunc Immunoplate MaxiSorp; Fisher Scientific) were coated with 3 g/m1MP4, 10 g/ml MOG:35-55 or 3 g/ml ovalbumin (OVA) in bicarbonate buffer overnight at 4 C. The plates were blocked for 2 hours with phosphate-buffered saline (PBS), containing 0.05% Tween 20 (PBST) and 1% BSA at room temperature. Subsequently, serum samples diluted in PBST/BSA, were added to the plate for overnight incubation at 4 C. Secondary antibodies used were biotinylated rat anti-mouse IgG (eBioscience, San Diego, Calif.), IgG1 and IgG2a (BD-Pharmingen, San Jose, Calif.). Streptavidin-AP or Streptavidin-HRP served as tertiary reagents (DakoCytomation, Glostrup, Denmark), both diluted at 1:1000 in PBST/BSA. Plates were developed with 100 l/well of freshly prepared p-nitrophenylphosphate (p-NPP) solution (Sigma-Aldrich) or tetramethylbenzidine (TMB) (eBioscience).
Example 18: Immunohistochemistry
[0301] To analyze the myelin-reactivity of the serum samples 7 m thick longitudinal spinal cord sections from naive untreated B6 mice that had been perfused with 4% PFA were cut on a Reichert-Jung Cryocut CM1850 cryostat (Leica, Wetzlar, Germany). For the evaluation of antibody depositions MOG:35-55-immunized WT B6 or MP4-immunized B cell-deficient and WT B6 mice were perfused with 4% PFA on day 40 after immunization and 7 m thick longitudinal spinal cord sections were obtained. All sections were air-dried for 2 hours at room temperature and fixed in methanol at 20 C. for 10 min. Staining was performed with the M.O.M. basic kit (Vector Laboratories, Burlingame, Calif.), following the vendor's instructions. For the analysis of myelin-reactivity serum was diluted at 1:50. For the detection of antibody depositions biotinylated anti-mouse IgG (M.O.M. kit reagent) was left on the sections for overnight incubation at 4 C. SMI-99 anti-MBP antibody (Covance, Princeton, N.J.) was used for the detection of myelin at 1:1000 dilution. All sections were incubated with Neutravidin Dylight549 fluorescent dye (Thermo Fisher Scientific, Rockford, Ill.) and Hoechst as nuclear counterstain (Sigma-Aldrich). Sections were observed with a Zeiss Axioskop 50 epifluorescence microscope. For fluorescence detection the rhodamine filter (Nr. 15 of Carl Zeiss, excitation BP 546/12, beamsplitter FT 580, emission LP 590) and the ultraviolet filter (Nr, 1 of Carl Zeiss, excitation BP 365/12, emission LP 397) were used. Digital images were acquired using a slow scan CCD camera (Leica) and software. The acquisition software ImagePro Plus (Media Cybernetics, Silver Spring) was used for consecutive image analysis.
[0302] Statistics
[0303] Differences between groups were assessed by Student's t-test. In case the Normality Test or the Equal Variance Test failed, the Mann-Whitney U rank sum test was used (calculated by SigmaPlot, version 11.0). Statistical significance was set at p0.05. A summary of these studies is shown in Table 2 below.
TABLE-US-00003 TABLE 2 MP4-Specific Serum Restores Disease Susceptibility In EAE Mean Mean maximal Mouse Disease Mean day disease disease strain Treatment incidence of onset severity severity CNS pathology C57BL/6 none 11/11 9.4 1.9 1.7 0.4 2.6 0.9 severe inflammation, demyelination and axonal loss MT none 0/8 N/A N/A N/A none J.sub.HT 0/5 MT MP4 serum 0/2 N/A N/A N/A none J.sub.HT 0/2 MT MP4 serum + PTX 0/4 N/A N/A N/A none J.sub.HT 0/2 MT MP4 immunized + 3/3 11.8 0.4 2.7 0.8 2.8 0.3 severe inflammation, J.sub.HT MP4 serum + PTX 5/5 14.5 1.5 2.3 0.4 2.8 0.2 demyelination and axonal loss MT MP4 immunized + 0/6 N/A N/A N/A none OVA serum + PTX MT MP4 immunized + 0/6 N/A N/A N/A none serum from control-immunized mice + PTX MT MP4-immunized + 0/5 N/A N/A N/A none serum from naive mice + PTX
Example 19: Myelin-Specific Direct B Cell Antibody Responses in a Patient with Multiple Sclerosis
[0304] Using methods outlined herein, we obtained measurements of myelin-specific T cell responses and B cell/antibody responses in MS and CIS patients. In a preliminary study, we measured the production of IgG and IgM antibodies from PMBCs from a patient with MS and compared the results with those from a normal human subject without MS. We used a direct B-Cell assay of this invention, described herein above.
[0305]
[0306] In contrast, no MP4 responses were observed in PBMCs from healthy controls, either in the medium controls (
Example 20: Myelin-Specific Indirect B Cell Antibody Responses in a Patient with Multiple Sclerosis
[0307] Symptoms in multiple sclerosis are episodic in nature. At certain times, a patient with MS may be in remission (reduced or no symptoms), and at other times, symptoms may recur. The reasons for the episodic nature of symptoms in MS are poorly understood. One hypothesis is that memory B -cells may play a role. According to an hypothesis, during recurrent MS, CNS B cells respond by producing antibodies directed at CNS antigens (e.g., myelin proteins), which trigger symptoms. When symptoms resolve, the patient is in remission. Prior to this invention the mechanism of recurrence was poorly understood. We have found that B cells capable of producing antibodies against CNS antigens may reside for relatively long periods of time in lymphoid or other tissues outside the CNS, in a relatively quiescent state. Recurrence of symptoms may be associated with reactivation of such quiescent B cells, termed Memory B-Cells.
[0308] To evaluate this hypothesis, we devised an ELISPOT test for memory B Cells (the Indirect B Cell assay or Memory B Cell assay) described below in Examples 21 and 22. We herein report a new assay to detect memory B cells that may be responsible for recurrence of symptoms in MS.
[0309] To do this, we retrieved PBMCs from MS patients in remission. After isolating the PBMCs, we cultured them in cell culture wells as described herein above. We then exposed the PBMCs to medium or a stimulating agent (polyclonal stimulation), and determined the presence of antibodies against human MOG (hMOG).
