METHODS OF TREATING VOLUME DEPLETION AND KIDNEY INJURY
20190064166 ยท 2019-02-28
Assignee
Inventors
- Jonathan Barasch (New York, NY)
- Katherine Xu (New York, NY)
- Paul Rosenstiel (New York, NY)
- Paolo Guarnieri (New York, NY)
Cpc classification
G01N2800/347
PHYSICS
International classification
Abstract
The present invention provides methods for treatment of volume-dependent Acute Kidney Injury (vAKI) and ischemic Acute Kidney Injury (iAKI), as well as methods for diagnosing vAKI and iAKI. The methods are based on determining the levels of PAPPA2, NGAL, KRT20, or TAC-STD2 protein in a sample from a patient, such as a urine sample. The present invention also provides a device and a diagnostics kit for determining whether a sample from a subject contains PAPPA2, NGAL, KRT20, or TACSTD2 protein.
Claims
1. A method for treating volume-dependent acute kidney injury (vAKI) in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; and b) administering fluids to the subject if full-length PAPPA2 protein is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have Acute Kidney Injury (AKI).
2. A method for treating vAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; b) determining the level of proteolytically cleaved PAPPA2 protein in a urine sample from the subject; c) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject; d) determining the ratio of full-length PAPPA2/proteolytically cleaved PAPPA2, full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject; e) determining the level of full-length PAPPA2 protein in a urine sample from a subject that does not have AKI; f) determining the level of proteolytically cleaved PAPPA2 protein in a urine sample from the subject that does not have AKI, g) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in a urine sample from a subject that does not have AKI; h) determining the ratio of full-length PAPPA2/proteolytically cleaved PAPPA2, full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject that does not have AKI; i) administering fluids to the subject if the ratio of full-length PAPPA2/proteolytically cleaved PAPPA2, full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject is greater than the ratio of full-length PAPPA2/proteolytically cleaved PAPPA2, full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from a subject that does not have AKI, respectively.
3.-5. (canceled)
6. The method of claim 1 or 2, wherein the size of full-length PAPPA2 is equal to or above 180 kDa.
7. The method of claim 2, wherein the size of proteolytically cleaved PAPPA2 is equal to or below 130 kDa.
8. The method of claim 1 or 2, further comprising determining the level of serum creatinine in the subject.
9. (canceled)
10. (canceled)
11. The method of claim 8, wherein treatment is administered if the subject has a level of serum creatinine above 0.5 mg/dL.
12. (canceled)
13. (canceled)
14. The method of claim 2, further comprising, prior to step a), reducing a urine sample from a subject with a reducing agent to generate a reduced urine sample, filtering the reduced urine sample with a 300 KDa filter to produce a retentate and a filtrate, wherein step a) and/or is then performed on the retentate.
15. (canceled)
16. The method of claim 1 or 2, wherein the level of full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein is determined by ELISA, immunoblot, Western blot, or lateral flow dip stick.
17. The method of claim 1 or 2, wherein the level of full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein is determined using an antibody that specifically binds to full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, respectively, or a fragment thereof.
18. A diagnostic kit for determining whether a urine sample from a subject contains full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a combination thereof, the kit comprising at least one antibody that specifically binds to full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a fragment thereof.
19. (canceled)
20. The method of claim 1 or 2, wherein the determining the level of a full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein in a urine sample from a subject comprises: (b) measuring full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein levels by ELISA using an antibody directed to SEQ ID NO: 1, 2, 5, 7, or 9, or a fragment thereof; or by western blot using an antibody directed to SEQ ID NO: 1, 2, 5, 7, or 9, or a fragment thereof; or by mass spectroscopy; or by isoelectric focusing, or a combination thereof.
21.-41. (canceled)
42. The method of claim 1 or 2, wherein the fluids comprise saline, blood, or an albumin infusion, or any combination thereof.
43. The method of claim 1 or 2, wherein the administering is done intravenously.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0005] To conform with the requirements for PCT applications, many of the figures presented herein are black and white representations of images originally created in color.
[0006]
[0007]
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
SUMMARY OF THE INVENTION
[0035] The present invention relates to divergent AKI transcriptomes, specifically gene signatures in pre-renal/volume depletion/hemodynamic fluctuations versus ischemic kidney injury. The definition of acute kidney failure is undergoing a revision. Serum creatinine (sCr) is currently the only marker. Yet it elevates in pre-renal/volume depletion/hemodynamic fluctuations and in ischemic damage.
[0036] In one aspect, the invention provides a method for treating volume-dependent acute kidney injury (vAKI) in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; and b) administering fluids to the subject if full-length PAPPA2 protein is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have Acute Kidney Injury (AKI).
[0037] In another aspect, the invention provides a method for treating vAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; b) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject; c) determining the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject; d) determining the level of full-length PAPPA2 protein in a urine sample from a subject that does not have AKI; e) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in a urine sample from a subject that does not have AKI; f) determining the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject that does not have AKI; and g) administering fluids to the subject if the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject is greater than the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from a subject that does not have AKI, respectively.
[0038] In another aspect, the invention provides a method for treating ischemic acute kidney injury (iAKI) in a subject in need thereof, the method comprising: a) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in a urine sample from the subject; and b) administering treatment for kidney damage to the subject if NGAL, KRT20, or TACSTD2 protein, or a combination thereof, is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have AKI.
[0039] In one aspect, the invention provides a method for treating iAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; b) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject; c) determining the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject; d) determining the level of full-length PAPPA2 protein in a urine sample from a subject that does not have AKI; e) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject that does not have AKI; f) determining the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject that does not have AKI; and g) administering treatment for kidney damage to the subject if the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject is greater than the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject that does not have AKI, respectively.
[0040] In another aspect, the invention provides a method for treating iAKI in a subject in need thereof, the method comprising: a) determining the level of proteolytically cleaved PAPPA2 protein in a urine sample from the subject; and b) administering treatment for kidney damage to the subject if proteolytically cleaved PAPPA2 protein is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have AKI.
[0041] In one embodiment, the size of full-length PAPPA2 is equal to or above 180 kDa. In another embodiment, the size of proteolytically cleaved PAPPA2 is equal to or below 130 kDa.
[0042] In one embodiment, the method further comprises determining the level of serum creatinine in the subject. In one embodiment, the level of serum creatinine is determined before the administering step. In another embodiment, an elevated level of serum creatinine is above 0.5 mg/dL.
[0043] In one embodiment, treatment is administered if the subject has an elevated level of serum creatinine. In another embodiment, the treatment for kidney damage comprises withholding fluids, administering dialysis, or a combination thereof. In one embodiment, the method further comprises testing and treating the subject for hyperkalemia, hyponatremia, hyperphosphatemia or acidosis.
[0044] In one embodiment, the method comprises prior to step a), reducing a urine sample from a subject with a reducing agent to generate a reduced urine sample, filtering the reduced urine sample with a 300 KDa filter to produce a retentate and a filtrate, wherein step a) and/or d) is then performed on the retentate. In another embodiment, the reducing agent is beta-mercaptoethanol.
[0045] In one embodiment, the level of full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein is determined by ELISA, immunoblot, Western blot, or lateral flow dip stick. In another embodiment, the level of full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein is determined using an antibody that specifically binds to full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, respectively, or a fragment thereof.
[0046] In one aspect, the invention provides a diagnostic kit for determining whether a urine sample from a subject contains full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a combination thereof, the kit comprising at least one antibody that specifically binds to full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a fragment thereof.
[0047] In another aspect, the invention provides a diagnostic kit for determining whether a urine sample from a subject contains full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a combination thereof, the kit comprising at least one antibody that specifically binds to a protein comprising SEQ ID NO: 1, 2, 5, 7, or 9.
[0048] In another aspect, the invention provides a method for detecting the presence of a full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein in a urine sample from a subject, the method comprising: (a) obtaining a urine sample from the subject; and (b) measuring full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein levels by ELISA using an antibody directed to SEQ ID NO: 1, 2, 5, 7, or 9; or by western blot using an antibody directed to SEQ ID NO: 1, 2, 5, 7, or 9; or by mass spectroscopy; or by isoelectric focusing, or a combination thereof.
[0049] In another aspect, the invention provides a method of diagnosing vAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; and b) diagnosing the subject with vAKI if full-length PAPPA2 protein is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have AKI.
[0050] In one aspect, the invention provides a method of diagnosing vAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; b) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject; c) determining the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject; d) determining the level of full-length PAPPA2 protein in a urine sample from a subject that does not have AKI; e) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject that does not have AKI; f) determining the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject that does not have AKI; g) diagnosing the subject with vAKI if the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject is greater than the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from a subject that does not have AKI, respectively.
[0051] In another aspect, the invention provides a method of diagnosing iAKI in a subject in need thereof, the method comprising: a) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in a urine sample from the subject; and b) diagnosing the subject with iAKI if NGAL, KRT20, or TACSTD2 protein, or a combination thereof, is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have AKI.
[0052] In one aspect, the invention provides a method of diagnosing iAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; b) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject; c) determining the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject; d) determining the level of full-length PAPPA2 protein in a urine sample from a subject that does not have AKI; e) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject that does not have AKI; f) determining the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject that does not have AKI; g) diagnosing the subject with iAKI if the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject is greater than the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject that does not have AKI, respectively.
[0053] In another aspect, the invention provides a method for diagnosing iAKI in a subject in need thereof, the method comprising: a) determining the level of proteolytically cleaved PAPPA2 protein in a urine sample from the subject; and b) diagnosing the subject with iAKI if proteolytically cleaved PAPPA2 protein is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have AKI.
[0054] In one embodiment, the size of full-length PAPPA2 is equal to or above 180 kDa. In another embodiment, the size of proteolytically cleaved PAPPA2 is equal to or below 130 kDa.
[0055] In one embodiment, the method comprises administering fluids to the subject if the subject is diagnosed with vAKI. In another embodiment, the method comprises administering treatment for kidney damage if the subject is diagnosed with iAKI.
[0056] In one embodiment, the method comprises determining the level of serum creatinine in the subject. In another embodiment, the level of serum creatinine is determined before the diagnosing step. In one embodiment, an elevated level of serum creatinine is above 0.5 mg/dL.
[0057] In one embodiment, the subject is diagnosed with vAKI or iAKI if the subject also has an elevated level of serum creatinine.
[0058] In one embodiment, the treatment for kidney damage comprises withholding fluids, administering dialysis, or a combination thereof. In another embodiment, the method further comprises testing and treating the subject for hyperkalemia, hyponatremia, hyperphosphatemia or acidosis if the subject is diagnosed with iAKI.
[0059] In one embodiment, the method further comprises, prior to step a), reducing a urine sample from a subject with a reducing agent to generate a reduced urine sample, filtering the reduced urine sample with a 300 kDa filter to produce a retentate and a filtrate, wherein step a) and/or d) is then performed on the retentate. In another embodiment, the reducing agent is beta-mercaptoethanol.
[0060] In one embodiment, the level of full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein is determined by ELISA, immunoblot, Western blot, or lateral flow dip stick. In another embodiment, the level of full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein is determined using an antibody that specifically binds to full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, respectively, or a fragment thereof.
[0061] In one embodiment, the subject is a human subject.
[0062] In one aspect, the invention provides a device for determining whether a urine sample from a subject contains full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a combination thereof, the device comprising at least one antibody that specifically binds to full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a fragment thereof.
DETAILED DESCRIPTION
[0063] All patent applications, published patent applications, issued and granted patents, texts, and literature references cited in this specification are hereby incorporated herein by reference in their entirety to more fully describe the state of the art to which the present disclosed subject matter pertains.
[0064] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Methods and materials are described herein for use in the present invention; other, suitable methods and materials known in the art can also be used. The materials, methods, and examples are illustrative only and not intended to be limiting. All publications, patent applications, patents, sequences, database entries, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control.
[0065] Described herein are specific gene markers for volume depletion of the kidney (i.e. vAKI) and for kidney ischemic damage (i.e. iAKI) that have been identified. Specific gene markers were identified for volume depletion (i.e. vAKI), and specific gene markers were identified for ischemic damage (i.e. iAKI).
[0066] The terms effective amount and effective to treat, as used herein, refer to an amount or a concentration of one or more compounds or a pharmaceutical composition described herein utilized for a period of time (including in vitro and in vivo acute or chronic administration and periodic or continuous administration) that is effective within the context of its administration for causing an intended effect or physiological outcome.
[0067] The term subject is used throughout the specification to describe an animal, human or non-human, to whom treatment according to the methods of the present invention is provided. A subject may be, for example, a mammal such as a dog, a cat, a cow, a horse, a rabbit, a monkey, a pig, a sheep, a goat, a mouse, a rat, or a human.
[0068] The singular forms a, an, and the include plural reference unless the context clearly dictates otherwise.
[0069] As used herein the term about is used herein to mean approximately, roughly, around, or in the region of. When the term about is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values set forth. In general, the term about is used herein to modify a numerical value above and below the stated value by a variance of 20 percent up or down (higher or lower).
[0070] As used herein the term variant covers nucleotide or amino acid sequence variants which have about 95%, about 90%, about 85%, about 80%, about 85%, about 80%, about 75%, about 70%, or about 65% nucleotide identity, or about 95%, about 90%, about 85%, about 80%, about 85%, about 80%, about 75%, or about 70% amino acid identity, including but not limited to variants comprising conservative, or non-conservative substitutions, deletions, insertions, duplications, or any other modification. The term variant as used herein includes functional and non-functional variants, and variants with reduced or altered activity.
[0071] As used herein AKI refers to Acute Kidney Injury.
[0072] As used herein vAKI and pAKI refer to volume-dependent Acute Kidney Injury, also referred to as pre-renal/volume depletion/hemodynamic fluctuations. vAKI (or pAKI) is defined by an increase in serum creatinine that is rapidly reversible by fluids. vAKI (or pAKI) is commonly due to volume depletion, heart failure, or liver failure, and is considered a transient condition.
[0073] As used herein iAKI refers to ischemic Acute Kidney Injury, or nephrotoxic Acute Kidney Injury, also referred to as intrinsic tubular damage, ischemic damage, direct damage to the kidney tubule, tubular injury, and intrinsic tubular damage. iAKI is a direct injury to the kidney tubules, or kidney vasculature. iAKI is not reversible with fluids, typically lasts more than two days, and is considered a more prolonged condition.
[0074] As used herein sCr refers to serum creatinine, and Pcr refers to plasma creatinine or P-creatinine. The terms sCr and Pcr and the terms serum creatinine and plasma creatinine and P-creatinine can be used interchangeably.
[0075] vAKI and iAKI
[0076] Acute kidney failure was traditionally categorized by etiology including prerenal/transient kidney failure, intrinsic/prolonged kidney failure (ATN), or postrenal kidney failure. In contrast, more recent classifications focus on two metrics, the rise in serum creatinine (sCr) or a decrease in urine output as tantamount to kidney injury (Acute Kidney Injury, AKI), without emphasis on its potential etiologies or on clinical heterogeneity. While any form of AKI worsens patient outcomes, it has remained an open question how hemodynamic or volume vAKI is related to intrinsic tubular damage iAKI.
[0077] The critical function of the kidney is the preservation of water and electrolytes. These functions are conserved throughout the animal kingdom from planaria to mammals. When Na+ and water are scarce (volume depletion), the kidney's excretory responses decrease, causing Na+, water, and urea retention. When volume depletion is more severe, the serum creatinine, sCr, is also retained. A similar scenario occurs in the setting of non-renal diseases that mimic volume depletion such as severe congestive heart and liver failure, because similar drivers (angiotensin-aldosterone systems) and effectors of volume retention (ENac, Na/KATPase and osmolytes) are activated (currently called cardio-renal and hepato-renal syndromes). Adding further complexity, destruction of kidney epithelia by toxic stimuli (e.g. ischemia, sepsis, nephrotoxins) also blocks water, electrolyte, urea, and sCr excretion. Hence, it is not surprising that increases in urea and sCr of different etiologies are associated with poor prognoses, but it remains challenging to prospectively distinguish subtypes of diminished excretion on the basis of current blood or urine measurements.
[0078] Described herein is a method directed to a core issue in patient management on presentation to the clinic or to the hospitalwhether the patient has a kidney injury. P-creatinine (Pcr) can be elevated because of volume depletion, but an elevated Pcr can also be found because of direct damage to the kidney tubule.
[0079] In the case of volume depletion or vAKI, fluids (saline, blood, albumin infusions) are administered, but in the case of injury or iAKI the same fluids should be withheld. In the case of volume depletion or vAKI, all medications, including medications that the patient may already be taking, do not need to be withheld or dose-adjusted. In the case of injury or iAKI, all medications, including medications that the patient may already be taking, need to be withheld or dose-adjusted. In the case of volume depletion or vAKI, the patient can be discharged, but in the case of injury or iAKI, the patient must remain in the hospital. In the case of volume depletion or vAKI, electrolyte imbalance is rare, but in the case of injury or iAKI, it is routine.
[0080] Because it is not possible to prospectively know whether an elevated Pcr is due to volume depletion (vAKI) or due to kidney damage (iAKI), mistakes in the treatment of these conditions are routine. For example, if the patient is volume depleted but does not get fluids, different organs can be damaged further. If the patient has kidney damage or injury already and receives fluids, the patient could become so fluid-overload that they go into pulmonary edema, and may need dialysis and intensive care admission. Described herein, is a method to diagnose, distinguish, and treat volume depletion or vAKI from kidney injury or iAKI.
[0081] Described herein is the identification of a combination of proteins in the urine which on measurement can distinguish the mechanism of the elevated Pcr at the time of patient contact, allowing prospective diagnosis, triage and treatment. Depending on the levels of proteins, treatment regimens are as follows.
[0082] Pappa 2 is a marker for volume depletion Acute Kidney Injury (vAKI). When there is elevated Pcr and positive Pappa2 in the urine, a patient is diagnosed with vAKI, and treated by immediate administration with fluids, such as saline, albumin and blood.
[0083] NGAL, TACSTD1 (Trop2) and Cytokeratin 20 (Krt20) are markers identified herein for ischemic Acute Kidney Injury (iAKI). When there is elevated Pcr and negative Pappa2, but positive NGAL, Cytokeratin 20 (Krt20), or TACSTD1 (Trop2), a patient is diagnosed with iAKI, is not treated with fluids, and doses of medications, including medications the patient may already be on, must be withheld or dose-adjusted. Further treatment of a patient with elevated Pcr, negative Pappa2, and positive NGAL, Cytokeratin 20 (Krt20), or TACSTD1 (Trop2) includes monitoring for and potentially administering dialysis, repeating blood tests, and testing for hyperkalemia, hyponatremia, and acidosis, each of which must be treated immediately.