[0310]
[0311] In another study, we used human brain lysate to stimulate B cell responses. Results of this study are shown in
[0312]
[0313] We conclude from these studies that in MS patients with no symptoms, that memory B cells are present in MS patients and can be activated by stimulation.
Example 21: Antigen-Specific B Cell Test
[0314] In some embodiments of this invention, an antigen-specific B cell test can be used.
[0315]
Example 22: Direct B Cell Assay
[0316] In certain embodiments of this invention, a direct B cell assay can be used to detect the presence of B cells capable of producing antibodies against CNS-specific antigens.
[0317]
[0318]
Example 23: Myelin-Specific B Cell Responses in Patients with MS, CIS, and Healthy Subjects I
[0319] To study the prevalence of myelin-specific B-cell responses in human beings, we carried out a preliminary study of 21 healthy subjects without MS, 10 patients with MS, and 3 patients having Clinically Isolated Syndrome (CIS). Results of this preliminary study are shown below in Table 3.
TABLE-US-00004 TABLE 3 Prevalence of Myelin-Specific B Cells Number of Patients Exhibiting a Subject Category Myelin-Specific B-Cell Response Healthy 0/21 Multiple Sclerosis (MS) 10/10 Clinically Isolated 1/3 Syndrome (CIS) Unresponsive to Immune 0/1 Modulatory Treatment
[0320] We conclude from this preliminary study that myelin-specific B cell responses are completely absent in the control subjects, are prevalent in all 10 patients with MS, and occur (1 out of 3) in the patients with CIS.
Example 24: Direct B Cell and Indirect B Cells in Healthy Subjects without MS II
[0321] To be able to determine the usefulness of the Direct B Cell test and the Indirect B Cell tests of this invention, we first studied a series of healthy human subjects without MS. We assessed: (1) disease stage, (2) disease activity, (3) serum antibodies, (4) Th-1 cells (T.sub.H1), Th-17 cells (T.sub.H17), (5) Direct B cell test data, and (6) indirect B cell test data. Results are shown below in
[0322] The cut-off values for the myelin-specific serum antibody titers and the T.sub.H1 and T.sub.H17 response have been calculated by testing a total of 71 healthy controls. These cut-off values are highlighted in grey and have been calculated according to the formula [mean value2*standard deviation]. None of the healthy controls tested showed a positive response in either the Direct or Indirect B cell test. Any positive responses in the Direct or Indirect B cell test observed in the MS patients or in patients at risk of developing MS are therefore indicative of the disease.
[0323] The inclusion criteria for healthy controls were an age over 18, female or male gender, informed consent, and no previous history of neuroimmunological or autoimmune disorders. The exclusion criteria were the intake of cytokine or anti-cytokine drugs, intravenous immunoglobulins, plasmapheresis or the intake of non-approved drugs 12 months prior to inclusion in the study. In addition, severe systemic or psychiatric disorders were considered as exclusion criteria.
[0324] As can be seen from
Example 25: Clinically-Isolated Syndrome (CIS)
[0325] We then studied a series of 12 patients with CIS and measured: (1) disease stage, (2) disease activity, (3) serum antibodies, (4) T.sub.H1 cells, (5) T.sub.H17 cells, (6) Direct B Cell test, and (7) Indirect Be Cell test. Results are shown below in
[0326] The cut-off values for a positive response were calculated as mean values 2 SD of a total of 71 healthy controls tested. Positive test results are highlighted in grey. As can be seen in
[0327] Summary of Results and Conclusions
[0328] 10 of 12 patients tested showed at least one positive test response. For one of the non-responders it has been shown that this donor suffers from cervical myelitis rather than MS (BII121111). Donor SI1250212 presented with NMO only, the MRI revealed rather unspecific lesions, not typical of MS. Thus, 10 of 10 patients with CIS exhibited at least one of a positive serum antibody test, a positive TH17 test or a positive indirect B cell test.
[0329] Repeated testing proved to be important. Some of the CIS patients were negative upon initial testing, but converted with time (repeated testing after 3 months). This corresponds to the idea that at this early stage of the disease the initial wave of autoimmune responses that caused the clinical symptoms had ceased and only with time the second and full-blown response develops.
[0330] The initial immune response showed inter-individual heterogeneity being characterized by T cell or B cell immunity or a combination of both. We conclude that diagnosis of CIS is highly accurate, with no false negative results.
Example 26: Patients with Remitting Relapsing MS
[0331] In a series of 11 patients with clinically definite MS, we determined: (1) disease stage, (2) disease activity, (3) serum antibodies, (4) T.sub.H1 cells, (5) T.sub.H17 cells, (6) direct B cell test, and (7) indirect B cell test. Results are shown in
[0332]
[0333] Results and Conclusions
[0334] The cut-off values for a positive response were calculated as mean values 2 SD of a total of 71 healthy controls tested. Positive test results are highlighted in grey.
[0335] All eleven patients show positive test results Definite MS is characterized by the presence of a memory B cell response. We conclude that diagnosis of RRMS using methods of this invention is highly accurate, showing no false negative results. Thus, these patients can benefit from immune modulatory therapy to decrease B cells.
Example 27: Patients with Clinically Definite MS with Secondary Progressive or Chronic Disease
[0336] In 12 patients with MS and secondary progressive or chronic disease, we determined: (1) disease stage, (2) disease activity, (3) serum antibodies, (4) T.sub.H1 cells, (5) T.sub.H17 cells, (6) direct B cell test, and (7) indirect B cell test. Results are shown below in
[0337] In 12 patients with chronic non-active MS, one had elevated serum CNS-specific antibodies, and one had elevated T.sub.H1 cells. All 12 patients had negative direct B cell test results, and 5 of 12 patients had positive indirect B cell test results.
[0338] The cut-off values for a positive response were calculated as mean values 2 SD of a total of 71 healthy subjects. Positive test results are highlighted in grey.