[0084] If the patient has hyperkalemia, then potassium levels must be lowered, by administering to the patient kayexolate-sodium polystyrene sulfonate or sodium bicarbonate. If the patient has hyponatremia, then sodium chloride or sodium bicarbonate must be administered to the patient. If the patient has acidosis, then sodium bicarbonate must be administered to the patient. If the patient has hyperphosphatemia, then oral phosphate binders including aluminum and calcium and iron based binders must be administered to the patient.
[0085] Possible commercial applications include applications in heart failure/liver failure versus tubular damage of kidney versus nephrotoxicity. More specifically, the methods described herein can be used to distinguish heart and liver failure, which typically start with vAKI, from tubular damage of kidney and nephrotoxicity, which typically starts with iAKI. The methods can be used singularly or in combination.
[0086] Molecules of the Invention
[0087] The practice of aspects of the present invention can employ, unless otherwise indicated, conventional techniques of cell biology, cell culture, molecular biology, transgenic biology, microbiology, recombinant DNA, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Molecular Cloning A Laboratory Manual, 3rd Ed., ed. by Sambrook (2001), Fritsch and Maniatis (Cold Spring Harbor Laboratory Press: 1989); DNA Cloning, Volumes I and II (D. N. Glover ed., 1985); Oligonucleotide Synthesis (M. J. Gait ed., 1984); Mullis et al. U.S. Pat. No. 4,683,195; Nucleic Acid Hybridization (B. D. Hames & S. J. Higgins eds. 1984); Transcription and Translation (B. D. Hames & S. J. Higgins eds. 1984); Culture Of Animal Cells (R. I. Freshney, Alan R. Liss, Inc., 1987); Immobilized Cells and Enzymes (IRL Press, 1986); B. Perbal, A Practical Guide To Molecular Cloning (1984); the series, Methods In Enzymology (Academic Press, Inc., N.Y.), specifically, Methods In Enzymology, Vols. 154 and 155 (Wu et al. eds.); Gene Transfer Vectors For Mammalian Cells (J. H. Miller and M. P. Calos eds., 1987, Cold Spring Harbor Laboratory); Immunochemical Methods In Cell And Molecular Biology (Caner and Walker, eds., Academic Press, London, 1987); Handbook Of Experimental Immunology, Volumes I-IV (D. M. Weir and C. C. Blackwell, eds., 1986); Manipulating the Mouse Embryo, (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1986). All patents, patent applications and references cited herein are incorporated by reference in their entireties.
[0088] One skilled in the art can obtain a protein in several ways, which include, but are not limited to, isolating the protein via biochemical means or expressing a nucleotide sequence encoding the protein of interest by genetic engineering methods.
[0089] A protein is encoded by a nucleic acid (including, for example, genomic DNA, complementary DNA (cDNA), synthetic DNA, as well as any form of corresponding RNA). For example, it can be encoded by a recombinant nucleic acid of a gene. The proteins of the invention can be obtained from various sources and can be produced according to various techniques known in the art. For example, a nucleic acid that encodes a protein can be obtained by screening DNA libraries, or by amplification from a natural source. A protein can be a fragment or portion thereof. The nucleic acids encoding a protein can be produced via recombinant DNA technology and such recombinant nucleic acids can be prepared by conventional techniques, including chemical synthesis, genetic engineering, enzymatic techniques, or a combination thereof.
[0090] The Genbank ID for the PAPPA2 gene is 60676. PAPPA2 is also referred to as pappalysin-2, PAPPE, PLAC3, PAPP-E, and PAPP-A2. These alternative names for PAPPA2 may be used interchangeably herein. Unless stated otherwise, the term PAPPA2, as used herein, includes any PAPPA2 protein, or fragment thereof. PAPPA2 is a member of the pappalysin family of metzincin metalloproteinases. The encoded protein cleaves insulin-like growth factor-binding protein 5 and is thought to be a local regulator of insulin-like growth factor (IGF) bioavailability. Alternative splicing of PAPPA2 results in multiple transcript variants. The Genbank Accession No for the PAPPA2 genomic DNA is NG 023390.1. Two isoforms are listed on Genbank for PAPPA2, e.g., having Genebank Accession Nos. NP_064714.2 (corresponding nucleotide sequence NM_020318.2); NP_068755.2 (corresponding to NM_021936.2).
[0091] SEQ ID NO: 1 is the PAPPA2 Amino Acid Sequence, Isoform 1 precursor (NP_064714.2; 1791 aa).
TABLE-US-00001 1 mmclkilrislailagwalcsanselgwtrkkslverehlnqvllegercwlgakvrrpr 61 aspqhhlfgvypsragnylrpypvgeqeihhtgrskpdtegnavslvppdltenpaglrg 121 aveepaapwvgdspigqsellgdddaylgnqrskeslgeagiqkgsamaattttaifttl 181 nepkpetqrrgwaksrqrrqvwkrraedgqgdsgisshfqpwpkhslkhrvkksppeesn 241 qnggegsyreaetfnsqvglpilyfsgrrerlllrpevlaeipreaftveawvkpeggqn 301 npaiiagvfdncshtvsdkgwalgirsgkdkgkrdarfffslctdrvkkatilishsryq 361 pgtwthvaatydgrhmalyvdgtqvassldqsgplnspfmascrslllggdssedghyfr 421 ghlgtlvfwstalpqshfqhssqhssgeeeatdlvltasfepvntewvpfrdekyprlev 481 lqgfepepeilsplqpplcgqtvcdnvelisqyngywplrgekviryqvvnicddeglnp 541 ivseeqirlqhealneafsryniswqlsvhqvhnstlrhrvvlvncepskigndhcdpec 601 ehpltgydggdcrlqgrcyswnrrdglchvecnnmlndfddgdccdpqvadvrktcfdpd 661 spkraymsvkelkealqlnsthflniyfassvredlagaatwpwdkdavthlggivlspa 721 yygmpghtdtmihevghvlglyhvfkgvserescndpcketvpsmetgdlcadtaptpks 781 elcrepeptsdtcgftrfpgapftnymsytddnctdnftpnqvarmhcyldlvyqqwtes 841 rkptpipippmvigqtnksltihwlppisgvvydrasgslcgactedgtfrqyvhtassr 901 rvcdssgywtpeeavgppdvdqpcepslqawspevhlyhmnmtvpcptegcslellfqhp 961 vqadtltlwvtsffmessqvlfdteillenkesvhlgpldtfcdipltiklhvdgkvsgv 1021 kvytfderieidaalltsqphsplcsgcrpvryqvlrdppfasglpvvvthshrkftdve 1081 vtpgqmyqyqvlaeaggelgeaspplnhihgapycgdgkvserlgeecddgdlvsgdgcs 1141 kvceleegfncvgepslcymyegdgicepferktsivdcgiytpkgyldqwatraysshe 1201 dkkkcpvslvtgephslictsyhpdlpnhrpltgwfpcvasenetqddrseqpegslkke 1261 devwlkvcfnrpgearaififlttdglvpgehqqptvtlyltdvrgsnhslgtyglscqh 1321 npliinvthhqnvlfhhttsvllnfssprvgisavalrtssriglsapsncisedegqnh 1381 qgqscihrpcgkqdscpsllldhadvvnctsigpglmkcaitcqrgfalqassgqyirpm 1441 qkeilltcssghwdqnvsclpvdcgvpdpslvnyanfscsegtkflkrcsiscvppaklq 1501 glspwltcledglwslpevycklecdappiilnanlllphclqdnhdvgtickyeckpgy 1561 yvaesaegkvrnkllkiqcleggiweggscipvvceppppvfegmyectngfsldsqcvl 1621 ncnqereklpilctkeglwtqefklcenlqgecppppselnsveykceqgygigavcspl 1681 cvippsdpvmlpenitadtlehwmepvkvqsivctgrrqwhpdpvlvhciqscepfqadg 1741 wcdtinnraychydggdccsstlsskkvipfaadcdldectcrdpkaeenq
[0092] SEQ ID NO: 2 is the PAPPA2 Amino Acid Sequence, Isoform 2 precursor (NP_068755.2; 827 aa).
TABLE-US-00002 1 mmclkilrislailagwalcsanselgwtrkkslverehlnqvllegercwlgakvrrpr 61 aspqhhlfgvypsragnylrpypvgeqeihhtgrskpdtegnavslvppdltenpaglrg 121 aveepaapwvgdspigqsellgdddaylgnqrskeslgeagiqkgsamaattttaifttl 181 nepkpetqrrgwaksrqrrqvwkrraedgqgdsgisshfqpwpkhslkhrvkksppeesn 241 qnggegsyreaetfnsqvglpilyfsgrrerlllrpevlaeipreaftveawvkpeggqn 301 npaiiagvfdncshtvsdkgwalgirsgkdkgkrdarfffslctdrvkkatilishsryq 361 pgtwthvaatydgrhmalyvdgtqvassldqsgplnspfmascrslllggdssedghyfr 421 ghlgtlvfwstalpqshfqhssqhssgeeeatdlvltasfepvntewvpfrdekyprlev 481 lqgfepepeilsplqpplcgqtvcdnvelisqyngywplrgekviryqvvnicddeglnp 541 ivseeqirlqhealneafsryniswqlsvhqvhnstlrhrvvlvncepskigndhcdpec 601 ehpltgydggdcrlqgrcyswnrrdglchvecnnmlndfddgdccdpqvadvrktcfdpd 661 spkraymsvkelkealqlnsthflniyfassvredlagaatwpwdkdavthlggivlspa 721 yygmpghtdtmihevghvlglyhvfkgvserescndpcketvpsmetgdlcadtaptpks 781 elcrepeptsdtcgftrfpgapftnymsytgittvlfcfllrihggl
[0093] SEQ ID NO: 3 is the PAPPA2 mRNA or cDNA Nucleotide Sequence, transcript variant 1 (NM_020318.2; 6940 bp).
TABLE-US-00003 1 gggcatgactctctctcttgagtaggcacacactcccttttctcgggtgtgtactttttg 61 ctttgtgatacatctctgcactttcagtattttccaactcatccttaaattccttctcac 121 aacagtgtcaagagcctggacgccagccaggattgaggtcctacgggtgtttggggacct 181 ccccaagcccacgagtatcaatggcagtatcaattgtctgtgacagtgattaaggagcaa 241 aacacttggaacccacaagactcccagaaggtgaagttaagagctcccagactcataagg 301 ttattagaacagcaaactggcaccccaaagaactttacggagacttgcaacctatcaaca 361 agttggatgagggattaaaagccttcaacaaccaacaaccccaagcatcaaactgaagga 421 aacattctaaccttcacagacagactggaggctggatggggacctggctgaagacatctg 481 gagaatgaaagttaagtaccagcttgcatttttgtgcccctagattatttttgcatttta 541 aaataagaagcatcaaattgcgtgtctctgtgtaaaagttctagcaatttgttttaaggt 601 gaacttattttggcttagggactacaaaaagagaaggtaattcctagggaaggaagaaga 661 gaaagaaatgaaaattagagaataagattattttgaatgacttcaggtagcgaggagtgt 721 gtgtttgtgagtgtgtatttgagagacttggctcatgcctgtgggtcttctcttctagta 781 tcagtgaggggagggattactgaagaagaaggggggaaaaaaaaagaaagaaatctgagc 841 tttctgggaggaaattcaaaggaaccaagagaaattaacttcgttctgcaaggactaaag 901 tacagcaagaggagagaggtcaagcgagaagcgtgcgggaagcacatgccctggggaggc 961 atagaagccacactggcagagcggccagcacaggtagccagcagaggcattcttggggct 1021 atttgaaaaagtttggtctgtgaacaaaacagtttccctggtgactgcaaatccattgct 1081 agctgcctctttctcgtctgcccatcactctggtgtggtacccagaagttgacttctggt 1141 tctgtagaaagagctaggggaggtatgatgtgcttaaagatcctaagaataagcctggcg 1201 attttggctgggtgggcactctgttctgccaactctgagctgggctggacacgcaagaaa 1261 tccttggttgagagggaacacctgaatcaggtgctgttggaaggagaacgttgttggctg 1321 ggggccaaggttcgaagacccagagcttctccacagcatcacctctttggagtctacccc 1381 agcagggctgggaactacctaaggccctaccccgtgggggagcaagaaatccatcataca 1441 ggacgcagcaaaccagacactgaaggaaatgctgtgagccttgttcccccagacctgact 1501 gaaaatccagcaggactgaggggtgcagttgaagagccggctgccccatgggtaggggat 1561 agtcctattgggcaatctgagctgctgggagatgatgacgcttatctcggcaatcaaaga 1621 tccaaggagtctctaggtgaggccgggattcagaaaggctcagccatggctgccactact 1681 accaccgccattttcacaaccctgaacgaacccaaaccagagacccaaaggaggggctgg 1741 gccaagtccaggcagcgtcgccaagtgtggaagaggcgggcggaagatgggcagggagac 1801 tccggtatctcttcacatttccaaccttggcccaagcattcccttaaacacagggtcaaa 1861 aagagtccaccggaggaaagcaaccaaaatggtggagagggctcctaccgagaagcagag 1921 acctttaactcccaagtaggactgcccatcttatacttctctgggaggcgggagcggctg 1981 ctgctgcgtccagaagtgctggctgagattccccgggaggcgttcacagtggaagcctgg 2041 gttaaaccggagggaggacagaacaacccagccatcatcgcaggtgtgtttgataactgc 2101 tcccacactgtcagtgacaaaggctgggccctggggatccgctcagggaaggacaaggga 2161 aagcgggatgctcgcttcttcttctccctctgcaccgaccgcgtgaagaaagccaccatc 2221 ttgattagccacagtcgctaccaaccaggcacatggacccatgtggcagccacttacgat 2281 ggacggcacatggccctgtatgtggatggcactcaggtggctagcagtctagaccagtct 2341 ggtcccctgaacagccccttcatggcatcttgccgctctttgctcctggggggagacagc 2401 tctgaggatgggcactatttccgtggacacctgggcacactggttttctggtcgaccgcc 2461 ctgccacaaagccattttcagcacagttctcagcattcaagtggggaggaggaagcgact 2521 gacttggtcctgacagcgagctttgagcctgtgaacacagagtgggttccctttagagat 2581 gagaagtacccacgacttgaggttctccagggctttgagccagagcctgagattctgtcg 2641 cctttgcagcccccactctgtgggcaaacagtctgtgacaatgtggaattgatctcccag 2701 tacaatggatactggccccttcggggagagaaggtgatacgctaccaggtggtgaacatc 2761 tgtgatgatgagggcctaaaccccattgtgagtgaggagcagattcgtctgcagcacgag 2821 gcactgaatgaggccttcagccgctacaacatcagctggcagctgagcgtccaccaggtc 2881 cacaattccaccctgcgacaccgggttgtgcttgtgaactgtgagcccagcaagattggc 2941 aatgaccattgtgaccccgagtgtgagcacccactcacaggctatgatgggggtgactgc 3001 cgcctgcagggccgctgctactcctggaaccgcagggatgggctctgtcacgtggagtgt 3061 aacaacatgctgaacgactttgacgacggagactgctgcgacccccaggtggctgatgtg 3121 cgcaagacctgctttgaccctgactcacccaagagggcatacatgagtgtgaaggagctg 3181 aaggaggccctgcagctgaacagtactcacttcctcaacatctactttgccagctcagtg 3241 cgggaagaccttgcaggtgctgccacctggccttgggacaaggacgctgtcactcacctg 3301 ggtggcattgtcctcagcccagcatattatgggatgcctggccacaccgacaccatgatc 3361 catgaagtgggacatgttctgggactctaccatgtctttaaaggagtcagtgaaagagaa 3421 tcctgcaatgacccctgcaaggagacagtgccatccatggaaacgggagacctctgtgcc 3481 gacaccgcccccactcccaagagtgagctgtgccgggaaccagagcccactagtgacacc 3541 tgtggcttcactcgcttcccaggggctccgttcaccaactacatgagctacacggatgat 3601 aactgcactgacaacttcactcctaaccaagtggcccgaatgcattgctatttggaccta 3661 gtctatcagcagtggactgaaagcagaaagcccacccccatccccattccacctatggtc 3721 atcggacagaccaacaagtccctcactatccactggctgcctcctattagtggagttgta 3781 tatgacagggcctcaggcagcttgtgtggcgcttgcactgaagatgggacctttcgtcag 3841 tatgtgcacacagcttcctcccggcgggtgtgtgactcctcaggttattggaccccagag 3901 gaggctgtggggcctcctgatgtggatcagccctgcgagccaagcttacaggcctggagc 3961 cctgaggtccacctgtaccacatgaacatgacggtcccctgccccacagaaggctgtagc 4021 ttggagctgctcttccaacacccggtccaagccgacaccctcaccctgtgggtcacttcc 4081 ttcttcatggagtcctcgcaggtcctctttgacacagagatcttgctggaaaacaaggag 4141 tcagtgcacctgggccccttagacactttctgtgacatcccactcaccatcaaactgcac 4201 gtggatgggaaggtgtcgggggtgaaagtctacacctttgatgagaggatagagattgat 4261 gcagcactcctgacttctcagccccacagtcccttgtgctctggctgcaggcctgtgagg 4321 taccaggttctccgcgatcccccatttgccagtggtttgcccgtggtggtgacacattct 4381 cacaggaagttcacggacgtggaggtcacacctggacagatgtatcagtaccaagttcta 4441 gctgaagctggaggagaactgggagaagcttcgcctcctctgaaccacattcatggagct 4501 ccttattgtggagatgggaaggtgtcagagagactgggagaagagtgtgatgatggagac 4561 cttgtgagcggagatggctgctccaaggtgtgtgagctggaggaaggtttcaactgtgta 4621 ggagagccaagcctttgctacatgtatgagggagatggcatatgtgaaccttttgagaga 4681 aaaaccagcattgtagactgtggcatctacactcccaaaggatacttggatcaatgggct 4741 acccgggcttactcctctcatgaagacaagaagaagtgtcctgtttccttggtaactgga 4801 gaacctcattccctaatttgcacatcataccatccagatttacccaaccaccgtccccta 4861 actggctggtttccctgtgttgccagtgaaaatgaaactcaggatgacaggagtgaacag 4921 ccagaaggtagcctgaagaaagaggatgaggtttggctcaaagtgtgtttcaatagacca 4981 ggagaggccagagcaatttttatttttttgacaactgatggcctagttcccggagagcat 5041 cagcagccgacagtgactctctacctgaccgatgtccgtggaagcaaccactctcttgga 5101 acctatggactgtcatgccagcataatccactgattatcaatgtgacccatcaccagaat 5161 gtccttttccaccataccacctcagtgctgctgaatttctcatccccacgggtcggcatc 5221 tcagctgtggctctaaggacatcctcccgcattggtctttcggctcccagtaactgcatc 5281 tcagaggacgaggggcagaatcatcagggacagagctgtatccatcggccctgtgggaag 5341 caggacagctgtccgtcattgctgcttgatcatgctgatgtggtgaactgtacctctata 5401 ggcccaggtctcatgaagtgtgctatcacttgtcaaaggggatttgcccttcaggccagc 5461 agtgggcagtacatcaggcccatgcagaaggaaattctgctcacatgttcttctgggcac 5521 tgggaccagaatgtgagctgccttcccgtggactgcggtgttcccgacccgtctttggtg 5581 aactatgcaaacttctcctgctcagagggaaccaaatttctgaaacgctgctcaatctct 5641 tgtgtcccaccagccaagctgcaaggactgagcccatggctgacatgtcttgaagatggt 5701 ctctggtctctccctgaagtctactgcaagttggagtgtgatgctccccctattattctg 5761 aatgccaacttgctcctgcctcactgcctccaggacaaccacgacgtgggcaccatctgc 5821 aaatatgaatgcaaaccagggtactatgtggcagaaagtgcagagggtaaagtcaggaac 5881 aagctcctgaagatacaatgcctggaaggtggaatctgggagcaaggcagctgcattcct 5941 gtggtgtgtgagccaccccctcctgtgtttgaaggcatgtatgaatgtaccaatggcttc 6001 agcctggacagccagtgtgtgctcaactgtaaccaggaacgtgaaaagcttcccatcctc 6061 tgcactaaagagggcctgtggacccaggagtttaagttgtgtgagaatctgcaaggagaa 6121 tgcccaccacccccctcagagctgaattctgtggagtacaaatgtgaacaaggatatggg 6181 attggtgcagtgtgttccccattgtgtgtaatcccccccagtgaccccgtgatgctacct 6241 gagaatatcactgctgacactctggagcactggatggaacctgtcaaagtccagagcatt 6301 gtgtgcactggccggcgtcaatggcacccagaccccgtcttagtccactgcatccagtca 6361 tgtgagcccttccaagcagatggttggtgtgacactatcaacaaccgagcctactgccac 6421 tatgacgggggagactgctgctcttccacactctcctccaagaaggtcattccatttgct 6481 gctgactgtgacctggatgagtgcacctgccgggaccccaaggcagaagaaaatcagtaa 6541 ctgtgggaacaagcccctccctccactgcctcagaggcagtaagaaagagaggccgaccc 6601 aggaggaaacaaagggtgaatgaagaagaacaatcatgaaatggaagaaggaggaagagc 6661 atgaaggatcttataagaaatgcaagaggatattgataggtgtgaactagttcatcaagt 6721 agcccaagtaggagagaatcataggcaaaagtttctttaaagtggcagttgattaacatg 6781 gaaggggaaatatgatagatatataaggaccctcctccctcacttatattctattaaatc 6841 ctatcctcaactcttgccctgctctccgctccaccccctgccaactactcagtcccaccc 6901 aacttgtaaaccaataccaaaaaaaaaaaaaaaaaaaaaa
[0094] SEQ ID NO: 4 is the PAPPA2 mRNA or cDNA Nucleotide Sequence, transcript variant 2 (NM_021936.2; 4370 bp).
TABLE-US-00004 1 gggcatgactctctctcttgagtaggcacacactcccttttctcgggtgtgtactttttg 61 ctttgtgatacatctctgcactttcagtattttccaactcatccttaaattccttctcac 121 aacagtgtcaagagcctggacgccagccaggattgaggtcctacgggtgtttggggacct 181 ccccaagcccacgagtatcaatggcagtatcaattgtctgtgacagtgattaaggagcaa 241 aacacttggaacccacaagactcccagaaggtgaagttaagagctcccagactcataagg 301 ttattagaacagcaaactggcaccccaaagaactttacggagacttgcaacctatcaaca 361 agttggatgagggattaaaagccttcaacaaccaacaaccccaagcatcaaactgaagga 421 aacattctaaccttcacagacagactggaggctggatggggacctggctgaagacatctg 481 gagaatgaaagttaagtaccagcttgcatttttgtgcccctagattatttttgcatttta 541 aaataagaagcatcaaattgcgtgtctctgtgtaaaagttctagcaatttgttttaaggt 601 gaacttattttggcttagggactacaaaaagagaaggtaattcctagggaaggaagaaga 661 gaaagaaatgaaaattagagaataagattattttgaatgacttcaggtagcgaggagtgt 721 gtgtttgtgagtgtgtatttgagagacttggctcatgcctgtgggtcttctcttctagta 781 tcagtgaggggagggattactgaagaagaaggggggaaaaaaaaagaaagaaatctgagc 841 tttctgggaggaaattcaaaggaaccaagagaaattaacttcgttctgcaaggactaaag 901 tacagcaagaggagagaggtcaagcgagaagcgtgcgggaagcacatgccctggggaggc 961 atagaagccacactggcagagcggccagcacaggtagccagcagaggcattcttggggct 1021 atttgaaaaagtttggtctgtgaacaaaacagtttccctggtgactgcaaatccattgct 1081 agctgcctctttctcgtctgcccatcactctggtgtggtacccagaagttgacttctggt 1141 tctgtagaaagagctaggggaggtatgatgtgcttaaagatcctaagaataagcctggcg 1201 attttggctgggtgggcactctgttctgccaactctgagctgggctggacacgcaagaaa 1261 tccttggttgagagggaacacctgaatcaggtgctgttggaaggagaacgttgttggctg 1321 ggggccaaggttcgaagacccagagcttctccacagcatcacctctttggagtctacccc 1381 agcagggctgggaactacctaaggccctaccccgtgggggagcaagaaatccatcataca 1441 ggacgcagcaaaccagacactgaaggaaatgctgtgagccttgttcccccagacctgact 1501 gaaaatccagcaggactgaggggtgcagttgaagagccggctgccccatgggtaggggat 1561 agtcctattgggcaatctgagctgctgggagatgatgacgcttatctcggcaatcaaaga 1621 tccaaggagtctctaggtgaggccgggattcagaaaggctcagccatggctgccactact 1681 accaccgccattttcacaaccctgaacgaacccaaaccagagacccaaaggaggggctgg 1741 gccaagtccaggcagcgtcgccaagtgtggaagaggcgggcggaagatgggcagggagac 1801 tccggtatctcttcacatttccaaccttggcccaagcattcccttaaacacagggtcaaa 1861 aagagtccaccggaggaaagcaaccaaaatggtggagagggctcctaccgagaagcagag 1921 acctttaactcccaagtaggactgcccatcttatacttctctgggaggcgggagcggctg 1981 ctgctgcgtccagaagtgctggctgagattccccgggaggcgttcacagtggaagcctgg 2041 gttaaaccggagggaggacagaacaacccagccatcatcgcaggtgtgtttgataactgc 2101 tcccacactgtcagtgacaaaggctgggccctggggatccgctcagggaaggacaaggga 2161 aagcgggatgctcgcttcttcttctccctctgcaccgaccgcgtgaagaaagccaccatc 2221 ttgattagccacagtcgctaccaaccaggcacatggacccatgtggcagccacttacgat 2281 ggacggcacatggccctgtatgtggatggcactcaggtggctagcagtctagaccagtct 2341 ggtcccctgaacagccccttcatggcatcttgccgctctttgctcctggggggagacagc 2401 tctgaggatgggcactatttccgtggacacctgggcacactggttttctggtcgaccgcc 2461 ctgccacaaagccattttcagcacagttctcagcattcaagtggggaggaggaagcgact 2521 gacttggtcctgacagcgagctttgagcctgtgaacacagagtgggttccctttagagat 2581 gagaagtacccacgacttgaggttctccagggctttgagccagagcctgagattctgtcg 2641 cctttgcagcccccactctgtgggcaaacagtctgtgacaatgtggaattgatctcccag 2701 tacaatggatactggccccttcggggagagaaggtgatacgctaccaggtggtgaacatc 2761 tgtgatgatgagggcctaaaccccattgtgagtgaggagcagattcgtctgcagcacgag 2821 gcactgaatgaggccttcagccgctacaacatcagctggcagctgagcgtccaccaggtc 2881 cacaattccaccctgcgacaccgggttgtgcttgtgaactgtgagcccagcaagattggc 2941 aatgaccattgtgaccccgagtgtgagcacccactcacaggctatgatgggggtgactgc 3001 cgcctgcagggccgctgctactcctggaaccgcagggatgggctctgtcacgtggagtgt 3061 aacaacatgctgaacgactttgacgacggagactgctgcgacccccaggtggctgatgtg 3121 cgcaagacctgctttgaccctgactcacccaagagggcatacatgagtgtgaaggagctg 3181 aaggaggccctgcagctgaacagtactcacttcctcaacatctactttgccagctcagtg 3241 cgggaagaccttgcaggtgctgccacctggccttgggacaaggacgctgtcactcacctg 3301 ggtggcattgtcctcagcccagcatattatgggatgcctggccacaccgacaccatgatc 3361 catgaagtgggacatgttctgggactctaccatgtctttaaaggagtcagtgaaagagaa 3421 tcctgcaatgacccctgcaaggagacagtgccatccatggaaacgggagacctctgtgcc 3481 gacaccgcccccactcccaagagtgagctgtgccgggaaccagagcccactagtgacacc 3541 tgtggcttcactcgcttcccaggggctccgttcaccaactacatgagctacacgggtatc 3601 accactgtcttgttttgttttctgttaagaatacatgggggcctttgagagctgggaggg 3661 tggaggtgtgggagctgatgggagaatgattaagtggtcatttgtgtcggagagttgaag 3721 tgtatttattataaggtattattattttttcatgtctttgaagaacttgaagaaatactg 3781 acatattaaggtactttgttcactgaattctcctctactagatattttaaaatatacttc 3841 tatcctcgatagtaaaaaaggcacagagccaaaagccctcttgtgatccccttgacttct 3901 agaatgtggttattcttatttttgcccgcattcttagacatttactctgaagaagagtcc 3961 aatggaaataaaggaaaagagtttatgggtcaaggtggcccattgtactgtttttgaagt 4021 tggtcaacaaggtggcttggttaatttaggctcagcatgttttactgtatgttactaaaa 4081 aaaaaaaaaaaaaaaatcagattctctttttccagcactagtcaagcacaaattcttagc 4141 tgcctaccaccctttccccaccaaaaggtgacatctaattttaaaaaaatggcatcttcc 4201 tggccctcggaaaaacttgtcatctggtctttcttgccttaattcagcttctgtattatt 4261 cttcgctgtctctcacgccttccttgtttcttgtgaaaagtaatagtgactggtttccta 4321 taatggactcaaagttatccctaaaattaaagacttatttgatgacctag
[0095] The Genbank ID for the KRT20 gene is 54474. KRT20 is also referred to as keratin 20, K20, CD20, CK20, CK-20, KRT21, and cytokeratin 20. These alternative names for KRT20 may be used interchangeably herein. Unless stated otherwise, the term KRT20, as used herein, includes any KRT20 protein, or fragment thereof. The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. This cytokeratin is a major cellular protein of mature enterocytes and goblet cells and is specifically expressed in the gastric and intestinal mucosa. The type I cytokeratin genes are clustered in a region of chromosome 17q12-q21. The Genbank Accession No for the KRT20 genomic DNA is NG_012286.1. One isoform is listed on Genbank for KRT20, e.g., having Genebank Accession Nos. NP_061883.1 (corresponding nucleotide sequence NM_019010.2).
[0096] SEQ ID NO: 5 is the KRT20 Amino Acid Sequence (NP_061883.1; 424 aa).
TABLE-US-00005 1 mdfsrrsfhrslssslqapvvstvgmqrlgttpsvyggaggrgirisnsrhtvnygsdlt 61 gggdlfvgnekmamqnlndrlasylekvrtleqsnsklevqikqwyetnapragrdysay 121 yrqieelrsqikdaqlqnarcvlqidnaklaaedfrlkyetergirltveadlqglnkvf 181 ddltlhktdleiqieelnkdlallkkehqeevdglhkhlgntvnvevdaapglnlgvimn 241 emrqkyevmaqknlqeakeqferqtavlqqqvtvnteelkgtevqltelrrtsqsleiel 301 qshlsmkeslehtleetkaryssqlanlqsllssleaqlmqirsnmerqnneyhilldik 361 trleqeiatyrrllegedvktteyqlstleerdikktrkiktvvqevvdgkvvssevkev 421 eeni
[0097] SEQ ID NO: 6 is the KRT20 mRNA or cDNA Nucleotide Sequence (NM_019010.2; 1805 bp).
TABLE-US-00006 1 gagacacactctgccccaaccatcctgaagctacaggtgctccctcctggaatctccaat 61 ggatttcagtcgcagaagcttccacagaagcctgagctcctccttgcaggcccctgtagt 121 cagtacagtgggcatgcagcgcctcgggacgacacccagcgtttatgggggtgctggagg 181 ccggggcatccgcatctccaactccagacacacggtgaactatgggagcgatctcacagg 241 cggcggggacctgtttgttggcaatgagaaaatggccatgcagaacctaaatgaccgtct 301 agcgagctacctagaaaaggtgcggaccctggagcagtccaactccaaacttgaagtgca 361 aatcaagcagtggtacgaaaccaacgccccgagggctggtcgcgactacagtgcatatta 421 cagacaaattgaagagctgcgaagtcagattaaggatgctcaactgcaaaatgctcggtg 481 tgtcctgcaaattgataatgctaaactggctgctgaggacttcagactgaagtatgagac 541 tgagagaggaatacgtctaacagtggaagctgatctccaaggcctgaataaggtctttga 601 tgacctaaccctacataaaacagatttggagattcaaattgaagaactgaataaagacct 661 agctctcctcaaaaaggagcatcaggaggaagtcgatggcctacacaagcatctgggcaa 721 cactgtcaatgtggaggttgatgctgctccaggcctgaaccttggcgtcatcatgaatga 781 aatgaggcagaagtatgaagtcatggcccagaagaaccttcaagaggccaaagaacagtt 841 tgagagacagactgcagttctgcagcaacaggtcacagtgaatactgaagaattaaaagg 901 aactgaggttcaactaacggagctgagacgcacctcccagagccttgagatagaactcca 961 gtcccatctcagcatgaaagagtctttggagcacactctagaggagaccaaggcccgtta 1021 cagcagccagttagccaacctccagtcgctgttgagctctctggaggcccaactgatgca 1081 gattcggagtaacatggaacgccagaacaacgaataccatatccttcttgacataaagac 1141 tcgacttgaacaggaaattgctacttaccgccgccttctggaaggagaagacgtaaaaac 1201 tacagaatatcagttaagcaccctggaagagagagatataaagaaaaccaggaagattaa 1261 gacagtcgtgcaagaagtagtggatggcaaggtcgtgtcatctgaagtcaaagaggtgga 1321 agaaaatatctaaatagctaccagaaggagatgctgctgaggttttgaaagaaatttggc 1381 tataatcttatctttgctccctgcaagaaatcagccataagaaagcactattaatactct 1441 gcagtgattagaaggggtggggtggcgggaatcctatttatcagactctgtaattgaata 1501 taaatgttttactcagaggagctgcaaattgcctgcaaaaatgaaatccagtgagcacta 1561 gaatatttaaaacatcattactgccatctttatcatgaagcacatcaattacaagctgta 1621 gaccacctaatatcaatttgtaggtaatgttcctgaaaattgcaatacatttcaattata 1681 ctaaacctcacaaagtagaggaatccatgtaaattgcaaataaaccactttctaattttt 1741 tcctgtttctgaattgtaaaaccccctttgggagtccctggtttcttattgagccaattt 1801 ctggg
[0098] The Genbank ID for the TACSTD2 gene is 4070. TACSTD2 is also referred to as tumor-associated calcium signal transducer 2, EGP1, GP50, M1S1, EGP-1, TROP2, GA7331, GA733-1. These alternative names for TACSTD2 may be used interchangeably herein. Unless stated otherwise, the term TACSTD2, as used herein, includes any TACSTD2 protein, or fragment thereof. This intronless gene encodes a carcinoma-associated antigen. This antigen is a cell surface receptor that transduces calcium signals. Mutations of this gene have been associated with gelatinous drop-like corneal dystrophy. The Genbank Accession No for the TACSTD2 genomic DNA is NG 016237.1. One isoform is listed on Genbank for TACSTD2, e.g., having Genebank Accession Nos. NP_002344.2 (corresponding nucleotide sequence NM 002353.2).
[0099] SEQ ID NO: 7 is the TACSTD2 Amino Acid Sequence (NP_002344.2; 323 aa).
TABLE-US-00007 1 margpglappplrlpllllvlaavtghtaaqdnctcptnkmtvcspdgpggrcqcralgs 61 gmavdcstltskclllkarmsapknartlvrpsehalvdndglydpdcdpegrfkarqcn 121 qtsvcwcvnsvgvrrtdkgdlslrcdelvrthhilidlrhrptagafnhsdldaelrrlf 181 reryrlhpkfvaavhyeqptiqielrqntsqkaagdvdigdaayyferdikgeslfqgrg 241 gldlrvrgeplqvertliyyldeippkfsmkrltagliavivvvvvalvagmavlvitnr 301 rksgkykkveikelgelrkepsl
[0100] SEQ ID NO: 8 is the TACSTD2 mRNA or cDNA Nucleotide Sequence (NM_002353.2; 2080 bp).