[0339] Primary Progressive MS (PPMS) is characterized by a gradual progression of the disease from its onset with no superimposed relapses and remissions. There may be periods of a leveling off of disease activity. PPMS differs from RRMS and SPMS in that the onset is typically in the late thirties or early forties, men are as likely women to develop it and initial disease activity is often in the spinal cord and not in the brain. Primary Progressive MS often migrates into the brain, but is less likely to damage brain areas compared to RRMS and SPMS. For example, people with PPMS are less likely to develop cognitive deficits. PPMS is the subtype of MS that is least likely to show inflammatory (gadolinium enhancing) lesions on MRI scans. The primary progressive form of the disease affects between 10 and 15% of all people with multiple sclerosis.
[0340] Results and Conclusions
[0341] Clinical progression into chronic MS is characterized by an attenuation of the autoimmune component of the disease in favor of primary neurodegeneration. The tests of this invention correctly identified 7 of 12 patients with CDMS, and 5 patients showed false negative results.
[0342] The test identifies those patients with SP-MS/chronic MS that will still benefit from immune modulatory treatment in the chronic stage of the disease. In particular, those patients with positive indirect B cell test results or elevated serum CNS-specific antibodies can be beneficially treated with immune modulatory treatments. For patients with a negative indirect B cell test, a negative serum antibody test, and a negative T.sub.H1/T.sub.H17 test, immune modulatory therapy may not be indicated, whereas use of anti-neurodegenerative therapies are indicated.
Example 28: The Triple Test for Diagnosis and Prediction of MS
[0343] Introduction
[0344] This Example describes an embodiment of this invention in which three immunological tests are made that provides improved ability to diagnose and predict prognosis in patients with MS. The three tests measure: (1) CNS-specific antibodies (e.g., against MP4 or whole human brain lysate), (2) CNS-specific T.sub.H1 and T.sub.H17 cells using ELISPOT methods (e.g., antigens MP4, hMOG, whole human brain lysate), and (3) CNS-specific B cells using ELISPOT (e.g., antigens MP4, hMOG, whole human brain lysate).
[0345] ELISA Methods
[0346] 1. Cell culture wells are coated with antigen (MP4 or whole human CNS lysate).
[0347] 2. Plates are blocked with 10 fetal bovine serum to prevent non-specific binding.
[0348] 3. Serum dilutions 1:40 in 10% fetal bovine serum.
[0349] 4. Plates are developed with TMB, stopped after 2 minutes with H.sub.2SO.sub.4 and optical density (OD) is read at 450 nm.
[0350] 5. Cut-off value for a positive ELISA response is considered to be OD>MW+2 SD of the healthy controls tested.
[0351] ELISPOT Methods for Measurement of T.sub.H1 and T.sub.H17 Cells
[0352] 1. ELISPOT methods are carried out using standard methods.
[0353] 2. The protocol is modified to provide an incubation time of 72 hours.
[0354] 3. 310.sup.5 PBMCs are plated per well (e.g., of a 96 well plate).
[0355] 4. The number of spots is counted per well.
[0356] 5. Cut-off value for a positive T.sub.H1 response is the spot number>MW+2 SD of the healthy control subjects tested.
[0357] 6. Cut-off value for a positive T.sub.H17 response is the spot number>MW+2 SD of the healthy controls tested.
[0358] ELISPOT Methods for Measurement of B Cells
[0359] 1. Cell culture wells are coated with antigen (e.g., MP4, hMOG or whole human brain lystate).
[0360] 2. 10.sup.6 PBMCs are plated per well.
[0361] 3. Direct measurements of IgG and IgM before and after:
[0362] 4. Polyclonal stimulation with R-848, IL-2 and -mercaptoethanol for 72 hours.
[0363] 5. Positive response is considered by presence of plasma cells or B cells secreting MP4 and/or hMOG and/or whole human CNS lysate-specific antibodies.
[0364] 6. Cut-off value for a positive B cell response is the spot number>MW+2 SD of the healthy controls tested.
[0365] Study Populations
[0366] 1. 71 healthy subjects without MS were studied for determination of baseline data;
[0367] 2. 12 patients with clinically isolated syndrome (CIS);
[0368] 3. 11 patients with relapsing remitting MS (RRMS); and
[0369] 4. 12 patients with SP-MS secondary progressive MS (SP-MS)/incomplete remissions/chronic MS.
[0370] Advantages
[0371] Based on the Examples above, the Triple Test provides a highly sensitive and specific method for diagnosing MS combining detection of autoimmune T cells, B cells, and serum antibodies against CNS antigens. Further, the Triple Test facilitates identification of subpopulations of patients depending on the T cell, B cell and antibody response patterns. The Triple Test facilitates development of therapeutic strategies differentially targeting T cells and B cells. The Test also can identify patients in whom a B cell or T cell-specific strategy will not be successful, thereby eliminating the costs and hazards associated with ineffective therapeutic interventions. The Triple Test reveals disease-specific kinetics of autoimmune responses and demonstrates that myelin-specific autoimmune responses increasingly develop as patients progress from a CIS/RIS state to definite, fully blown MS while decreasing when patients enter the SP-MS/chronic MS stage. The Tests of this invention permit the identification of optimal therapeutic windows for immune modulatory treatment. Finally, the Triple Test has demonstrated the diagnostic value of B cell measurements, in addition to T cell measurements.
Example 29: CNS Antigen-Specific T Cell and B Cell/Antibody Responses as Predictors for the Treatment of Multiple Sclerosis
[0372] Multiple sclerosis is a chronic autoimmune disease of the central nervous system. The etiology and pathogenesis of the disease remain unclear, but based on the disclosures herein, myelin-reactive T cells and B cells/antibodies play a crucial role. In addition, environmental factors, including infectious agents, are suggested to facilitate the invasion of auto-reactive immune cells into the CNS by crossing the blood-brain barrier (BBB). The transmigration of cells and soluble molecules such as antibodies through the BBB requires several steps including the breakdown of the barrier by proteases and the activation of the endothelial cells that form the barrier. Having entered the CNS, auto-reactive T cells recognize self-antigen and start producing cytokines. The nature of the cytokines secreted (pro- or anti-inflammatory) depends on the interaction between the T cells and antigen-presenting cells and other interacting molecules. In addition, B cells get activated, differentiate into plasma cells and start secreting autoantibodies. Finally, also cells from the innate immune system are drawn into the inflammatory reaction. Acute inflammatory, demyelinating plaques occur due to the binding of autoantibodies to myelin, activation of the complement system and phagocytosis of myelin by macrophages. Also, cytotoxic T cells and pro-inflammatory cytokines can directly damage CNS tissue.