TABLE-US-00008 1 gcgggtccccagaagcctacaggtgagtatcggttctccccttcccggctttcggtccgg 61 aggaggcgggagcagcttccctgttctgatcctatcgcgggcggcgcagggccggcttgg 121 ccttccgtgggacggggaggggggcgggatgtgtcacccaaataccagtggggacggtcg 181 gtggtggaaccagccgggcaggtcgggtagagtataagagccggagggagcggccgggcg 241 gcagacgcctgcagaccatcccagacgccggagcccgagccccgacgagtccccgcgcct 301 catccgcccgcgtccggtccgcgttcctccgccccaccatggctcggggccccggcctcg 361 cgccgccaccgctgcggctgccgctgctgctgctggtgctggcggcggtgaccggccaca 421 cggccgcgcaggacaactgcacgtgtcccaccaacaagatgaccgtgtgcagccccgacg 481 gccccggcggccgctgccagtgccgcgcgctgggctcgggcatggcggtcgactgctcca 541 cgctgacctccaagtgtctgctgctcaaggcgcgcatgagcgcccccaagaacgcccgca 601 cgctggtgcggccgagtgagcacgcgctcgtggacaacgatggcctctacgaccccgact 661 gcgaccccgagggccgcttcaaggcgcgccagtgcaaccagacgtcggtgtgctggtgcg 721 tgaactcggtgggcgtgcgccgcacggacaagggcgacctgagcctacgctgcgatgagc 781 tggtgcgcacccaccacatcctcattgacctgcgccaccgccccaccgccggcgccttca 841 accactcagacctggacgccgagctgaggcggctcttccgcgagcgctatcggctgcacc 901 ccaagttcgtggcggccgtgcactacgagcagcccaccatccagatcgagctgcggcaga 961 acacgtctcagaaggccgccggtgacgtggatatcggcgatgccgcctactacttcgaga 1021 gggacatcaagggcgagtctctattccagggccgcggcggcctggacttgcgcgtgcgcg 1081 gagaacccctgcaggtggagcgcacgctcatctattacctggacgagattcccccgaagt 1141 tctccatgaagcgcctcaccgccggcctcatcgccgtcatcgtggtggtcgtggtggccc 1201 tcgtcgccggcatggccgtcctggtgatcaccaaccggagaaagtcggggaagtacaaga 1261 aggtggagatcaaggaactgggggagttgagaaaggaaccgagcttgtaggtacccggcg 1321 gggcaggggatggggtggggtaccggatttcggtatcgtcccagacccaagtgagtcacg 1381 cttcctgattcctcggcgcaaaggagacgtttatcctttcaaattcctgccttccccctc 1441 ccttttgcgcacacaccaggtttaatagatcctggcctcagggtctcctttctttctcac 1501 ttctgtcttgaaggaagcatttctaaaatgtatcccctttcggtccaacaacaggaaacc 1561 tgactggggcagtgaaggaagggatggcatagcgttatgtgtaaaaaacaagtatctgta 1621 tgacaacccgggatcgtttgcaagtaactgaatccattgcgacattgtgaaggcttaaat 1681 gagtttagatgggaaatagcgttgttatcgccttgggtttaaattatttgatgagttcca 1741 cttgtatcatggcctacccgaggagaagaggagtttgttaactgggcctatgtagtagcc 1801 tcatttaccatcgtttgtattactgaccacatatgcttgtcactgggaaagaagcctgtt 1861 tcagctgcctgaacgcagtttggatgtctttgaggacagacattgcccggaaactcagtc 1921 tatttattcttcagcttgcccttactgccactgatattggtaatgttcttttttgtaaaa 1981 tgtttgtacatatgttgtctttgataatgttgctgtaattttttaaaataaaacacgaat 2041 ttaataaaatatgggaaaggcacaaaccagaaaaaaaaaa
[0101] The Genbank ID for the NGAL gene is 3934. The abbreviation NGAL refers to Neutrophil Gelatinase Associated Lipocalin. NGAL is also referred to in the art as human neutrophil lipocalin, siderocalin, a-micropglobulin related protein, Scn-NGAL, lipocalin 2, 24p3, superinducible protein 24 (SIP24), uterocalin, neu-related lipocalin, LCN2, p25, 24p3, and MSFI. This gene encodes a protein that belongs to the lipocalin family. These alternative names for NGAL may be used interchangeably herein. Unless stated otherwise, the term NGAL, as used herein, includes any NGAL protein, or fragment thereof. The Genbank Accession No for the NGAL genomic DNA is NC_000009.12. One isoform is listed on Genbank for NGAL, e.g., having Genebank Accession Nos. NP_005555.2 (corresponding nucleotide sequence NM_005564.4).
[0102] NGAL is a small protein with a molecular weight of about 22 kD and is a siderophore binding protein. A siderophore is an organic molecule that binds to and chelates iron. Bacteria produce the siderophore enterochelin, and mammals endogenously express a similar type, but simpler molecule called catechol. Enterochelin has an extremely high affinity for iron, and wild type NGAL has a high affinity for the enterochelin-iron complex. The enterochelin-iron-NGAL complex is pH insensitive and the bound iron is redox inactive. Thus the iron bound by such NGAL complexes is not available to catalyze oxygen radical formation, making NGAL an ideal iron chelator for in vivo use.
[0103] NGAL, and once produced in cells, is secreted into extracellular space and quickly cleared by kidney with a half-life of 10 minutes. Serum and urine levels of the protein can become very high in a number of disease models. The NGAL protein is transported into the kidney of healthy humans and can pass the filtration barrier of the glomerulus (the cut-off size of filtration is about 70 kD) to enter the primary urine, but then NGAL is efficiently reabsorbed by megalin or megalin-cubilin-cubilin receptors localized on the apical side of the epithelia of the proximal tubules. Megalin is a universal receptor with broad substrate specificity and is expressed at the apical surface of the proximal tubules of the kidney where it is involved in protein reabsorption. The binding of megalin to its substrates is mediated by ionic interactions, and its negative charged substrate binding domains can efficiently bind to the positively charged surfaces of proteins in the urinary filtrate. Once absorbed and endocytosed, NGAL is trafficked to lysosomes, where it is degraded. Once degraded, the iron which NGAL transported to the kidney is reabsorbed.
[0104] SEQ ID NO: 9 is the NGAL Amino Acid Sequence (NP_005555.2; 198 aa).
TABLE-US-00009 1 mplgllwlglallgalhaqaqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagna 61 ilredkdpqkmyatiyelkedksynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksy 121 pgltsylvrvvstnynqhamvffkkvsqnreyfkitlygrtkeltselkenfirfskslg 181 lpenhivfpvpidqcidg
[0105] SEQ ID NO: 10 is the NGAL mRNA or cDNA Nucleotide Sequence (NM_002353.2; 2080 bp).
TABLE-US-00010 1 agggccacccaggtgagcctctcactcgccacctcctcttccacccctgccaggcccagc 61 agccaccacagcgcctgcttcctcggccctgaaatcatgcccctaggtctcctgtggctg 121 ggcctagccctgttgggggctctgcatgcccaggcccaggactccacctcagacctgatc 181 ccagccccacctctgagcaaggtccctctgcagcagaacttccaggacaaccaattccag 241 gggaagtggtatgtggtaggcctggcagggaatgcaattctcagagaagacaaagacccg 301 caaaagatgtatgccaccatctatgagctgaaagaagacaagagctacaatgtcacctcc 361 gtcctgtttaggaaaaagaagtgtgactactggatcaggacttttgttccaggttgccag 421 cccggcgagttcacgctgggcaacattaagagttaccctggattaacgagttacctcgtc 481 cgagtggtgagcaccaactacaaccagcatgctatggtgttcttcaagaaagtttctcaa 541 aacagggagtacttcaagatcaccctctacgggagaaccaaggagctgacttcggaacta 601 aaggagaacttcatccgcttctccaaatctctgggcctccctgaaaaccacatcgtcttc 661 cctgtcccaatcgaccagtgtatcgacggctgagtgcacaggtgccgccagctgccgcac 721 cagcccgaacaccattgagggagctgggagaccctccccacagtgccacccatgcagctg 781 ctccccaggccaccccgctgatggagccccaccttgtctgctaaataaacatgtgccctc 841 aggccaaaaaaaaaaaaaaaaaa
[0106] As used herein, a PAPPA2 molecule can be a nucleic acid (e.g., synthetic, purified, and/or recombinant) which encodes a polypeptide corresponding to a PAPPA2 protein, or a PAPPA2 protein, or fragment thereof. For example, a PAPPA2 molecule can comprise the amino acid sequence shown in SEQ ID NOs: 1 or 2, or can comprise the nucleic acid sequence shown in SEQ ID NOs: 3 or 4. A PAPPA2 molecule can include a variant of the above described examples, such as a fragment thereof.
[0107] As used herein, a KRT20 molecule can be a nucleic acid (e.g., synthetic, purified, and/or recombinant) which encodes a polypeptide corresponding to a KRT20 protein, or a KRT20 protein, or fragment thereof. For example, a KRT20 molecule can comprise the amino acid sequence shown in SEQ ID NO: 5, or can comprise the nucleic acid sequence shown in SEQ ID NO: 6. A KRT20 molecule can include a variant of the above described examples, such as a fragment thereof.
[0108] As used herein, a TACSTD2 molecule can be a nucleic acid (e.g., synthetic, purified, and/or recombinant) which encodes a polypeptide corresponding to a TACSTD2 protein, or a TACSTD2 protein, or fragment thereof. For example, a TACSTD2 molecule can comprise the amino acid sequence shown in SEQ ID NO: 7, or can comprise the nucleic acid sequence shown in SEQ ID NO: 8. A TACSTD2 molecule can include a variant of the above described examples, such as a fragment thereof.
[0109] As used herein, a NGAL molecule can be a nucleic acid (e.g., synthetic, purified, and/or recombinant) which encodes a polypeptide corresponding to a NGAL protein, or a NGAL protein, or fragment thereof. For example, a NGAL molecule can comprise the amino acid sequence shown in SEQ ID NO: 9, or can comprise the nucleic acid sequence shown in SEQ ID NO: 10. A NGAL molecule can include a variant of the above described examples, such as a fragment thereof.
[0110] The nucleic acid can be any type of nucleic acid, including genomic DNA, complementary DNA (cDNA), recombinant DNA, synthetic or semi-synthetic DNA, as well as any form of corresponding RNA. A cDNA is a form of DNA artificially synthesized from a messenger RNA template and is used to produce gene clones. A synthetic DNA is free of modifications that can be found in cellular nucleic acids, including, but not limited to, histones and methylation. For example, a nucleic acid encoding a molecule of the invention can comprise a recombinant nucleic acid encoding such a protein. The nucleic acid can be a non-naturally occurring nucleic acid created artificially (such as by assembling, cutting, ligating or amplifying sequences). It can be double-stranded or single-stranded.
[0111] The invention further provides for nucleic acids that are complementary to a PAPPA2, KRT20, TACSTD2, or NGAL molecule. Complementary nucleic acids can hybridize to the nucleic acid sequence described above under stringent hybridization conditions. Non-limiting examples of stringent hybridization conditions include temperatures above 30 C., above 35 C., in excess of 42 C., and/or salinity of less than about 500 mM, or less than 200 mM. Hybridization conditions can be adjusted by the skilled artisan via modifying the temperature, salinity and/or the concentration of other reagents such as SDS or SSC.
[0112] According to the invention, protein variants can include amino acid sequence modifications. For example, amino acid sequence modifications fall into one or more of three classes: substitutional, insertional or deletional variants. Insertions can include amino and/or carboxyl terminal fusions as well as intrasequence insertions of single or multiple amino acid residues. Insertions ordinarily will be smaller insertions than those of amino or carboxyl terminal fusions, for example, on the order of one to four residues. Deletions are characterized by the removal of one or more amino acid residues from the protein sequence. These variants ordinarily are prepared by site-specific mutagenesis of nucleotides in the DNA encoding the protein, thereby producing DNA encoding the variant, and thereafter expressing the DNA in recombinant cell culture.
[0113] In one embodiment, a molecule of the invention comprises a protein or polypeptide, such as the sequences shown in SEQ ID NOS: 1-2, 5, 7, or 9. In some embodiments, the protein or polypeptide is about 70%, about 75%, about 80%, about 85%, about 90%, about 93%, about 95%, about 97%, about 98%, or about 99% identical to SEQ ID NOS: 1-2, 5, 7, or 9. In another embodiment, the polypeptide can be modified, such as by glycosylations and/or acetylations and/or chemical reaction or coupling, and can contain one or several non-natural or synthetic amino acids. In another embodiment, a molecule of the invention can be a fragment of a protein. For example, the molecule of the invention can encompass any portion of at least about 8 consecutive amino acids of SEQ ID NOS: 1-2, 5, 7, or 9. The fragment can comprise at least about 10 amino acids, a least about 20 amino acids, at least about 30 amino acids, at least about 40 amino acids, a least about 50 amino acids, at least about 60 amino acids, or at least about 75 amino acids of SEQ ID NOS: 1-2, 5, 7, or 9. Fragments include all possible amino acid lengths between about 8 and 100 about amino acids, for example, lengths between about 10 and 100 amino acids, between about 15 and 100 amino acids, between about 20 and 100 amino acids, between about 35 and 100 amino acids, between about 40 and 100 amino acids, between about 50 and 100 amino acids, between about 70 and 100 amino acids, between about 75 and 100 amino acids, or between about 80 and 100 amino acids.
[0114] Chemical Synthesis. Nucleic acid sequences encoding a molecule can be synthesized, in whole or in part, using chemical methods known in the art. Alternatively, a polypeptide can be produced using chemical methods to synthesize its amino acid sequence, such as by direct peptide synthesis using solid-phase techniques. Protein synthesis can either be performed using manual techniques or by automation. Automated synthesis can be achieved, for example, using Applied Biosystems 431A Peptide Synthesizer (Perkin Elmer).
[0115] Optionally, polypeptides fragments can be separately synthesized and combined using chemical methods to produce a full-length molecule. For example, these methods can be utilized to synthesize a protein of the invention.
[0116] Obtaining, Purifying and Detecting PAPPA2, KRT20, TACSTD2, and NGAL molecules. A polypeptide, such as PAPPA2, KRT20, TACSTD2, or NGAL, can be obtained by purification from a sample. Non-limiting purification methods include size exclusion chromatography, ammonium sulfate fractionation, ion exchange chromatography, affinity chromatography, and preparative gel electrophoresis.
[0117] The expression of a polypeptide can be measured or detected using either polyclonal or monoclonal antibodies specific for the polypeptide. Non-limiting examples include enzyme-linked immunosorbent assay (ELISA), and radioimmunoassay (RIA). A two-site, monoclonal-based immunoassay using monoclonal antibodies reactive to two non-interfering epitopes on a polypeptide can be used, or a competitive binding assay can be employed.
[0118] Labeling and conjugation techniques are known by those skilled in the art and can be used in various nucleic acid and amino acid assays. Methods for producing labeled hybridization or PCR probes for detecting sequences related to nucleic acid sequences encoding a protein, include, but are not limited to, oligolabeling, nick translation, end-labeling, or PCR amplification using a labeled nucleotide. Alternatively, nucleic acid sequences, can be cloned into a vector for the production of an mRNA probe. Such vectors are known in the art, are commercially available, and can be used to synthesize RNA probes in vitro by addition of labeled nucleotides and an appropriate RNA polymerase such as T7, T3, or SP6. These procedures can be conducted using a variety of commercially available kits (Amersham Pharmacia Biotech, Promega, and US Biochemical). Suitable reporter molecules or labels which can be used for ease of detection include radionuclides, enzymes, and fluorescent, chemiluminescent, or chromogenic agents, as well as substrates, cofactors, inhibitors, and/or magnetic particles.
[0119] A fragment can be a fragment of a protein, such as a PAPPA2, KRT20, TACSTD2, or NGAL protein. For example, a fragment of a a PAPPA2, KRT20, TACSTD2, or NGAL molecule can encompass any portion of at least about 8 consecutive amino acids of SEQ ID NOs: 1-2, 5, 7, or 9. The fragment can comprise at least about 10 consecutive amino acids, at least about 20 consecutive amino acids, at least about 30 consecutive amino acids, at least about 40 consecutive amino acids, a least about 50 consecutive amino acids, at least about 60 consecutive amino acids, at least about 70 consecutive amino acids, at least about 75 consecutive amino acids, at least about 80 consecutive amino acids, at least about 85 consecutive amino acids, at least about 90 consecutive amino acids, at least about 95 consecutive amino acids, at least about 100 consecutive amino acids, at least about 200 consecutive amino acids, at least about 300 consecutive amino acids, at least about 400 consecutive amino acids, at least about 500 consecutive amino acids, at least about 600 consecutive amino acids, at least about 700 consecutive amino acids, or at least about 800 consecutive amino acids of SEQ ID NOs: 1-2, 5, 7, or 9. Fragments include all possible amino acid lengths between about 8 and 100 about amino acids, for example, lengths between about 10 and about 100 amino acids, between about 15 and about 100 amino acids, between about 20 and about 100 amino acids, between about 35 and about 100 amino acids, between about 40 and about 100 amino acids, between about 50 and about 100 amino acids, between about 70 and about 100 amino acids, between about 75 and about 100 amino acids, or between about 80 and about 100 amino acids.
[0120] Polypeptides of the present invention comprising fragments of at least 8 contiguous amino acids, often at least 15 contiguous amino acids, are useful as immunogens for raising antibodies that recognize polypeptides of the present invention. See, e.g., Lerner, Nature 299: 592-596 (1982); Shinnick et al., Annu. Rev. Microbiol. 37: 425-46 (1983); Sutcliffe et al., Science 219: 660-6 (1983). As further described in the references cited herein, 8-mers, conjugated to a carrier, such as a protein, prove immunogenic and are capable of eliciting antibody for the conjugated peptide; accordingly, fragments of at least 8 amino acids of the polypeptides of the present invention have utility as immunogens.
[0121] Polypeptides comprising fragments of at least 8, 9, 10 or 12 contiguous amino acids are also useful as competitive inhibitors of binding of the entire polypeptide, or a portion thereof, to antibodies (as in epitope mapping), and to natural binding partners, such as subunits in a multimeric complex or to receptors or ligands of the subject protein; this competitive inhibition permits identification and separation of molecules that bind specifically to the polypeptide of interest. See U.S. Pat. Nos. 5,539,084 and 5,783,674, incorporated herein by reference in their entireties.
[0122] The polypeptides of the present invention thus can be at least 6 amino acids in length, at least 8 amino acids in length, at least 9 amino acids in length, at least 10 amino acids in length, at least 12 amino acids in length, at least 15 amino acids in length, at least 20 amino acids in length, at least 25 amino acids in length, at least 30 amino acids in length, at least 35 amino acids in length, at least 50 amino acids in length, at least 75 amino acids in length, at least 100 amino acids in length, or at least 150 amino acids in length. Polypeptides of the present invention can also be larger and comprise a full-length protein and/or an epitope tag and/or a fusion protein.