[0373] The treatment options for MS aim at targeting this autoimmune component of the disease. Acute relapses are commonly treated with a short duration of high-dose oral or intravenous corticosteroids. Typically, treatment with high-dose corticosteroids is only initiated when a patient presents with an acute clinical event, a relapse. The problem with each new clinical event is that there is the possibility that irreversible CNS damage and with that irreversible functional deficits/symptoms will occur in a patient. However, thus far there is no diagnostic-prognostic test that can reliably predict whether and when a relapse is likely to occur. Measurements of the CNS antigen-/myelin-specific T and/or B cell/antibody response are suitable to predict an upcoming relapse before clinical symptoms have developed in a given patient. This has important therapeutic implications for the patient. According to our claim, the detection of an increased CNS antigen-/myelin-specific T and/or B cell/antibody response precedes the development of a disease relapse. The early initiation of treatment before the onset of (new) clinical symptoms is likely to prevent the development of the upcoming relapse, thus also preventing the development of irreversible CNS damage. Early treatment, according to the currently accepted regimen, can include corticosteroids, but also other treatment options, such as disease-modifying drugs, that prove to be effective in the prevention of relapses.
[0374] Besides acute treatment with corticosteroids, disease-modifying/immune modulatory drugs are available, that are designed to prevent relapses and progression of disability rather than treat specific symptoms or exacerbations of the disease. These agents modify the immune response through various immunomodulatory or immunosuppressive effects. The currently approved disease-modifying drugs include glatiramer acetate, interferon beta-1a, mitoxantrone, tysabri and fingolimod. The indication and mechanisms of action of each drug are summarized in Table 4.
TABLE-US-00005 TABLE 4 Current MS Therapies Drug Indication Patients targeted Glatiramer Acetate Reduce frequency of relapses in patients with RRMS CIS, RRMS Copaxone including patients who experienced a first clinical episode and have MRI features consistent with MS. Interferon beta-1a Treatment of patients with relapsing forms of MS to CIS, RRMS, SPMS Avonex, slow accumulation of physical disability and decrease Avonex PS the frequency of clinical exacerbations. Effective in patients who experienced a first clinical episode and have MRI features consistent with MS. Interferon beta-1a Treatment of relapsing forms of MS to decrease the See above Rebif frequency of clinical exacerbations and delay the accumulation of physical disability. Inteferon beta-1b Treatment of relapsing forms of MS to reduce the See above Betaseron frequency of clinical exacerbations. Effective in patients who experienced a first clinical episode and have MRI features consistent with MS. Interferon beta-1b Treatment of relapsing forms of MS to reduce the See above Extavia frequency of clinical exacerbations. Effective in patients who experienced a first clinical episode and have MRI features consistent with MS. Mitoxantrone Reduce neurologic disability and/or the frequency of RRMS, SPMS, (Novantrone clinical relapses in SPMS, PPMS or worsening RRMS. PPMS Ralenova) cyclophosphamide (Endoxan), azathioprine (Imurek) Natalizumab Treatment of relapsing forms of MS to delay the CIS, RRMS Tysabri accumulation of physical disability and reduce the frequency of clinical exacerabations. FTY720 Fingolimod Treatment of relapsing forms of MS in order to reduce CIS, RRMS Gilenya and the frequency of clinical exacerbations and to delay the BAF312 progression of disability. Immunoglobulins IVIG is used in MS to slow progression of disease, CIS, RMA, SPMS, (IVIGs) reduce the number of and limit disability and MS PPMS Gamunex symptoms Octagam B Cell-specific Treatment of B cell dependent MS; reduce frequency CIS, RRMS, therapies: of clinical exacerbations and delay progression of SPMS, potentially Rituximab, disability. Depletes CD20 or CD22 lymphocytes or PPMS ocrelizumab, block interaction of cell survival and growth factors ofatimumab, with their receptors on B cells. belimumab atacicept, epratuzumab MLN1202 Treatment of relapsing forms of MS to delay CIS, RRMS, accumulation of physical disability and reduce SPM < frequency of clinical exacerbations. Inhibits nerve potentiall PPMS fiber degeneration (demyelination, axonal degeneration and neuronal damage by inhibiting apoptosis, glutamate toxicity and increase in trophic factors. GABAA receptor Reduce neurological disability and/or frequency of CIS, RRMS, SPMS antagonists clinical relapses in SPMS, PPMS and RRMS. PPMS Trophic factors including CNTF, IGF-1, VEGF, GDNF, FGF, Anti-protein aggregation agents, Calcium antagonists Minocycline, Acamprosate Creatine, nimodipine CGP77116 Treatment of relapsing form of MS to delay CIS, RRMS, accumulation of physical disability and reduce SPMS, potentially frequency of clinical exacerbations. Altered peptide PPMS ligand/mimetope for a dominant antigenic determinant of MBP (83-99). Decreases MBP-specific response by competing with native MBP. Vitamin D3 Treatment of B cell dependent MS, reduces frequency CIS, RRMS, of clinical exacerbations and delay progression of SPMS, PPMS disability. Vitamin D reduces B cell proliferative responses, reduces antibody secretion and class switching, inhibits maturation into memory and plasma phenotypes and induces apoptosis, but does not modulate expression of HLA-DR or co-receptors. Neuroprotective Reduce neurological disability and/or frequency of CIS, RRMS, agents clinical relapses in SPM, PPMS and RMS. Inhibits SPMS, PPMS (anti-apoptotic) nerve fiber degeneration (demyelination, axonal caspase inhibitors damage) and neuronal damage. antioxidants, glutamate toxicity blocking agents, glutamate receptor antagonists, NMDA receptor antagonists
[0375] The majority of patients with MS are typically on immune modulatory treatment. However, it should be noted that not every patient responds to immune modulatory treatment and response rates can differ significantly and also decline over time in different patient populations. Also, serious side effects can occur.