[0123] One having ordinary skill in the art can produce fragments by truncating the nucleic acid molecule, encoding the polypeptide and then expressing it recombinantly. Alternatively, one can produce a fragment by chemically synthesizing a portion of the full-length polypeptide. One can also produce a fragment by enzymatically cleaving a recombinant polypeptide or an isolated naturally occurring polypeptide. Methods of producing polypeptide fragments are well known in the art. See, e.g., Sambrook (1989), supra; Sambrook (2001), supra; Ausubel (1992), supra; and Ausubel (1999), supra. In one embodiment, a polypeptide comprising only a fragment can be produced by chemical or enzymatic cleavage of a polypeptide.
[0124] Polypeptides of the present invention are also inclusive of mutants, fusion proteins, homologous proteins and allelic variants.
[0125] A mutant protein can have the same or different properties compared to a naturally occurring polypeptide and comprises at least one amino acid insertion, duplication, deletion, rearrangement or substitution compared to the amino acid sequence of a native polypeptide. Small deletions and insertions can often be found that do not alter the function of a protein. The mutant protein can be a polypeptide that comprises at least one amino acid insertion, duplication, deletion, rearrangement or substitution compared to the amino acid sequence of SEQ ID NO: 1-2, 5, 7, or 9. Accordingly, in one embodiment, the mutant protein is one that exhibits at least 60% sequence identity, at least 70%, or at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 97%, sequence identity at least 985, sequence identity at least 99% or sequence identity at least 99.5% to SEQ ID NO: 1-2, 5, 7, or 9.
[0126] The invention also contemplates polypeptides that are homologous to a polypeptide of the invention. By homologous polypeptide it is meant one that exhibits significant sequence identity to a PAPPA2, NGAL, KRT20, or TACSTD2 protein. By significant sequence identity it is meant that the homologous polypeptide exhibits at least exhibits at least 60% sequence identity, at least 70%, or at least 80% sequence identity, at least 85% sequence identity, at least 90% sequence identity, at least 95% sequence identity, at least 97%, sequence identity at least 985, sequence identity at least 99% or sequence identity at least 99.5% to a PAPPA2, NGAL, KRT20, or TACSTD2 protein. In one embodiment, the amino acid substitutions of the homologous polypeptide are conservative amino acid substitutions.
[0127] Homologous polypeptides of the present invention can be naturally occurring and derived from another species, especially one derived from another primate, such as chimpanzee, gorilla, rhesus macaque, or baboon, wherein the homologous polypeptide comprises an amino acid sequence that exhibits significant sequence identity to a polypeptide of the invention. The homologous polypeptide can also be a naturally occurring polypeptide from a human, when the PAPPA2, NGAL, KRT20, or TACSTD2 protein is a member of a family of polypeptides. The homologous polypeptide can also be a naturally occurring polypeptide derived from a non-primate, mammalian species, including without limitation, domesticated species, e.g., dog, cat, mouse, rat, rabbit, guinea pig, hamster, cow, horse, goat or pig. The homologous polypeptide can also be a naturally occurring polypeptide derived from a non-mammalian species, such as birds or reptiles. The naturally occurring homologous protein can be isolated directly from humans or other species. Alternatively, the nucleic acid molecule encoding the naturally occurring homologous polypeptide can be isolated and used to express the homologous polypeptide recombinantly. The homologous polypeptide can also be one that is experimentally produced by random mutation of a nucleic acid molecule and subsequent expression of the nucleic acid molecule. Alternatively, the homologous polypeptide can be one that is experimentally produced by directed mutation of one or more codons to alter the encoded amino acid of a PAPPA2, NGAL, KRT20, or TACSTD2 protein.
[0128] Relatedness of proteins can also be characterized using a second functional test, the ability of a first protein competitively to inhibit the binding of a second protein to an antibody. It is, therefore, another aspect of the present invention to provide isolated polpeptide not only identical in sequence to those described herein, but also to provide isolated polypeptide (cross-reactive proteins) that can competitively inhibit the binding of antibodies to all or to a portion of various of the isolated polypeptides of the present invention. Such competitive inhibition can readily be determined using immunoassays well known in the art.
[0129] As discussed herein, single nucleotide polymorphisms (SNPs) occur frequently in eukaryotic genomes, and the sequence determined from one individual of a species can differ from other allelic forms present within the population. Thus, polypeptides of the present invention are also inclusive of those encoded by an allelic variant of a nucleic acid molecule encoding a PAPPA2, NGAL, KRT20, or TACSTD2 protein.
[0130] Polypeptides of the present invention are also inclusive of derivative polypeptides encoded by a nucleic acid molecule according to the invention. Also inclusive are derivative polypeptides having an amino acid sequence selected from the group consisting of SEQ ID NOs: 1, 2, 5, 7, and 9 and which has been acetylated, carboxylated, phosphorylated, glycosylated, ubiquitinated or other post-translational modifications. In another embodiment, the derivative has been labeled with, e.g., radioactive isotopes such as 125I, 32P, 35S, and 3H. In another embodiment, the derivative has been labeled with fluorophores, chemiluminescent agents, enzymes, and antiligands that can serve as specific binding pair members for a labeled ligand.
[0131] Polypeptide modifications are well known to those of skill and have been described in detail in the scientific literature. Several common modifications, such as glycosylation, lipid attachment, sulfation, gamma-carboxylation of glutamic acid residues, hydroxylation and ADP-ribosylation, for instance, are described in most basic texts, such as, for instance Creighton, Protein Structure and Molecular Properties, 2nd ed., W.H. Freeman and Company (1993). Many detailed reviews are available on this subject, such as, for example, those provided by Wold, in Johnson (ed.), Posttranslational Covalent Modification of Proteins, pgs. 1-12, Academic Press (1983); Seifter et al., Meth. Enzymol. 182: 626-646 (1990) and Rattan et al., Ann. N.Y. Acad. Sci. 663: 48-62 (1992).
[0132] One can determine whether a polypeptide of the invention will be post-translationally modified by analyzing the sequence of the polypeptide to determine if there are peptide motifs indicative of sites for post-translational modification. There are a number of computer programs that permit prediction of post-translational modifications. See, e.g., expasy with the extension .org of the world wide web (accessed Nov. 11, 2002), which includes PSORT, for prediction of protein sorting signals and localization sites, SignalP, for prediction of signal peptide cleavage sites, MITOPROT and Predotar, for prediction of mitochondrial targeting sequences, NetOGlyc, for prediction of type O-glycosylation sites in mammalian proteins, big-PI Predictor and DGPI, for prediction of prenylation-anchor and cleavage sites, and NetPhos, for prediction of Ser, Thr and Tyr phosphorylation sites in eukaryotic proteins. Other computer programs, such as those included in GCG, also can be used to determine post-translational modification peptide motifs.
[0133] Examples of types of post-translational modifications include, but are not limited to: (Z)-dehydrobutyrine; 1-chondroitin sulfate-L-aspartic acid ester; 1-glycosyl-L-tryptophan; 1-phospho-L-histidine; 1-thioglycine; 2-(S-L-cysteinyl)-L-histidine; 2-[3-carboxamido(trimethylammonio)propyl]-L-histidine; 2-alpha-mannosyl-L-tryptophan; 2-methyl-L-glutamine; 2-oxobutanoic acid; 2-pyrrolidone carboxylic acid; 3-(1-L-histidyl)-L-tyrosine; 3-(8alpha-FAD)-L-histidine; 3-(S-L-cysteinyl)-L-tyrosine; 3, 3, 5-triiodo-L-thyronine; 3-4-phospho-L-tyrosine; 3-hydroxy-L-proline; 3-methyl-L-histidine; 3-methyl-L-lanthionine; 3-phospho-L-histidine; 4-(L-tryptophan)-L-tryptophyl quinone; 42 N-cysteinyl-glycosylphosphatidylinositolethanolamine; 43-(T-L-histidyl)-L-tyrosine; 4-hydroxy-L-arginine; 4-hydroxy-L-lysine; 4-hydroxy-L-proline; 5-(N6-L-lysine)-L-topaquinone; 5-hydroxy-L-lysine; 5-methyl-L-arginine; alpha-1-microglobulin-Ig alpha complex chromophore; bis-L-cysteinyl bis-L-histidino diiron disulfide; bis-L-cysteinyl-L-N3-histidino-L-serinyI tetrairon tetrasulfide; chondroitin sulfate D-glucuronyl-D-galactosyl-D-galactosyl-D-xylosyl-L-serine; //D-alanine; D-allo-isoleucine; D-asparagine; dehydroalanine; dehydrotyrosine; dermatan 4-sulfate D-glucuronyl-D-galactosyl-D-galactosyl-D-xylosyl-L-serine; D-glucuronyl-N-glycine; dipyrrolylmethanemethyl-L-cysteine; D-leucine; D-methionine; D-phenylalanine; D-serine; D-tryptophan; glycine amide; glycine oxazolecarboxylic acid; glycine thiazolecarboxylic acid; heme P450-bis-L-cysteine-L-tyrosine; heme-bis-L-cysteine; hemediol-L-aspartyl ester-L-glutamyl ester; hemediol-L-aspartyl ester-L-glutamyl ester-L-methionine sulfonium; heme-L-cysteine; heme-L-histidine; heparan sulfate D-glucuronyl-D-galactosyl-D-galactosyl-D-xylosyl-L-serine; heme P450-bis-L-cysteine-L-lysine; hexakis-L-cysteinyl hexairon hexasulfide; keratan sulfate D-glucuronyl-D-galactosyl-D-galactosyl-D-xylosyl-L-threonine; L oxoalanine-lactic acid; L phenyllactic acid; 1-(8alpha-FAD)-L-histidine; L-2.4.5-topaquinone; L-3,4-dihy droxyphenylalanine; L-3.4.5-trihydroxyphenylalanine; L-4-bromophenylalanine; L-6-bromotryptophan; L-alanine amide; L-alanyl imidazolinone glycine; L-allysine; L-arginine amide; L-asparagine amide; L-aspartic 4-phosphoric anhydride; L-aspartic acid 1-amide; L-beta-methylthioaspartic acid; L-bromohistidine; L-citrulline; L-cysteine amide; L-cysteine glutathione disulfide; L-cysteine methyl disulfide; L-cysteine methyl ester; L-cysteine oxazolecarboxylic acid; L-cysteine oxazolinecarboxylic acid; L-cysteine persulfide; L-cysteine sulfenic acid; L-cysteine sulfinic acid; L-cysteine thiazolecarboxylic acid; L-cysteinyl homocitryl molybdenum-heptairon-nonasulfide; L-cysteinyl imidazolinone glycine; L-cysteinyl molybdopterin; L-cysteinyl molybdopterin guanine dinucleotide; L-cystine; L-erythro-beta-hydroxyasparagine; L-erythro-beta-hydroxyaspartic acid; L-gamma-carboxyglutarnic acid; L-glutamic acid 1-amide; L-glutamic acid 5-methyl ester; L-glutamine amide; L-glutamyl 5-glycerylphosphorylethanolarnine; L-histidine amide; L-isoglutamyl-polyglutamic acid; L-isoglutamyl-polyglycine; L-isoleucine amide; L-lanthionine; L-leucine amide; L-lysine amide; L-lysine thiazolecarboxylic acid; L-lysinoalanine; L-methionine amide; L-methionine sulfone; L-phenyalanine thiazolecarboxylic acid; L-phenylalanine amide; L-proline amide; L-selenocysteine; L-selenocysteinyl molybdopterin guanine dinucleotide; L-serine amide; L-serine thiazolecarboxylic acid; L-seryl imidazolinone glycine; L-T-bromophenylalanine; L-T-bromophenylalanine; L-threonine amide; L-thyroxine; L-tryptophan amide; L-tryptophyl quinone; L-tyrosine amide; L-valine amide; meso-lanthionine; N-(L-glutamyl)-L-tyrosine; N-(L-isoaspartyl)-glycine; N-(L-isoaspartyl)-L-cysteine; N,N,N-trimethyl-L-alanine; N,N-dimethyl-L-proline; N2-acetyl-L-lysine; N2-succinyl-L-tryptophan; N4-(ADP-ribosyl)-L-asparagine; N4-glycosyl-L-asparagine; N4-hydroxymethyl-L-asparagine; N4-methyl-L-asparagine; N5-methyl-L-glutamine; N6-1-carboxyethyl-L-lysine; N6-(4-amino hydroxybutyl)-L-lysine; N6-(L-isoglutamyl)-L-lysine; N6-(phospho-5-adenosine)-L-lysine; N6-(phospho-5-guanosine)-L-lysine; N6,N6,N6-trimethyl-L-lysine; N6,N6-dimethyl-L-lysine; N6-acetyl-L-lysine; N6-biotinyl-L-lysine; N6-carboxy-L-lysine; N6-formyl-L-lysine; N6-glycyl-L-lysine; N6-lipoyl-L-lysine; N6-methyl-L-lysine; N6-methyl-N6-poly(N-methyl-propylamine)-L-lysine; N6-mureinyl-L-lysine; N6-myristoyl-L-lysine; N6-palmitoyl-L-lysine; N6-pyridoxal phosphate-L-lysine; N6-pyruvic acid 2-iminyl-L-lysine; N6-retinal-L-lysine; N-acetylglycine; N-acetyl-L-glutamine; N-acetyl-L-alanine; N-acetyl-L-aspartic acid; N-acetyl-L-cysteine; N-acetyl-L-glutamic acid; N-acetyl-L-isoleucine; N-acetyl-L-methionine; N-acetyl-L-proline; N-acetyl-L-serine; N-acetyl-L-threonine; N-acetyl-L-tyrosine; N-acetyl-L-valine; N-alanyl-glycosylphosphatidylinositolethanolamine; N-asparaginyl-glycosylphosphatidylinositolethanolamine; N-aspartyl-glycosylphosphatidylinositolethanolamine; N-formylglycine; N-formyl-L-methionine; N-glycyl-glycosylphosphatidylinositolethanolamine; N-L-glutamyl-poly-L-glutamic acid; N-methylglycine; N-methyl-L-alanine; N-methyl-L-methionine; N-methyl-L-phenylalanine; N-myristoyl-glycine; N-palmitoyl-L-cysteine; N-pyruvic acid 2-iminyl-L-cysteine; N-pyruvic acid 2-iminyl-L-valine; N-seryl-glycosylphosphatidylinositolethanolamine; N-seryl-glycosyOSPhingolipidinositolethanolamine; O-(ADP-ribosyl)-L-serine; O-(phospho-5-adenosine)-L-threonine; O-(phospho-5-DNA)-L-serine; O-(phospho-5-DNA)-L-threonine; O-(phospho-5rRNA)-L-serine; O-(phosphoribosyl dephospho-coenzyme A)-L-serine; O-(sn-1-glycerophosphoryl)-L-serine; O4-(8alpha-FAD)-L-tyrosine; O4-(phospho-5-adenosine)-L-tyrosine; O4-(phospho-5-DNA)-L-tyrosine; O4-(phospho-5-RNA)-L-tyrosine; O4-(phospho-5-uridine)-L-tyrosine; O4-glycosyl-L-hydroxyproline; O4-glycosyl-L-tyrosine; O4-sulfo-L-tyrosine; O5-glycosyl-L-hydroxylysine; O-glycosyl-L-serine; O-glycosyl-L-threonine; omega-N-(ADP-ribosyl)-L-arginine; omega-N-omega-N-dimethyl-L-arginine; omega-N-methyl-L-arginine; omega-N-omega-N-dimethyl-L-arginine; omega-N-phospho-L-arginine; Ooctanoyl-L-serine; O-palmitoyl-L-serine; O-palmitoyl-L-threonine; O-phospho-L-serine; O-phospho-L-threonine; O-phosphopantetheine-L-serine; phycoerythrobilin-bis-L-cysteine; phycourobilin-bis-L-cysteine; pyrroloquinoline quinone; pyruvic acid; S hydroxycinnamyl-L-cysteine; S-(2-aminovinyl)methyl-D-cysteine; S-(2-aminovinyl)-D-cysteine; S-(6-FW-L-cysteine; S-(8alpha-FAD)-L-cysteine; S-(ADP-ribosyl)-L-cysteine; S-(L-isoglutamyl)-L-cysteine; S-12-hydroxyfamesyl-L-cysteine; S-acetyl-L-cysteine; S-diacylglycerol-L-cysteine; S-diphytanylglycerot diether-L-cysteine; S-famesyl-L-cysteine; S-geranylgeranyl-L-cysteine; S-glycosyl-L-cysteine; S-glycyl-L-cysteine; S-methyl-L-cysteine; S-nitrosyl-L-cysteine; S-palmitoyl-L-cysteine; S-phospho-L-cysteine; S-phycobiliviolin-L-cysteine; S-phycocyanobilin-L-cysteine; S-phycoerythrobilin-L-cysteine; S-phytochromobilin-L-cysteine; S-selenyl-L-cysteine; S-sulfo-L-cysteine; tetrakis-L-cysteinyl diiron disulfide; tetrakis-L-cysteinyl iron; tetrakis-L-cysteinyl tetrairon tetrasulfide; trans-2,3-cis 4-dihydroxy-L-proline; tris-L-cysteinyl triiron tetrasulfide; tris-L-cysteinyl triiron trisulfide; tris-L-cysteinyl-L-aspartato tetrairon tetrasulfide; tris-L-cysteinyl-L-cysteine persulfido-bis-L-glutamato-L-histidino tetrairon disulfide trioxide; tris-L-cysteinyl-L-N3-histidino tetrairon tetrasulfide; tris-L-cysteinyl-L-NM-histidino tetrairon tetrasulfide; and tris-L-cysteinyl-L-serinyl tetrairon tetrasulfide.
[0134] Additional examples of post translational modifications can be found in web sites such as the Delta Mass database based on Krishna, R. G. and F. Wold (1998). Posttranslational Modifications. ProteinsAnalysis and Design. R. H. Angeletti. San Diego, Academic Press. 1: 121-206.; Methods in Enzymology, 193, J. A. McClosky (ed) (1990), pages 647-660; Methods in Protein Sequence Analysis edited by Kazutomo Imahori and Fumio Sakiyama, Plenum Press, (1993) Post-translational modifications of proteins R. G. Krishna and F. Wold pages 167-172; GlycoSuiteDB: a new curated relational database of glycoprotein glycan structures and their biological sources Cooper et al. Nucleic Acids Res. 29; 332-335 (2001) O-GLYCBASE version 4.0: a revised database of 0-glycosylated proteins Gupta et al. Nucleic Acids Research, 27: 370-372 (1999); and PhosphoBase, a database of phosphorylation sites: release 2.0., Kreegipuu et al. Nucleic Acids Res 27(1):237-239 (1999) see also, WO 02/21139A2, the disclosure of which is incorporated herein by reference in its entirety.