[0376] Embodiments of this invention for diagnostic and/or prognostic tests for MS can facilitate the development of more efficient treatment strategies that also lead to higher patient compliance. In fact, in some cases, it can be an effective strategy to initiate immune modulatory treatment only when an increased CNS antigen-specific T cell and/or B cell antibody response is evident,
[0377] Our invention enables this approach. Previous to this disclosure, there has been no means of measuring or predicting the responsiveness of individual patients to immune modulatory treatment. By measuring the magnitude of the CNS antigen- or myelin-specific T cells and/or B cell antibody responses, such a prediction can be clinically useful. In simple terms, immune modulatory treatment means that the auto-reactive immune response in a patient is modulated in a way that makes it less likely that self-tissue is targeted and destroyed. The autoimmune component of the disease may be more or less relevant to the actual disease pathogenesis in individual patients and patients have been described to show CNS histopathology that is more dominated by primary oligodendrocyte loss, for example. In such patients, immune modulatory treatment due to its very nature is less likely to be effective compared to patients with a prevalent T cell responses or B cell antibody responses contributing to the disease. Our methods can therefore distinguish different patient populations based on their predicted responsiveness to treatment. By detecting patients, in whom a CNS-/myelin-reactive pathology is not prevalent, as shown by a decreased/absent responsiveness to immune modulatory treatment, our approach enables better treatment of low- or non-responder patients.
[0378] Finally, opinions about the treatment strategy for patients with clinically isolated syndrome (CIS) or radiologically isolated syndrome (RIS) differ. While patients are treated with corticosteroids during the acute disease, it is unclear whether these patients will show long-term benefit from an early initiation of immune modulatory treatment. A significant problem here is that currently there is no diagnostic and/or prognostic test that defines whether a patient with CIS or RIS will eventually develop MS. Therefore, most patients do not see any reason why they should start treatment without even knowing whether they will finally develop MS. Even if the initial brain MRI is abnormal (with a demyelinating lesion), the likelihood of developing MS is only 60 percent. If the initial brain MRI is normal (no demyelinating lesion), there is still a likelihood of 20 percent of developing MS. By measuring whether a CNS antigen-or myelin-specific T cells and/or B cell antibody responses are present in a patient with CIS or RIS, embodiments of this invention allow one to distinguish patients that will develop MS from those patients that are not likely to develop MS. Thus, methods of this invention can have important therapeutic implications because CIS or RIS patients with a positive response in our test can greatly benefit from early initiation of immune modulatory treatment, including use of anti-CD20, CD21, CD22, and other B cell modulatory agents, while patients with a negative response are not likely to benefit from such therapies.
Example 30: Preparation of Purified Detection Particles Labeled with Streptavidin and Biotinylated Detection Antibodies
[0379] In some embodiments, this a bead array method includes use of detection particles having detection reagents thereon. An embodiment of this method is illustrated in
Example 31: Two Color Assay for Human IL2 and Human Interferon
[0380] On day 1 plates (MIP45, Millipore) were coated simultaneously with two primary capture monoclonal antibodies (mAbs), one raised against (1) h-IFN- Endogen MA700A) at a concentration of 4 g/ml and another raised against h-IL-2 (R&D Systems 5334.21) at a concentration of 3 g/ml. 200 l of coating mAbs mixture was added per well. Plates were coated overnight at 4 C.
[0381] On day 2 the plates were washed 3 times with PBS (200 l/well), and blocked with 1%BSA in PBS for 2 h at RT (200 l/well). PPD antigen was added to the well at concentration 100 g/ml (100 l/well). 300.000 human unseparated PBMCs were added to the same wells (100 l/well). Plates were incubated for 24 h at 37 C., humidified, in the presence of 7% CO.sub.2.
[0382] On day 3 cells and unbound materials were removed from the wells by washing 3 times with PBS and 3 times with PBS-Tween (0.05%). Then plate was incubated overnight at 4 C. with 100 l per well of detection particles directly labeled with secondary detection reagents being antibodies. Red dots (655 nm) were labeled with anti h-IFN- Endogen M701) and used at a concentration 5.010.sup.9 M. Green dots (525 nm) were labeled with h-IL-2 mAbs (Endogen BG5) and used at a concentration of 1.010.sup.8 M.
[0383] On day 4 unbound detection particles were washed out 4 times with PBS-Tween (0.05%) and 3 times with PBS. Digital images were taken using a Fluorescent microscope (Optem) with a longpath emission filter (Chroma 32013).
[0384] A photomicrograph
REFERENCES
[0385] Each of the patents, patent applications and non-patent documents disclosed herein are incorporated in their entirety, as if separately so incorporated.
J. Goverman, T. Brabb, Rodent models of experimental allergic encephalomyelitis applied to the study of multiple sclerosis, Lab. Anim Sci. 46 (1996) 482-492.
M. Sospedra, R. Martin, Immunology of multiple sclerosis, Annu. Rev. Immunol. 23 (2005) 683-747.
L. Steinman, S. S Zamvil, How to successfully apply animal studies in experimental allergic encephalomyelitis to research on multiple sclerosis, Ann. Neurol. 60 (2006) 12-21.
R. Gold, C. Linington, H. Lassmann, Understanding pathogenesis and therapy of multiple sclerosis via animal models: 70 years of merits and culprits in experimental autoimmune encephalomyelitis research, Brain 129 (2006) 1953-1971.
V. K. Tuohy, Z. Lu, R. A. Sobel, R. A. Laursen, M. B. Lees, Identification of an encephalitogenic determinant of myelin proteolipid protein for SJL mice, J. Immunol. 142 (1989) 1523-1527.
R. A. Sobel, V. K. Tuohy, Z. J. Lu, R. A. Laursen, M. B. Lees, Acute experimental allergic encephalomyelitis in SJL/J mice induced by a synthetic peptide of myelin proteolipid protein, J. Neuropathol. Exp. Neurol. 49 (1990) 468-479.
I. Mendel, N. K. de Rosbo, A. Ben Nun, A myelin oligodendrocyte glycoprotein peptide induces typical chronic experimental autoimmune encephalomyelitis in H-2b mice: fine specificity and T cell receptor V beta expression of encephalitogenic T cells, Eur. J. Immunol. 25 (1995) 1951-1959.
I. Mendel, N. K. de Rosbo, A. Ben Nun, Delineation of the minimal encephalitogenic epitope within the immunodominant region of myelin oligodendrocyte glycoprotein: diverse V beta usage by T cells recognizing the core epitope encephalitogenic for T cell receptor V beta b and T cell receptor V beta in H-2b mice, Eur. J. Immunol. 26 (1996) 2470-2479.
N. T. Potter, T. S. Stephens, Humoral immune recognition of proteolipid protein (PLP)-specific epitopes in the SJL/J mouse, J. Neurosci. Res. 37 (1994) 15-22.
B. L. McRae, S. D. Miller, Fine specificity of CD4+ T cell responses to the dominant encephalitogenic PLP 139-151 peptide in SJL/J mice, Neurochem. Res. 19 (1994) 997-1004.
P. Hjelmstrom, A. E. Juedes, J. Fjell, N. H. Ruddle, B-cell deficient mice develop experimental autoimmune encephalomyelitis with demyelination after myelin oligodendrocyte glycoprotein sensitization, J. Immunol. 161 (1998) 4480-4483.
A. R. Oliver, G. M. Lyon, N. H. Ruddle, Rat and human myelin oligodendrocyte glycoproteins induce experimental autoimmune encephalomyelitis by different mechanisms in C57BL/6 mice, J. Immunol. 171 (2003) 462-468.
J. E. Merrill, D. H. Kono, J. Clayton, D. G. Ando, D. R. Hinton, F. M. Hofman, Inflammatory leukocytes and cytokines in the peptide-induced disease of experimental allergic encephalomyelitis in SJL and B10.PL mice, Proc. Natl. Acad. Sci. U S A 89 (1992) 574-578.
V. Navikas, H. Link, Review: Cytokines and the pathogenesis of multiple sclerosis, J. Neurosci. Res. 45 (1996) 322-333.
H. H. Hofstetter, A. Y. Karulin, T. G. Forsthuber, P. A. Ott, M. Tary-Lehmann, P. V. Lehmann, The cytokine signature of MOG-specific CD4 cells in the EAE of C57BL/6 mice, J. Neuroimmunol. 170 (2005) 105-114.
H. H. Hofstetter, T. G. Forsthuber, Kinetics of IL-17- and interferon-gamma producing PLPp-specific CD4 T cells in EAE induced by coinjection of PLP/IFA with pertussis toxin in SJL mice, Neurosci. Lett. 476 (2010) 150-155.
H. H. Hofstetter, S. M. Ibrahim, D. Koczan, N. Kruse, A. Weishaupt, K. V. Toyka, R. Gold, Therapeutic efficacy of IL-17 neutralization in murine experimental autoimmune encephalomyelitis, Cell. Immunol. 237 (2005) 123-130.
I. I. Ivanov, B. S. McKenzie, L. Zhou, C. E. Tadokoro, A. Lepelley, J. J. Lafaille, D. J. Cua, D. R. Littman, The orphan nuclear receptor RORgammat directs the differentiation program of proinflammatory IL-17+ T helper cells, Cell 126 (2006) 1121-33.
Y. Komiyama, S. Nakae, T. Matsuki, A. Nambu, H. Ishigame, S. Kakuta, K. Sudo, Y. Iwakura, IL-17 plays an important role in the development of experimental autoimmune encephalomyelitis. J. Immunol. 177 (2006) 566-73.
H. H. Hofstetter, O. S. Targoni, A. Y. Karulin, T. G. Forsthuber, M. Tary-Lehmann, P. V. Lehmann, Does the frequency and the avidity spectrum of the neuroantigen-specific T cells in the blood mirror the autoimmune process in the central nervous system of mice undergoing experimental allergic encephalomyelitis?, J. Immunol. 174 (2005) 4598-4605.
S. Kuerten, D. A. Kostova-Bales, L. P. Frenzel, J. T. Tigno, M. Tary-Lehmann, D. N. Angelov, P. V. Lehmann, MP4- and MOG:35-55-induced EAE in C57BL/6 mice differentially targets brain, spinal cord and cerebellum, J. Neuroimmunol. 189 (2007) 31-40.
D. J. Mahad, J. Lawry, S. J. L. Howell, M. N. Woodroofe, Longitudinal study of chemokine receptor expression on peripheral lymphocytes in multiple sclerosis: CXCR3 upregulation is associated with relapse, Mult. Scler. 9 (2003) 189-198.
B. Bielekova, R. Martin, Development of biomarkers in multiple sclerosis. Brain 127 (2004) 1463-1478.
L. Rinaldi, P. Gallo, Immunological markers in multiple sclerosis: tackling the missing elements, Neurol. Sci. 26 (2005) S215-S217.
M. Reindl, M. Khalil, T. Berger, Antibodies as biological markers for pathophysiological processes in multiple sclerosis, J. Neuroimmunol. 180 (2006) 50-62.
A. Lutterotti, T. Berger, M. Reindl, Biological markers for multiple sclerosis. Curr. Med. Chem. 14 (2007) 1956-1965.
R. J. Fox, P. Kivisakk, E. Fisher, B. Tucky, J. C. Lee, R. A. Rudick, R. M. Ransohoff, Multiple sclerosis: chemokine receptor expression on circulating lymphocytes in correlation with radiographic measures of tissue injury. Mult. Scler. 14 (2008) 1036-1043.
J. Drulovic, E. Savic, T. Pekmezovic, S. Mesaros, N. Stosjavljevic, I. Dujmovic-Basuroski, I., J. Kostic, V. Vasic, M. Mostarica Stojkovic, D. Popadic, Expression of T.sub.H1 and T.sub.H17 cytokines and transcription factors in multiple sclerosis patients: Does baseline T-Bet mRNA predict the response to interferon-beta treatment?, J. Neuroimmunol. 215 (2009) 90-95.
S. Sawai, H. Umemura, M. Mori, M. Satoh, S. Hayakawa, Y. Kodera, T. Tomonaga, S. Kuwabara, F. Nomura, Serum levels of complement C4 fragments correlate with disease activity in multiple sclerosis: Proteomic analysis, J. Neuroimmunol. 218 (2010) 112-115.
C. M. Pelfrey, R. A. Rudick, A. C. Cotleur, J. C. Lee, M. Tary-Lehmann, P. V. Lehmann, Quantification of self-recognition in multiple sclerosis by single-cell analysis of cytokine production, J. Immunol. 165 (2000) 1641-1651.