[0135] Disease states are often accompanied by alterations in the post-translational modifications of proteins. Thus, in another embodiment, the invention provides polypeptides from diseased cells or tissues that have altered post-translational modifications compared to the post-translational modifications of polypeptides from normal cells or tissues. A number of altered post-translational modifications are known. One common alteration is a change in phosphorylation state, wherein the polypeptide from the diseased cell or tissue is hyperphosphorylated or hypophosphorylated compared to the polypeptide from a normal tissue, or wherein the polypeptide is phosphorylated on different residues than the polypeptide from a normal cell. Another common alteration is a change in glycosylation state, wherein the polypeptide from the diseased cell or tissue has more or less glycosylation than the polypeptide from a normal tissue, and/or wherein the polypeptide from the diseased cell or tissue has a different type of glycosylation than the polypeptide from a non-diseased cell or tissue.
[0136] Another post-translational modification that can be altered in diseased cells is prenylation. Prenylation is the covalent attachment of a hydrophobic prenyl group (farnesyl or geranylgeranyl) to a polypeptide. Prenylation is required for localizing a protein to a cell membrane and is often required for polypeptide function. For instance, the Ras superfamily of GTPase signalling proteins must be prenylated for function in a cell. See, e.g., Prendergast et al., Semin. Cancer Biol. 10: 443-452 (2000) and Khwaja et al., Lancet 355: 741-744 (2000).
[0137] Other post-translation modifications that can be altered in diseased cells include, without limitation, polypeptide methylation, acetylation, arginylation or racemization of amino acid residues. In these cases, the polypeptide from the diseased cell can exhibit increased or decreased amounts of the post-translational modification compared to the corresponding polypeptides from non-diseased cells.
[0138] Other polypeptide alterations in diseased cells include abnormal polypeptide cleavage of proteins and aberrant protein-protein interactions. Abnormal polypeptide cleavage can be cleavage of a polypeptide in a diseased cell that does not usually occur in a normal cell, or a lack of cleavage in a diseased cell, wherein the polypeptide is cleaved in a normal cell. Aberrant protein-protein interactions can be covalent cross-linking or non-covalent binding between proteins that do not normally bind to each other. Alternatively, in a diseased cell, a protein can fail to bind to another protein to which it is bound in a non-diseased cell. Alterations in cleavage or in protein-protein interactions can be due to over- or underproduction of a polypeptide in a diseased cell compared to that in a normal cell, or can be due to alterations in post-translational modifications of one or more proteins in the diseased cell. See, e.g., Henschen-Edman, Ann. N.Y. Acad. Sci. 936: 580-593 (2001).
[0139] Alterations in polypeptide post-translational modifications, as well as changes in polypeptide cleavage and protein-protein interactions, can be determined by any method known in the art. For instance, alterations in phosphorylation can be determined by using anti-phosphoserine, anti-phosphothreonine or anti-phosphotyrosine antibodies or by amino acid analysis. Glycosylation alterations can be determined using antibodies specific for different sugar residues, by carbohydrate sequencing, or by alterations in the size of the glycoprotein, which can be determined by, e.g., SDS polyacrylamide gel electrophoresis (PAGE). Other alterations of post-translational modifications, such as prenylation, racemization, methylation, acetylation and arginylation, can be determined by chemical analysis, protein sequencing, amino acid analysis, or by using antibodies that bind a post-translational modification. Changes in protein-protein interactions and in polypeptide cleavage can be analyzed by any method known in the art including, without limitation, non-denaturing PAGE (for non-covalent protein-protein interactions), SDS PAGE (for covalent protein-protein interactions and protein cleavage), chemical cleavage, protein sequencing or immunoassays.
[0140] In another embodiment, the invention provides polypeptides that have been post-translationally modified. In one embodiment, polypeptides can be modified enzymatically or chemically, by addition or removal of a post-translational modification. For example, a polypeptide can be glycosylated or deglycosylated enzymatically. Similarly, polypeptides can be phosphorylated using a purified kinase, such as a MAP kinase (e.g, p38, ERK, or JNK) or a tyrosine kinase (e.g., Src or erbB2). A polypeptide can also be modified through synthetic chemistry. Alternatively, one can isolate the polypeptide of interest from a cell or tissue that expresses the polypeptide with the desired post-translational modification. In another embodiment, a nucleic acid molecule encoding the polypeptide of interest is introduced into a host cell that is capable of post-translationally modifying the encoded polypeptide in the desired fashion. If the polypeptide does not contain a motif for a desired post-translational modification, one can alter the post-translational modification by mutating the nucleic acid sequence of a nucleic acid molecule encoding the polypeptide so that it contains a site for the desired post-translational modification. Amino acid sequences that can be post-translationally modified are known in the art. See, e.g., the programs described herein on the Expasy website. The nucleic acid molecule can also be introduced into a host cell that is capable of post-translationally modifying the encoded polypeptide. Similarly, one can delete sites that are post-translationally modified by mutating the nucleic acid sequence so that the encoded polypeptide does not contain the post-translational modification motif, or by introducing the native nucleic acid molecule into a host cell that is not capable of post-translationally modifying the encoded polypeptide.
[0141] Polypeptides are not always entirely linear. For instance, polypeptides can be branched as a result of ubiquitination, and they can be circular, with or without branching, as a result of posttranslation events, including natural processing event and events brought about by human manipulation which do not occur naturally. Circular, branched and branched circular polypeptides can be synthesized by non-translation natural process and by entirely synthetic methods, as well. Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. In fact, blockage of the amino or carboxyl group in a polypeptide, or both, by a covalent modification, is common in naturally occurring and synthetic polypeptides and such modifications can be present in polypeptides of the present invention, as well. For instance, the amino terminal residue of polypeptides made in E. coli, prior to proteolytic processing, almost invariably will be N-formylmethionine.
[0142] Useful post-synthetic (and post-translational) modifications include conjugation to detectable labels, such as fluorophores. A wide variety of amine-reactive and thiol-reactive fluorophore derivatives have been synthesized that react under nondenaturing conditions with N-terminal amino groups and epsilon amino groups of lysine residues, on the one hand, and with free thiol groups of cysteine residues, on the other.
[0143] Kits are available commercially that permit conjugation of proteins to a variety of amine-reactive or thiol-reactive fluorophores: Molecular Probes, Inc. (Eugene, Oreg., USA), e.g., offers kits for conjugating proteins to Alexa Fluor 350, Alexa Fluor 430, Fluorescein-EX, Alexa Fluor 488, Oregon Green 488, Alexa Fluor 532, Alexa Fluor 546, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, and Texas Red-X A wide variety of other amine-reactive and thiol-reactive fluorophores are available commercially (Molecular Probes, Inc., Eugene, Oreg., USA), including Alexa Fluor 350, Alexa Fluor 488, Alexa Fluor 532, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 647 (monoclonal antibody labeling kits available from Molecular Probes, Inc., Eugene, Oreg., USA), BODIPY dyes, such as BODIPY 493/503, BODIPY FL, BODIPY R6G, BODIPY 530/550, BODIPY TMR, BODIPY 558/568, BODIPY 558/568, BODIPY 564/570, BODIPY 576/589, BODIPY 581/591, BODIPY TR, BODIPY 630/650, BODIPY 650/665, Cascade Blue, Cascade Yellow, Dansyl, lissamine rhodamine B, Marina Blue, Oregon Green 488, Oregon Green 514, Pacific Blue, rhodamine 6G, rhodamine green, rhodamine red, tetramethylrhodamine, Texas Red (available from Molecular Probes, Inc., Eugene, Oreg., USA).
[0144] The polypeptides of the present invention can also be conjugated to fluorophores, other proteins, and other macromolecules, using bifunctional linking reagents. Common homobifunctional reagents include, e.g., APG, AEDP, BASED, BMB, BMDB, BMH, BMOE, BM[PEO]3, BM[PEO]4, BS3, BSOCOES, DFDNB, DMA, DMP, DMS, DPDPB, DSG, DSP (Lomant's Reagent), DSS, DST, DTBP, DTME, DTSSP, EGS, HBVS, Sulfo-BSOCOES, Sulfo-DST, Sulfo-EGS (available from Pierce, Rockford, Ill., USA); common heterobifunctional cross-linkers include ABH, AMAS, ANB-NOS, APDP, ASBA, BMPA, BMPH, BMPS, EDC, EMCA, EMCH, EMCS, KMUA, KMUH, GMBS, LC-SMCC, LC-SPDP, MBS, M2C2H, MPBH, MSA, NHS-ASA, PDPH, PMPI, SADP, SAED, SAND, SANPAH, SASD, SATP, SBAP, SFAD, SIA, SLAB, SMCC, SMPB, SMPH, SMPT, SPDP, Sulfo-EMCS, Sulfo-GMBS, Sulfo-HSAB, Sulfo-KMUS, Sulfo-LC-SPDP, Sulfo-MBS, Sulfo-NHS-LC-ASA, Sulfo-SADP, Sulfo-SANPAH, Sulfo-SIAB, Sulfo-SMCC, Sulfo-SMPB, Sulfo-LC-SMPT, SVSB, TFCS (available Pierce, Rockford, Ill., USA).
[0145] Polypeptides of the present invention, including full length polypeptides, fragments and fusion proteins, can be conjugated, using such cross-linking reagents, to fluorophores that are not amine- or thiol-reactive. Other labels that usefully can be conjugated to polypeptides of the present invention include radioactive labels, echosonographic contrast reagents, and MRI contrast agents.
[0146] Polypeptides of the present invention, including full length polypeptide, fragments and fusion proteins, can also usefully be conjugated using cross-linking agents to carrier proteins, such as KLH, bovine thyroglobulin, and even bovine serum albumin (BSA), to increase immunogenicity for raising anti-PAPPA2, anti-NGAL, anti-KRT20, or anti-TACSTD2 protein antibodies.
[0147] Polypeptides of the present invention, including full length polypeptide, fragments and fusion proteins, can also usefully be conjugated to polyethylene glycol (PEG); PEGylation increases the serum half life of proteins administered intravenously for replacement therapy. Delgado et al., Crit. Rev. Ther. Drug Carrier Syst. 9(3-4): 249-304 (1992); Scott et al., Curr. Pharm. Des. 4(6): 423-38 (1998); DeSantis et al., Curr. Opin. Biotechnol. 10(4): 324-30 (1999). PEG monomers can be attached to the protein directly or through a linker, with PEGylation using PEG monomers activated with tresyl chloride (2,2,2-trifluoroethanesulphonyl chloride) permitting direct attachment under mild conditions.
[0148] Methods of Treatment and Diagnosis
[0149] In one embodiment, the method comprises detecting the presence of PAPPA2 in a sample obtained from a subject, the presence of the PAPPA2 being indicative of a vAKI, and, administering to the subject in need a therapeutic treatment for vAKI. In some embodiments, the sample is incubated with an agent that binds to PAPPA2, such as an antibody, a probe, a nucleic acid primer, and the like.
[0150] In one embodiment, the method comprises detecting the presence of NGAL, KRT20, TACSTD2, or a combination thereof, in a sample obtained from a subject, the presence of the NGAL, KRT20, TACSTD2, or a combination thereof, being indicative of a iAKI, and, administering to the subject in need a therapeutic treatment for iAKI. In some embodiments, the sample is incubated with an agent that binds to NGAL, KRT20, or TACSTD2, such as an antibody, a probe, a nucleic acid primer, and the like.
[0151] In one aspect, the invention provides a method for treating volume-dependent acute kidney injury (vAKI) in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; and b) administering fluids to the subject if full-length PAPPA2 protein is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have Acute Kidney Injury (AKI).
[0152] In another aspect, the invention provides a method for treating vAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; b) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject; c) determining the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject; d) determining the level of full-length PAPPA2 protein in a urine sample from a subject that does not have AKI; e) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in a urine sample from a subject that does not have AKI; f) determining the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject that does not have AKI; and g) administering fluids to the subject if the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject is greater than the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from a subject that does not have AKI, respectively.
[0153] In another aspect, the invention provides a method for treating ischemic acute kidney injury (iAKI) in a subject in need thereof, the method comprising: a) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in a urine sample from the subject; and b) administering treatment for kidney damage to the subject if NGAL, KRT20, or TACSTD2 protein, or a combination thereof, is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have AKI.
[0154] In one aspect, the invention provides a method for treating iAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; b) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject; c) determining the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject; d) determining the level of full-length PAPPA2 protein in a urine sample from a subject that does not have AKI; e) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject that does not have AKI; f) determining the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject that does not have AKI; and g) administering treatment for kidney damage to the subject if the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject is greater than the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject that does not have AKI, respectively.
[0155] In another aspect, the invention provides a method for treating iAKI in a subject in need thereof, the method comprising: a) determining the level of proteolytically cleaved PAPPA2 protein in a urine sample from the subject; and b) administering treatment for kidney damage to the subject if proteolytically cleaved PAPPA2 protein is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have AKI.
[0156] In one embodiment, the size of full-length PAPPA2 is equal to or above 100 kDa, 110 kDa, 120 kDa, 130 kDa, 135 kDa, 140 kDa, 150 kDa, 160 kDa, 170 kDa, 180 kDa, 190 kDa, 200 kDa, 210 kDa or 220 kDa.
[0157] In one embodiment, the size of proteolytically cleaved PAPPA2 is equal to or below 200 kDa, 190 kDa, 180 kDa, 170 kDa, 160 kDa, 150 kDa, 140 kDa, 130 kDa, 120 kDa, 110 kDa, 100 kDa, 90 kDa, 80 kDa, 75 kDa, 70 kDa, 65 kDa, 60 kDa, 55 kDa, or 50 kDa.
[0158] In one embodiment, the method further comprises determining the level of serum creatinine in the subject. In one embodiment, the level of serum creatinine is determined before the administering step. In another embodiment, In one embodiment, the level of serum creatinine is determined after the administering step.
[0159] In one embodiment, an elevated level of serum creatinine is equal to or above 0.1 mg/dL, 0.2 mg/dL, 0.3 mg/dL, 0.4 mg/dL, 0.5 mg/dL, 0.6 mg/dL, 0.7 mg/dL, 0.8 mg/dL, 0.9 mg/dL or 1 mg/dL.
[0160] In one embodiment, treatment is administered if the subject has an elevated level of serum creatinine. In another embodiment, the treatment for kidney damage comprises withholding fluids, administering dialysis, or a combination thereof. In one embodiment, the method further comprises testing and treating the subject for hyperkalemia, hyponatremia, hyperphosphatemia or acidosis.
[0161] In one embodiment, the method comprises prior to step a), reducing a urine sample from a subject with a reducing agent to generate a reduced urine sample, filtering the reduced urine sample with a 300 KDa filter to produce a retentate and a filtrate, wherein step a) and/or d) is then performed on the retentate. In another embodiment, the reducing agent is beta-mercaptoethanol.
[0162] In one embodiment, the level of full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein is determined by ELISA, immunoblot, Western blot, or lateral flow dip stick. In another embodiment, the level of full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein is determined using an antibody that specifically binds to full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, respectively, or a fragment thereof.
[0163] In one embodiment, the subject is a human subject.
[0164] For vAKI, the administering step in each of the claimed methods can comprise a fluid, blood or albumin administration, or a drug administration. In another embodiment, administration of the therapy improves the volume capacity of the kidney and the volume status (extracellular fluid volume or the circulating volume) of the body.
[0165] In one embodiment, the biological sample comprises urine. In another embodiment, the biological sample comprises neuronal cells, serum, bone marrow, blood, peripheral blood, lymph nodes, cerebro-spinal fluid, urine, a saliva sample, a buccal swab, a serum sample, a sputum sample, a lacrimal secretion sample, a semen sample, a vaginal secretion sample, a fetal tissue sample, or a combination thereof.
[0166] A PAPPA2, NGAL, KRT20, or TACSTD2 molecule, can be determined at the level of the DNA, RNA, or polypeptide. Optionally, detection can be determined by performing an oligonucleotide ligation assay, a confirmation based assay, a hybridization assay, a sequencing assay, an allele-specific amplification assay, a microsequencing assay, a melting curve analysis, a denaturing high performance liquid chromatography (DHPLC) assay (for example, see Jones et al, (2000) Hum Genet., 106(6):663-8), or a combination thereof. In another embodiment, the detection or determination comprises protein expression analysis, for example by western blot analysis, ELISA, or other antibody detection methods.
[0167] The present invention provides a method for treating vAKI in a subject in need thereof. In one embodiment, the method comprises obtaining a sample from the subject to determine the level of PAPPA2 in the subject. In some embodiments, the sample is incubated with an agent that binds to PAPPA2, such as an antibody, a probe, a nucleic acid primer, and the like. In another embodiment, the detection or determination comprises nucleic acid sequencing, selective hybridization, selective amplification, gene expression analysis, or a combination thereof. In another embodiment, the detection or determination comprises protein expression analysis, for example by western blot analysis, ELISA, or other antibody detection methods. In some embodiments, the method further comprises assessing whether to administer treatment for vAKI based on the expression pattern of the subject. In further embodiments, the method comprises administering a vAKI treatment to the subject.
[0168] The present invention provides a method for treating iAKI in a subject in need thereof. In one embodiment, the method comprises obtaining a sample from the subject to determine the level of NGAL, KRT20, or TACSTD2 in the subject. In some embodiments, the sample is incubated with an agent that binds to NGAL, KRT20, or TACSTD2, such as an antibody, a probe, a nucleic acid primer, and the like. In another embodiment, the detection or determination comprises nucleic acid sequencing, selective hybridization, selective amplification, gene expression analysis, or a combination thereof. In another embodiment, the detection or determination comprises protein expression analysis, for example by western blot analysis, ELISA, or other antibody detection methods. In some embodiments, the method further comprises assessing whether to administer treatment for iAKI based on the expression pattern of the subject. In further embodiments, the method comprises administering an iAKI treatment to the subject.
[0169] Various techniques known in the art can be used to detect or quantify PAPPA2, NGAL, KRT20, or TACSTD2. Detection methods can require the use of a ligand specific for the polypeptide, for example, the use of a specific antibody.
[0170] Specific Ligand Binding.
[0171] As discussed herein, a PAPPA2, NGAL, KRT20, or TACSTD2 protein can be detected by screening for the expression level of a polypeptide. Different types of ligands can be used, such as specific antibodies. In one embodiment, the sample is contacted with an antibody specific for a a PAPPA2, NGAL, KRT20, or TACSTD2 protein and the formation of an immune complex is subsequently determined. Various methods for detecting an immune complex can be used, such as ELISA, radioimmunoassays (RIA) and immuno-enzymatic assays (IEMA).
[0172] For example, an antibody can be a polyclonal antibody, a monoclonal antibody, as well as fragments or derivatives thereof having substantially the same antigen specificity. Fragments include Fab, Fab2, or CDR regions. Derivatives include single-chain antibodies, humanized antibodies, or poly-functional antibodies. An antibody specific for a PAPPA2, NGAL, KRT20, or TACSTD2 protein can be an antibody that selectively binds such a polypeptide. In one embodiment, the antibody is raised against a PAPPA2, NGAL, KRT20, or TACSTD2 protein or an epitope-containing fragment thereof. Although non-specific binding towards other antigens can occur, binding to the target polypeptide occurs with a higher affinity and can be reliably discriminated from non-specific binding. In one embodiment, the method can comprise contacting a sample from the subject with an antibody specific for a PAPPA2, NGAL, KRT20, or TACSTD2 protein, and determining the presence of an immune complex. Optionally, the sample can be contacted to a support coated with antibody specific for a PAPPA2, NGAL, KRT20, or TACSTD2 protein. In one embodiment, the sample can be contacted simultaneously, or in parallel, or sequentially, with various antibodies specific for PAPPA2, NGAL, KRT20, or TACSTD2.
[0173] The invention also provides for a diagnostic kit comprising products and reagents for detecting in a sample from a subject the presence of a PAPPA2, NGAL, KRT20, or TACSTD2 protein, or the presence of PAPPA2, NGAL, KRT20, or TACSTD2 nucleic acid. The kit can be useful for determining whether a sample from a subject exhibits increased or reduced expression of a PAPPA2, NGAL, KRT20, or TACSTD2 protein or PAPPA2, NGAL, KRT20, or TACSTD2 nucleic acid. For example, the diagnostic kit according to the present invention comprises any primer, any pair of primers, any nucleic acid probe and/or any ligand, or any antibody directed specifically to a PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a a PAPPA2, NGAL, KRT20, or TACSTD2 nucleic acid. The diagnostic kit according to the present invention can further comprise reagents and/or protocols for performing a hybridization, amplification, or antigen-antibody immune reaction. In some embodiments, the kit comprises an antibody that specifically binds to a PAPPA2, NGAL, KRT20, or TACSTD2 protein comprising SEQ ID NO: 1, 2, 5, 7, or 9.
[0174] The diagnosis methods can be performed in vitro, ex vivo, or in vivo. These methods utilize a sample from the subject in order to assess the status of vAKI or iAKI. The sample can be any biological sample derived from a subject, which contains nucleic acids or polypeptides. Examples of such samples include, but are not limited to, fluids, tissues, cell samples, organs, and tissue biopsies. Non-limiting examples of samples include blood, liver, plasma, serum, saliva, urine, or seminal fluid. The sample can be collected according to conventional techniques and used directly for diagnosis or stored. The sample can be treated prior to performing the method, in order to render or improve availability of nucleic acids or polypeptides for testing. Treatments include, for instance, lysis (e.g., mechanical, physical, or chemical), centrifugation. The nucleic acids and/or polypeptides can be pre-purified or enriched by conventional techniques, and/or reduced in complexity. Nucleic acids and polypeptides can also be treated with enzymes or other chemical or physical treatments to produce fragments thereof. In one embodiment, the sample is contacted with reagents, such as probes, primers, or ligands, in order to assess the presence of a PAPPA2, NGAL, KRT20, or TACSTD2 protein, or PAPPA2, NGAL, KRT20, or TACSTD2 nucleic acid. Contacting can be performed in any suitable device, such as a plate, tube, well, or glass. In some embodiments, the contacting is performed on a substrate coated with the reagent, such as an antibody or epitope binding fragment of an antibody. The substrate can be a solid or semi-solid substrate such as any support comprising glass, plastic, nylon, paper, metal, or polymers. The substrate can be of various forms and sizes, such as a slide, a membrane, a bead, a column, or a gel. The contacting can be made under any condition suitable for a complex to be formed between the reagent and the nucleic acids or polypeptides of the sample.
[0175] Methods of Detection and Kits of the Invention
[0176] In one aspect, the invention provides a diagnostic kit for determining whether a urine sample from a subject contains full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a combination thereof, the kit comprising at least one antibody that specifically binds to full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a fragment thereof.
[0177] In another aspect, the invention provides a diagnostic kit for determining whether a urine sample from a subject contains full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a combination thereof, the kit comprising at least one antibody that specifically binds to a protein comprising SEQ ID NO: 1, 2, 5, 7, or 9.
[0178] In another aspect, the invention provides a method for detecting the presence of a full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein in a urine sample from a subject, the method comprising: (a) obtaining a urine sample from the subject; and (b) measuring full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein levels by ELISA using an antibody directed to SEQ ID NO: 1, 2, 5, 7, or 9; or by western blot using an antibody directed to SEQ ID NO: 1, 2, 5, 7, or 9; or by mass spectroscopy; or by isoelectric focusing, or a combination thereof.
[0179] In another aspect, the invention provides a method of diagnosing vAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; and b) diagnosing the subject with vAKI if full-length PAPPA2 protein is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have AKI.
[0180] In one aspect, the invention provides a method of diagnosing vAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; b) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject; c) determining the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject; d) determining the level of full-length PAPPA2 protein in a urine sample from a subject that does not have AKI; e) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject that does not have AKI; f) determining the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject that does not have AKI; g) diagnosing the subject with vAKI if the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from the subject is greater than the ratio of full-length PAPPA2/NGAL, full-length PAPPA2/KRT20, or full-length PAPPA2/TACSTD2 in the urine sample from a subject that does not have AKI, respectively.
[0181] In another aspect, the invention provides a method of diagnosing iAKI in a subject in need thereof, the method comprising: a) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in a urine sample from the subject; and b) diagnosing the subject with iAKI if NGAL, KRT20, or TACSTD2 protein, or a combination thereof, is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have AKI.
[0182] In one aspect, the invention provides a method of diagnosing iAKI in a subject in need thereof, the method comprising: a) determining the level of full-length PAPPA2 protein in a urine sample from the subject; b) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject; c) determining the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject; d) determining the level of full-length PAPPA2 protein in a urine sample from a subject that does not have AKI; e) determining the level of NGAL, KRT20, or TACSTD2 protein, or a combination thereof, in the urine sample from the subject that does not have AKI; f) determining the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject that does not have AKI; g) diagnosing the subject with iAKI if the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject is greater than the ratio of NGAL/full-length PAPPA2, KRT20/full-length PAPPA2, or TACSTD2/full-length PAPPA2 in the urine sample from the subject that does not have AKI, respectively.
[0183] In another aspect, the invention provides a method for diagnosing iAKI in a subject in need thereof, the method comprising: a) determining the level of proteolytically cleaved PAPPA2 protein in a urine sample from the subject; and b) diagnosing the subject with iAKI if proteolytically cleaved PAPPA2 protein is present in the urine sample from the subject in a higher amount than in a urine sample from a subject that does not have AKI.
[0184] In one embodiment, the size of full-length PAPPA2 is equal to or above 100 kDa, 110 kDa, 120 kDa, 130 kDa, 135 kDa, 140 kDa, 150 kDa, 160 kDa, 170 kDa, 180 kDa, 190 kDa, 200 kDa, 210 kDa or 220 kDa.
[0185] In one embodiment, the size of proteolytically cleaved PAPPA2 is equal to or below 200 kDa, 190 kDa, 180 kDa, 170 kDa, 160 kDa, 150 kDa, 140 kDa, 130 kDa, 120 kDa, 110 kDa, 100 kDa, 90 kDa, 80 kDa, 75 kDa, 70 kDa, 65 kDa, 60 kDa, 55 kDa, or 50 kDa.
[0186] In one embodiment, the method comprises administering fluids to the subject if the subject is diagnosed with vAKI. In another embodiment, the method comprises administering treatment for kidney damage if the subject is diagnosed with iAKI.
[0187] In one embodiment, the method comprises determining the level of serum creatinine in the subject. In another embodiment, the level of serum creatinine is determined before the diagnosing step.
[0188] In one embodiment, an elevated level of serum creatinine is equal to or above 0.1 mg/dL, 0.2 mg/dL, 0.3 mg/dL, 0.4 mg/dL, 0.5 mg/dL, 0.6 mg/dL, 0.7 mg/dL, 0.8 mg/dL, 0.9 mg/dL or 1 mg/dL.
[0189] In one embodiment, the subject is diagnosed with vAKI or iAKI if the subject also has an elevated level of serum creatinine.
[0190] In one embodiment, the treatment for kidney damage comprises withholding fluids, administering dialysis, or a combination thereof. In another embodiment, the method further comprises testing and treating the subject for hyperkalemia, hyponatremia, hyperphosphatemia or acidosis if the subject is diagnosed with iAKI.
[0191] In one embodiment, the method further comprises, prior to step a), reducing a urine sample from a subject with a reducing agent to generate a reduced urine sample, filtering the reduced urine sample with a 300 kDa filter to produce a retentate and a filtrate, wherein step a) and/or d) is then performed on the retentate. In another embodiment, the reducing agent is beta-mercaptoethanol.
[0192] In one embodiment, the level of full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein is determined by ELISA, immunoblot, Western blot, or lateral flow dip stick. In another embodiment, the level of full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein is determined using an antibody that specifically binds to full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, respectively, or a fragment thereof.
[0193] In one embodiment, the subject is a human subject.
[0194] Embodiments of the invention provide for detecting expression of PAPPA2, NGAL, KRT20, or TACSTD2 protein, or PAPPA2, NGAL, KRT20, or TACSTD2 nucleic acid. In one embodiment, increased or reduced protein expression and/or activity, or increased or reduced nucleic acid expression can be detected. The detection can be performed at the level of the DNA, RNA, or polypeptide.
[0195] In some embodiments, the detection comprises detecting in a biological sample whether there is a reduction in an mRNA encoding an PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a reduction in a PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a combination thereof. In further embodiments, the detection comprises detecting in a biological sample whether there is an increase in an mRNA encoding an PAPPA2, NGAL, KRT20, or TACSTD2 protein, or an increase in an PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a combination thereof.
[0196] Methods for detecting and quantifying PAPPA2, NGAL, KRT20, or TACSTD2 molecules in biological samples are known the art. For example, protocols for detecting and measuring a PAPPA2, NGAL, KRT20, or TACSTD2 protein molecule using either polyclonal or monoclonal antibodies specific for the polypeptide are well established. Non-limiting examples include Western blot, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), and fluorescence activated cell sorting (FACS).
[0197] In one aspect, the invention provides a device for determining whether a sample from a subject contains PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a combination thereof, the device comprising at least one antibody that specifically binds to PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a fragment thereof. In another aspect, the invention provides a device for determining whether a sample from a subject contains PAPPA2, NGAL, KRT20, or TACSTD2 nucleic acid, or a combination thereof, the device comprising at least one primer, primer pair, or nucleic acid probe, that specifically binds to PAPPA2, NGAL, KRT20, or TACSTD2 nucleic acid, or a fragment thereof.
[0198] In one embodiment, a biological sample comprises, a blood sample, serum, cells (including whole cells, cell fractions, cell extracts, and cultured cells or cell lines), tissues (including tissues obtained by biopsy), body fluids (e.g., urine, sputum, amniotic fluid, synovial fluid), or from media (from cultured cells or cell lines). The methods of detecting or quantifying a PAPPA2, NGAL, KRT20, or TACSTD2 molecule include, but are not limited to, amplification-based assays with (signal amplification) hybridization based assays and combination amplification-hybridization assays. For detecting and quantifying a PAPPA2, NGAL, KRT20, or TACSTD2 molecule, an exemplary method is an immunoassay that utilizes an antibody or other binding agents that specifically bind to an ILDR2 protein or epitope of such, for example, Western blot or ELISA assays.
[0199] Antibodies to PAPPA2, NGAL, KRT20, or TACSTD2
[0200] In one aspect, the invention provides antibody that binds to a PAPPA2, NGAL, KRT20, or TACSTD2. In one aspect, the invention provides antibody that binds to an epitope of the polypeptide of SEQ ID NO: 1, 2, 5, 7, or 9.
[0201] In another aspect, the antibodies of the invention are isolated. The antibodies of the invention can be monoclonal or polyclonal. Methods for making polyclonal and monoclonal antibodies are well known in the art. Antibodies of the invention can be produced by methods known in the art in any suitable animal host such as but not limited to rabbit, goat, mouse, sheep. In one embodiment, the antibodies can be chimeric, i.e. a combination of sequences of more than one species. In another embodiment, the antibodies can be fully-human or humanized Abs. Humanized antibodies contain complementarity determining regions that are derived from non-human species immunoglobulin, while the rest of the antibody molecule is derived from human immunoglobulin. Fully-human or humanized antibodies avoid certain problems of antibodies that possess non-human regions which can trigger host immune response leading to rapid antibody clearance. In still another embodiment, antibodies of the invention can be produced by immunizing a non-human animal with an immunogenic compositon comprising a polypeptide of the invention in the monomeric form. In other embodiments, dimeric or multimeric forms can be used. The immunogenic composition can also comprise other components that can increase the antigenicity of the inventive peptide. In one embodiment the non-human animal is a transgenic mouse model, for e.g., the HuMAb-Mouse or the Xenomouse, which can produce human antibodies. Neutralizing antibodies against peptides of interest and the cells producing such antibodies can be identified and isolated by methods know in the art.
[0202] Making of monoclonal antibodies is well known in the art. In one embodiment, the monoclonal antibodies of the invention are made by harvesting spleen tissue from a rabbit which produces a polyclonal antibody. Harvested cells are fused with the immortalized myeloma cell line partner. After an initial period of growth of the fused cells, single antibody producing clones are isolated by cell purification, grown and analyzed separately using a binding assay (e.g., ELISA, or Western). Hybridomas can be selected based on the ability of their secreted antibody to bind to a peptide interest, including a polypeptide comprising SEQ ID NO: 1, 2, 5, 7, or 9. Variable regions can be cloned from the hybridomas by PCR and the sequence of the epitope binding region can be determined by sequencing methods known in the art.
[0203] The invention provides antibodies and antibody fragments of various isotypes. The recombined immunoglobulin (Ig) genes, for example the variable region genes, can be isolated from the deposited hybridomas, by methods known in the art, and cloned into an Ig recombination vector that codes for human Ig constant region genes of both heavy and light chains. The antibodies can be generated of any isotype such as IgG1, IgG2, IgG3, IgG4, IgD, IgE, IgM, IgA1, IgA2, or sIgA isotype. The invention provides isotypes found in non-human species as well such as but not limited to IgY in birds and sharks. Vectors encoding the constant regions of various isotypes are known and previously described. (See, for example, Preston et al. Production and characterization of a set of mouse-human chimeric immunoglobulin G (IgG) subclass and IgA monoclonal antibodies with identical variable regions specific for P. aeruginosa serogroup O6 lipopolysaccharide. Infect Immun. 1998 September; 66(9):4137-42; Coloma et al. Novel vectors for the expression of antibody molecules using variable regions generated by polymerase chain reaction. J Immunol Methods. 1992 Jul. 31; 152(1):89-104; Guttieri et al. Cassette vectors for conversion of Fab fragments into full-length human IgG1 monoclonal antibodies by expression in stably transformed insect cells. Hybrid Hybridomics. 2003 June; 22(3):135-45; McLean et al. Human and murine immunoglobulin expression vector cassettes. Mol Immunol. 2000 October; 37(14):837-45; Walls et al. Vectors for the expression of PCR-amplified immunoglobulin variable domains with human constant regions. Nucleic Acids Res. 1993 Jun. 25; 21(12):2921-9; Norderhaug et al. Versatile vectors for transient and stable expression of recombinant antibody molecules in mammalian cells. J Immunol Methods. 1997 Can 12; 204(1):77-87.)
[0204] The antibodies of the invention bind to a polypeptide comprising the sequence of any of SEQ ID NOs: 1, 2, 5, 7, and 9, comprised in a longer polypeptide, in a specific manner. In one embodiment, the antibodies, or antibody fragments of the invention bind specifically to a peptide of SEQ ID NO: 1, 2, 5, 7, or 9. In one embodiment, the antibodies, or antibody fragments of the invention bind specifically to a peptide of SEQ ID NO: 1, 2, 5, 7, or 9. For example, antibodies that bind specifically to a peptide that comprises a sequence shown in any of SEQ ID NOs: 1, 2, 5, 7, and 9 will not bind to polypeptides which do not comprise the amino acid sequence of any of SEQ ID NOs: 1, 2, 5, 7, or 9 to the same extent and with the same affinity as they bind to a peptide that comprises a sequence shown in any of SEQ ID NOs: 1, 2, 5, 7, or 9.
[0205] The present invention provides specific monoclonal antibodies, including but not limited to rabbit, mouse and human, which recognize a peptide of SEQ ID NO: 1, 2, 5, 7, or 9. When used in vivo in humans, human monoclonal antibodies are far less likely to be immunogenic (as compared to antibodies from another species).
[0206] Variable region nucleic acids for the heavy and light chains of the antibodies can be cloned into an human Ig expression vector that contain any suitable constant region, for example (i.e., TCAE6) that contains the IgG1 (gamma 1) constant region coding sequences for the heavy chain and the lambda constant region for the light chains. (See, for example, Preston et al. Production and characterization of a set of mouse-human chimeric immunoglobulin G (IgG) subclass and IgA monoclonal antibodies with identical variable regions specific for P. aeruginosa serogroup O6 lipopolysaccharide. Infect Immun. 1998 September; 66(9):4137-42.) The variable regions can be placed in any vector that encodes constant region coding sequences. For example, human Ig heavy-chain constant-region expression vectors containing genomic clones of the human IgG2, IgG3, IgG4 and IgA heavy-chain constant-region genes and lacking variable-region genes have been described in Coloma, et al. 1992 J. Immunol. Methods 152:89-104.) These expression vectors can then be transfected into cells (e.g., CHO DG44 cells), the cells are grown in vitro, and IgG1 are subsequently harvested from the supernatant. Resultant antibodies can be generated to posses human variable regions and human IgG1 and lambda constant regions. In other embodiments, the Fc portions of the antibodies of the invention can be replaced so as to produce IgM.