R. Hohlfeld, H. Wekerle, Autoimmune concepts of multiple sclerosis as a basis for selective immunotherapy: from pipe dreams to (therapeutic) pipelines, Proc. Natl. Acad. Sci. U S A 101 (2004) 14599-14606.
P. V. Lehmann, T. Forsthuber, A. Miller, E. E. Sercarz, Spreading of T-cell autoimmunity to cryptic determinants of an autoantigen. Nature 358 (1992) 155-157.
B. L. McRae, C. L. Vanderlugt, M. C. Dal Canto, S. D. Miller, Functional evidence for epitope spreading in the relapsing pathology of experimental autoimmune encephalomyelitis, J. Exp. Med. 182 (1995) 75-85.
C. L. Vanderlugt, W. S. Begolka, K. L. Neville, Y. Katz-Lewy, L. M. Howard, T. N. Eagar, J. A. Bluestone, S. D. Miller, The functional significance of epitope spreading and its regulation by co-stimulatory molecules, Immunol. Rev. 164 (1998) 63-72.
C. L. Vanderlugt, K. L. Neville, K. M. Nikcevich, T. N. Eagar, J. A. Bluestone, S. D. Miller, Pathologic role and temporal appearance of newly emerging autoepitopes in relapsing remitting experimental autoimmune encephalomyelitis, J. Immunol. 164 (2000) 670-678.
V. K. Tuohy, M. Yu, L. Yin, J. A. Kawczak, J. M. Johnson, P. M. Mathisen, B. Weinstock-Guttman, R. P. Kinkel, The epitope spreading cascade during progression of experimental autoimmune encephalomyelitis and multiple sclerosis, Immunol. Rev. 164 (1998) 93-100.
W. S. Begolka, C. L. Vanderlugt, S. M. Rahbe, S. D. Miller, Differential expression of inflammatory cytokines parallels progression of central nervous system pathology in two clinically distinct models of multiple sclerosis, J. Immunol. 161 (1998) 4437-4446.
T. M. Pribyl, C. W. Campagnoni, K. Kampf, T. Kashima, V. W. Handley, J. McMahon, A. T. Campagnoni, The human myelin basic protein gene is included within a 179-kilobase transcription unit: expression in the immune and central nervous systems, Proc. Natl. Acad. Sci. U S A 90 (1993) 10695-10699.
T. M. Pribyl, C. Campagnoni, K Kampf, V. W. Handley, A. T. Campagnoni, The major myelin protein genes are expressed in the human thymus, J. Neurosci. Res. 45 (1996) 812-819.
R. B. Fritz, I. Kalvakolanu, Thymic expression of the golli-myelin basic protein gene in the SJL/J mouse, J. Neuroimmunol. 57 (1995) 93-99.
N. Kawakami, S. Lassmann, Z. Li, F. Odoardi, T. Ritter, T. Ziemssen, W. E. Klinkert, J. W. Ellwart, M. Bradl, K. Krivacic, H. Lassmann, R. M. Ransohoff, H. D. Volk, H. Wekerle, C. Linington, A. Flgel, The activation status of neuroantigen-specific T cells in the target organ determines the clinical outcome of autoimmune encephalomyelitis, J. Exp. Med. 1999 (2004) 185-197.
A. L. Astier, G. Meiffren, S. Freeman, D. A. Hafler, Alterations in CD46-mediated Tr1 regulatory T cells in patients with multiple sclerosis, J. Clin. Invest. 116 (2006) 3252-3257.
A. L. Zozulya, H. Wiendl, The role of regulatory T cells in multiple sclerosis, Nat. Clin. Pract. Neurol. 4 (2008) 384-398.
A. Ma, Z. Xiong, Y. Hu, S. Qi, L. Song, H. Dun, L. Zhang, D. Lou, P. Yang, Z. Zhao, X. Wang, D. Zhang, P. Daloze, H. Chen, Dysfunction of IL-10-producing type 1 regulatory T cells and CD4(+)CD25(+) regulatory T cells in a mimic model of human multiple sclerosis in Cynomolgus monkey, Int. Immunopharmacol. 9 (2009) 599-608.
I. M. Stromnes, J. M. Goverman, Passive induction of experimental allergic encephalomyelitis, Nat. Prot. 1 (2006) 1952-1960.
G. Shi, C. A. Cox, B. P. Vistica, E. F. Wawrousek, I. Gery, Phenotype switching by inflammation-inducing polarized Th17 cells, but not by Th1 cells. J. Immunol. 181 (2008) 7205-7213.
E. A. Kabat, A. Wolf, A. E. Bezer, Experimental studies on acute disseminated encephalomyelitis in rhesus monkeys, Res. Publ. Assoc. Res. Ner. Ment. Dis. 28 (1950) 113-132.
J. Freund, M. M. Lipton, L.R. Morrison, Demyelination in the guinea pig in chronic allergic encephalomyelitis produced by injecting guinea pig brain in oil emulsion containing a variant of Mycobacterium butyricum, Arch. Pathol. (Chic.) 50 (1950) 108-121.
S. Levine, R. Sowinski, Experimental allergic encephalomyelitis in inbred and outbred mice, J. Immunol. 110 (1973) 139-143.
S. H. Appel, M. B. Bornstein, The application of tissue culture to the study of experimental allergic encephalomyelitis. II. Serum factors responsible for demyelination, J. Exp. Med. 119 (1964) 303-312.
D. O. Willenborg, Transfer of lesions of allergic encephalomyelitis in sheep with cell-free lymph from animals sensitized with homologous spinal cord plus adjuvant, Scand. J. Immunol. 16 (1982) 437-441.
C. B. Marta, A. R. Oliver, R. A. Sweet, S. E. Pfeiffer, N. H. Ruddle, Pathogenic myelin oligodendrocyte glycoprotein antibodies recognize glycosylated epitopes and perturb oligodendrocyte physiology, Proc. Natl. Acad. Sci. USA 102 (2005) 13992-13997.
J. A. Lyons, M. J. Ramsbottom, A. H. Cross, Critical role of antigen-specific antibody in experimental autoimmune encephalomyelitis induced by recombinant myelin oligodendrocyte glycoprotein, Eur. J. Immunol.32 (2002) 1905-1913.
C. Bourquin, A. Schubart, S. Tobollik, I. Mather, S. Ogg, R. Liblau, C. Linington, Selective unresponsiveness to conformational B cell epitopes of the myelin oligodendrocyte glycoprotein in H2-b mice, J. Immunol. 171 (2003) 455-461.
P. Dharmasaroja, Specificity of autoantibodies to epitopes of myelin proteins in multiple sclerosis, J. Neurol. Sci. 206 (2003) 7-16.
Y. Qin, P. Duquette, B-cell immunity in MS, Int. MS J. 10 (2003) 110-120.
T. Ziemssen, F. Ziemssen, The role of the humoral immune system in multiple sclerosis (MS) and its animal model experimental autoimmune encephalomyelitis, Autoimmun Rev. 4 (2005) 460-467.
P. Martin Mdel, N. L. Monson, Potential role of humoral immunity in the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE), Front. Biosci. 12 (2007) 2735-2749.
K. A. McLaughlin, K. W. Wucherpfennig, B cells and autoantibodies in the pathogenesis of multiple sclerosis and related inflammatory demyelinating diseases, Adv. Immunol. 98 (2008) 121-149.
S. Kuerten, R. Pauly, S. Blaschke, A. Rottlaender, C. C. Kaiser, M. Schroeter, G. R. Fink, K. Addicks, The significance of a B cell-dependent immunopathology in multiple sclerosis, Fortschr. Neurol. Psychiatr. 79 (2011) 83-91.
S. Jarius, F. Paul, D. Franciotta, P. Waters, F. Zipp, R. Hohlfeld, A. Vincent, B. Wildemann, Mechanisms of disease: aquaporin-4 antibodies in neuromyelitis optica, Nat. Clin. Pract. Neurol.4 (2008) 202-214.
M. Morris-Downes, P. A. Smith, J. L. Rundle, S. J. Piddlesden, D. Baker, D. Pham-Dinh, N. Hejmans, S. Amor, Pathological and regulatory effects of anti-myelin antibodies in experimental allergic encephalomyelitis in mice, J. Neuroimmunol. 125 (2002) 114-124.
Z. Jingwu, A. A. Vandenbark, M. P. Jacobs, H. Offner, J. C. M. Raus, Murine monoclonal anti-myelin basic protein (MBP) antibodies inhibit proliferation and cytotoxicity of MBP-specific human T cell clones, J. Neuroimmunol. 24 (1989) 87-94.
V. K. Tuohy, Peptide determinants of myelin proteolipid protein (PLP) in autoimmune demyelinating disease: a review, Neurochem. Res. 19 (1993) 935-944.
E. A. Elliott, H. I. McFarland, S. H. Nye, R. Cofiell, T. M. Wilson, J. A. Wilkins, S. P. Squinto, L. A. Matis, J. P. Mueller, Treatment of experimental encephalomyelitis with a novel chimeric fusion protein of myelin basic protein and proteolipid protein, J. Clin. Invest. 98 (1996) 1602-1612.
S. Kuerten, F. S. Lichtenegger, S. Faas, D. N. Angelov, M. Tary-Lehmann, P. V. Lehmann, MBP-PLP fusion protein-induced EAE in C57BL/6 mice, J. Neuroimmunol. 177 (2006) 99-111.
C. C. Bernard, Experimental autoimmune encephalomyelitis in mice: genetic control of susceptibility, J. Immunogenet. 3 (1976) 263-274.
S. S. Zamvil, D. J. Mitchell, A. C. Moore, K. Kitamura, L. Steinman, J. B. Rothbard, T-cell epitope of the autoantigen myelin basic protein that induces encephalomyelitis, Nature 324 (1986) 258-260.
R. B. Fritz, M. L. Zhao, Active and passive experimental autoimmune encephalomyelitis in strain 129/J (H-2b) mice, J. Neurosci. Res. 5 (1996) 471-474.
C. P. Genain, M. H. Nguyen, N. L. Letvin, R. Pearl, R. L. Davis, M. Adelman, M. B. Lees, C. Linington, S. L. Hauser, Antibody facilitation of multiple sclerosis-like lesions in a nonhuman primate. J. Clin. Invest. 96 (1995) 2966-2974.
K. G. Warren, I. Catz, Relative frequency of autoantibodies to myelin basic protein and proteolipid protein in optic neuritis and multiple sclerosis cerebrospinal fluid, J. Neurol. Sci. 121 (1994) 66-73.
M. K. Storch, S. Piddlesden, M. Haltia, M. Iivanainen, P. Morgan, H. Lassmann, Multiple sclerosis: in situ evidence for antibody- and complement-mediated demyelination, Ann. Neurol. 43 (1998) 465-471.
C. Lucchinetti, W. Brck, J. Parisi, B. Scheithauer, M. Rodriguez, H. Lassmann, Heterogeneity of multiple sclerosis lesions: implications for the pathogenesis of demyelination, Ann. Neurol. 47 (2000) 707-717.
B. G. Weinshenker, P. C. O'Brien, T. M. Petterson, J. H. Noseworthy, C. F. Lucchinetti, D. W. Dodick, A. A. Pineda, L. N. Stevens, M. Rodriguez, A randomized trial of plasma exchange in acute central nervous system inflammatory demyelinating disease, Ann. Neurol. 46 (1999) 878-886.
M. Munemoto, Y. Otaki, S. Kasama, M. Nanami, M. Tokuyama, M. Yahiro, Y. Hasuike, T. Kuragano, H. Yoshikawa, H. Nonoguchi, T. Nakanishi, Therapeutic efficacy of double filtration plasmapheresis in patients with anti-aquaporin-4 antibody-positive multiple sclerosis. J. Clin. Neurosci. (2011), epub.
R. B. Fritz, C. H. Chou, D. E. McFarlin, Induction of experimental allergic encephalomyelitis in PL/J and (SJL/J x PL/J)F1 mice by myelin basic protein and its peptides: localization of a second encephalitogenic determinant, J. Immunol. 130 (1983) 191-194.
P. Whiting, R. Harbord, C. Main C, et al. Accuracy of MRI for the diagnosis of multiple sclerosis: systematic review. BMJ 2006; 15:875-884.