[0207] In other embodiments, the antibody of the invention also includes an antibody fragment. It is well-known in the art, only a portion of an antibody molecule, the paratope, is involved in the binding of the antibody to its epitope (see, in general, Clark, W. R. (1986) The Experimental Foundations of Modern Immunology Wiley & Sons, Inc., New York; Roitt, I. (1991) Essential Immunology, 7th Ed., Blackwell Scientific Publications, Oxford; and Pier G B, Lyczak J B, Wetzler L M, (eds). Immunology, Infection and Immunity (2004) 1st Ed. American Society for Microbiology Press, Washington D.C.). The pFc and Fc regions of the antibody, for example, are effectors of the complement cascade and can mediate binding to Fc receptors on phagocytic cells, but are not involved in antigen binding. An antibody from which the pFc region has been enzymatically cleaved, or which has been produced without the pFc region, e.g. an F(ab)2 fragment, retains both of the antigen binding sites of an intact antibody. An isolated F(ab)2 fragment is referred to as a bivalent monoclonal fragment because of its two antigen binding sites. Similarly, an antibody from which the Fc region has been enzymatically cleaved, or which has been produced without the Fc region, e.g. an Fab fragment, retains one of the antigen binding sites of an intact antibody molecule. Proceeding further, Fab fragments consist of a covalently bound antibody light chain and a portion of the antibody heavy chain denoted Fd (heavy chain variable region). The Fd fragments are the major determinant of antibody specificity (a single Fd fragment can be associated with up to ten different light chains without altering antibody specificity) and Fd fragments retain epitope-binding ability in isolation. An antibody fragment is a polypeptide which can be targeted to the nucleus. Methods to modify polypeptides for targeting to the nucleus are known in the art.
[0208] Additional methods of producing and using antibodies and antibody fragments comprising Fab, Fc, pFc, F(ab)2 and Fv regions are well known in the art [Klein, Immunology (John Wiley, New York, N.Y., 1982); Clark, W. R. (1986) The Experimental Foundations of Modern Immunology (Wiley & Sons, Inc., New York); Roitt, I. (1991) Essential Immunology, 7th Ed., (Blackwell Scientific Publications, Oxford); and Pier G B, Lyczak J B, Wetzler L M, (eds). Immunology, Infection and Immunity (2004) 1st Ed. American Society for Microbiology Press, Washington D.C.].
[0209] Usually the CDR regions in humanized antibodies are substantially identical, and more usually, identical to the corresponding CDR regions of the donor antibody. However, in certain embodiments, it can be desirable to modify one or more CDR regions to modify the antigen binding specificity of the antibody and/or reduce the immunogenicity of the antibody. One or more residues of a CDR can be altered to modify binding to achieve a more favored on-rate of binding, a more favored off-rate of binding, or both, such that an idealized binding constant is achieved. Using this strategy, an antibody having high or ultra high binding affinity of can be achieved. Briefly, the donor CDR sequence is referred to as a base sequence from which one or more residues are then altered. Affinity maturation techniques can be used to alter the CDR region(s) followed by screening of the resultant binding molecules for the desired change in binding. The method can also be used to alter the donor CDR to be less immunogenic such that a potential chimeric antibody response is minimized or avoided. Accordingly, as CDR(s) are altered, changes in binding affinity as well as immunogenicity can be monitored and scored such that an antibody optimized for the best combined binding and low immunogenicity are achieved (see, e.g., U.S. Pat. No. 6,656,467 and U.S. Pat. Pub. Nos: US20020164326A1; US20040110226A1; US20060121042A1).
[0210] The antibodies of the invention can be used in a variety of applications including, but not limited to, methods for vAKI and iAKI in a subject, wherein the antibody is used to determine different levels of PAPPA2, NGAL, KRT20, or TACSTD2 in a urine or other tissue sample, which can be compared to the level of PAPPA2, NGAL, KRT20, or TACSTD2 from a control subject, or sample that does not have vAKI or iAKI. Additionally, such antibodies could be used to detect shed molecules in the circulation as a diagnostic.
[0211] In one aspect, the antibodies that specifically bind a polypeptide of SEQ ID NO: 1, 2, 5, 7, or 9, or a polypeptide which comprises the corresponding peptide, can be used in a screening method to evaluate agents designed to affect the levels of PAPPA2, NGAL, KRT20, or TACSTD2 protein. The antibody can be used to quantitate protein levels and expression, protein localization, or protein modification of PAPPA2, NGAL, KRT20, or TACSTD2 protein.
[0212] The antibodies of the present invention, including fragments and derivatives thereof, can be labeled. It is, therefore, another aspect of the present invention to provide labeled antibodies that bind specifically to one or more of the polypeptides of the present invention, to one or more of the polypeptides encoded by the isolated nucleic acid molecules of the present invention, or the binding of which can be competitively inhibited by one or more of the polypeptides of the present invention or one or more of the polypeptides encoded by the isolated nucleic acid molecules of the present invention. The choice of label depends, in part, upon the desired use.
[0213] For example, when the antibodies of the present invention are used for immunohistochemical staining of tissue samples, the label can usefully be an enzyme that catalyzes production and local deposition of a detectable product. Enzymes useful as conjugates to antibodies to permit antibody detection are well known. Exemplary conjugataes are alkaline phosphatase, p-galactosidase, glucose oxidase, horseradish peroxidase (HRP), and urease. Exemplary substrates for production and deposition of visually detectable products are o-nitrophenyl-beta-D-galactopyranoside (ONPG); o-phenylenediamine dihydrochloride (OPD); p-nitrophenyl phosphate (NPP); p-nitrophenyl-beta-D-galactopryanoside (PNPG); 3,3-diaminobenzidine (DAB); 3-amino-9-ethylcarbazole (AEC); 4-chloro-1-naphthol (CN); 5-bromo-4-chloro-3-indolyl-phosphate (BCIP); ABTS; BluoGal; iodonitrotetrazolium (INT); nitroblue tetrazolium chloride (NBT); phenazine methosulfate (PMS); phenolphthalein monophosphate (PMP); tetramethyl benzidine (TMB); tetranitroblue tetrazolium (TNBT); X-Gal; X-Gluc; and X-Glucoside.
[0214] Other substrates can be used to produce luminescent products for local deposition. For example, in the presence of hydrogen peroxide (H2O2), horseradish peroxidase (HRP) can catalyze the oxidation of cyclic diacylhydrazides, such as luminol. Immediately following the oxidation, the luminol is in an excited state (intermediate reaction product), which decays to the ground state by emitting light. Strong enhancement of the light emission is produced by enhancers, such as phenolic compounds. Advantages include high sensitivity, high resolution, and rapid detection without radioactivity and requiring only small amounts of antibody. See, e.g., Thorpe et al., Methods Enzymol. 133: 331-53 (1986); Kricka et al., J. Immmunoassay 17(1): 67-83 (1996); and Lundqvist et al., J. Biolumin. Chemiluimin. 10(6): 353-9 (1995). Kits for such enhanced chemiluminescent detection (ECL) are available commercially. The antibodies can also be labeled using colloidal gold.
[0215] As another example, when the antibodies of the present invention are used, e.g., for flow cytometric detection, for scanning laser cytometric detection, or for fluorescent immunoassay, they can usefully be labeled with fluorophores. There are a wide variety of fluorophore labels that can usefully be attached to the antibodies of the present invention. For flow cytometric applications, both for extracellular detection and for intracellular detection, common useful fluorophores can be fluorescein isothiocyanate (FITC), allophycocyanin (APC), R-phycoerythrin (PE), peridinin chlorophyll protein (PerCP), Texas Red, Cy3, CyS, fluorescence resonance energy tandem fluorophores such as PerCP-Cy5.5, PE-CyS, PE-Cy5.5, PE-Cy7, PE-Texas Red, and APC-Cy7.
[0216] Other fluorophores include, inter alia, Alexa Fluor 350, Alexa Fluor 488, Alexa Fluor 532, Alexa Fluor 546, Alexa Fluor 568, Alexa Fluor 594, Alexa Fluor 647 (monoclonal antibody labeling kits available from Molecular Probes, Inc., Eugene, Oreg., USA), BODIPY dyes, such as BODIPY 493/503, BODIPY FL, BODIPY R6G, BODIPY 530/550, BODIPY TMR, BODIPY 558/568, BODIPY 558/568, BODIPY 564/570, BODIPY 576/589, BODIPY 581/591, BODIPY TR, BODIPY 630/650, BODIPY 650/665, Cascade Blue, Cascade Yellow, Dansyl, lissamine rhodamine B, Marina Blue, Oregon Green 488, Oregon Green 514, Pacific Blue, rhodamine 6G, rhodamine green, rhodamine red, tetramethylrhodamine, Texas Red (available from Molecular Probes, Inc., Eugene, Oreg., USA), and Cy2, Cy3, Cy3.5, CyS, Cy5.5, Cy7, all of which are also useful for fluorescently labeling the antibodies of the present invention. For secondary detection using labeled avidin, streptavidin, captavidin or neutravidin, the antibodies of the present invention can usefully be labeled with biotin.
[0217] When the antibodies of the present invention are used, e.g., for western blotting applications, they can usefully be labeled with radioisotopes, such as 33P, 32P, 35S, 3H, and 125I. As another example, when the antibodies of the present invention are used for radioimmunotherapy, the label can usefully be 228Th, 227Ac, 225Ac, 223Ra, 213Bi, 212Pb, 212Bi, 211At, 203Pb, 194Os, 188Re, 186Re, 153Sm, 149Tb, 131I, 125I, 111In, 105Rh, 99mTc, 97Ru, 90Y, 90Sr, 88Y, 72Se, 67Cu, or 47Sc.
[0218] As another example, when the antibodies of the present invention are to be used for in vivo diagnostic use, they can be rendered detectable by conjugation to MRI contrast agents, such as gadolinium diethylenetriaminepentaacetic acid (DTPA), Lauffer et al., Radiology 207(2): 529-38 (1998), or by radioisotopic labeling.
[0219] The antibodies of the present invention, including fragments and derivatives thereof, can also be conjugated to toxins, in order to target the toxin's ablative action to cells that display and/or express the polypeptides of the present invention. The antibody in such immunotoxins is conjugated to Pseudomonas exotoxin A, diphtheria toxin, shiga toxin A, anthrax toxin lethal factor, or ricin. See Hall (ed.), Immunotoxin Methods and Protocols (Methods in Molecular Biology, vol. 166), Humana Press (2000); and Frankel et al. (eds.), Clinical Applications of Immunotoxins, Springer-Verlag (1998).
[0220] In one aspect, the invention provides a device for determining whether a urine sample from a subject contains full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a combination thereof, the device comprising at least one antibody that specifically binds to full-length PAPPA2, proteolytically cleaved PAPPA2, NGAL, KRT20, or TACSTD2 protein, or a fragment thereof.
[0221] The antibodies of the present invention can usefully be attached to a substrate of a device, and it is, therefore, another aspect of the invention to provide antibodies that bind specifically to one or more of the polypeptides of the present invention, to one or more of the polypeptides encoded by the isolated nucleic acid molecules of the present invention, or the binding of which can be competitively inhibited by one or more of the polypeptides of the present invention or one or more of the polypeptides encoded by the isolated nucleic acid molecules of the present invention, attached to a substrate. Substrates can be porous or nonporous, planar or nonplanar. For example, the antibodies of the present invention can usefully be conjugated to filtration media, such as NHS-activated Sepharose or CNBr-activated Sepharose for purposes of immunoaffinity chromatography. For example, the antibodies of the present invention can usefully be attached to paramagnetic microspheres by, for example, biotin-streptavidin interaction. The microsphere can then be used for isolation of one or more cells that express or display the polypeptides of the present invention. As another example, the antibodies of the present invention can be attached to the surface of a microtiter plate for ELISA.
[0222] As noted herein, the antibodies of the present invention can be produced in prokaryotic and eukaryotic cells. It is, therefore, another aspect of the present invention to provide cells that express the antibodies of the present invention, including hybridoma cells, Beta cells, plasma cells, and host cells recombinantly modified to express the antibodies of the present invention.
[0223] In yet a further aspect, the present invention provides aptamers evolved to bind specifically to one or more of the PAPPA2, NGAL, KRT20, or TACSTD proteins of the present invention or to polypeptides encoded by the nucleic acids of the invention.
[0224] In sum, one of skill in the art, provided with the teachings of this invention, has available a variety of methods which can be used to alter the biological properties of the antibodies of this invention including methods which can increase or decrease the stability or half-life, immunogenicity, toxicity, affinity or yield of a given antibody molecule, or to alter it in any other way that can render it more suitable for a particular application.
Pharmaceutical Compositions and Administration for Therapy
[0225] The treatments described herein can be administered to the subject once (e.g., as a single injection or deposition). Alternatively, treatments can be administered once or twice daily to a subject in need thereof for a period of from about two to about twenty-eight days, or from about seven to about ten days. A treatment can also be administered once or twice daily to a subject for a period of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 times per year, or a combination thereof. Furthermore, therapeutics can be co-administrated with another therapeutic.
[0226] The treatments of this invention can be formulated and administered to reduce the symptoms associated with vAKI or iAKI. Treatments can be administered by any conventional means available for use in conjunction with pharmaceuticals. Treatments can be administered alone, but are generally administered with a pharmaceutical carrier selected on the basis of the chosen route of administration and standard pharmaceutical practice.
[0227] A therapeutically effective treatment can depend upon a number of factors known to those or ordinary skill in the art. The dose(s) of a treatment inhibitor can vary, for example, depending upon the identity, size, and condition of the subject or sample being treated, further depending upon the route by which the treatment is to be administered. These amounts can be readily determined by a skilled artisan. Any of the therapeutic applications described herein can be applied to any subject in need of such therapy, including, for example, a mammal such as a dog, a cat, a cow, a horse, a rabbit, a monkey, a pig, a sheep, a goat, or a human.
[0228] Pharmaceutical compositions for use in accordance with the invention can be formulated in conventional manner using one or more physiologically acceptable carriers or excipients. The therapeutic compositions of the invention can be formulated for a variety of routes of administration, including systemic and topical or localized administration. Techniques and formulations generally can be found in Remington's Pharmaceutical Sciences, Meade Publishing Co., Easton, Pa (20th Ed., 2000), the entire disclosure of which is herein incorporated by reference. For systemic administration, an injection is useful, including intramuscular, intravenous, intraperitoneal, and subcutaneous. For injection, the therapeutic compositions of the invention can be formulated in liquid solutions, for example in physiologically compatible buffers such as Hank's solution or Ringer's solution. In addition, the therapeutic compositions can be formulated in solid form and redissolved or suspended immediately prior to use. Lyophilized forms are also included. Pharmaceutical compositions of the present invention are characterized as being at least sterile and pyrogen-free. These pharmaceutical formulations include formulations for human and veterinary use.
[0229] According to the invention, a pharmaceutically acceptable carrier can comprise any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. The use of such media and agents for pharmaceutically active substances is well known in the art. Any conventional media or agent that is compatible with the active compound can be used. Supplementary active compounds can also be incorporated into the compositions.
[0230] A pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation or ingestion), transdermal (topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfate; chelating agents such as ethylenediaminetetraacetic acid; buffers such as acetates, citrates or phosphates and agents for the adjustment of tonicity such as sodium chloride or dextrose. pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.
[0231] Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersions. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, a pharmaceutically acceptable polyol like glycerol, propylene glycol, liquid polyetheylene glycol, and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it can be useful to include isotonic agents, for example, sugars, polyalcohols such as mannitol, sorbitol, sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.
[0232] Sterile injectable solutions can be prepared by incorporating the inhibitor (e.g., a polypeptide or antibody or small molecule) of the invention in the required amount in an appropriate solvent with one or a combination of ingredients enumerated herein, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle which contains a basic dispersion medium and the required other ingredients from those enumerated herein. In the case of sterile powders for the preparation of sterile injectable solutions, examples of useful preparation methods are vacuum drying and freeze-drying which yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.
[0233] Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier and subsequently swallowed.
[0234] Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.
[0235] Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.
[0236] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Exemplary methods and materials are described below, although methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention.
[0237] All publications and other references mentioned herein are incorporated by reference in their entirety, as if each individual publication or reference were specifically and individually indicated to be incorporated by reference. Publications and references cited herein are not admitted to be prior art.
EXAMPLES
[0238] Examples are provided below to facilitate a more complete understanding of the invention. The following examples illustrate the exemplary modes of making and practicing the invention. However, the scope of the invention is not limited to specific embodiments disclosed in these Examples, which are for purposes of illustration only, since alternative methods can be utilized to obtain similar results.
Example 1a Point-of-Care Test that Distinguishes Non-Fatal Volume Depletion from Fatal Tubular Injury of the Kidney
[0239] Abstract
[0240] Nephrology is the only field in Medicine that uses a single analyteserum creatinine (sCr)to suggest organ injury. Yet the rise of sCr trails the injury by 24 hrs, if not by days, and it is insensitive to <50% damage. Most vexing is the fact that common volume depletion (75%) and tubular injury (ATN 25%) both increase sCr, meaning that therapy is not based on a prospective physiological assay. The consequence of unguided decisions includes unacceptable morbidity, multiple testing, escalation of careLOS and increased aggregate costs of $7500 ppt. Described herein is a solution: while the damaged kidney does not produce a symptom like chest pain, it announces its injury by releasing proteins into the urine that have been detected by massive sequencing, and that when assayed together, distinguishes volume depletion from tubular injury at the time of patient contact. The assay is a point of care (POC) Urine Dip-Chip, or other rapid measurement devices including, but not limited to, microfluidics, lateral flow dip sticks, and rapid western blotting technology, administered by the clinician, applied to all patients with elevated s-Cr levels. Modeling indicates that the invention described herein will not only modify the cycle of care but save US Hospitals $3.6-$5.7B because of the huge population at risk (5-7% of all Emergency patients) that are managed today only by a $7 test for sCr.
[0241] Section IClinical Context: Does a True Umet Cinical Need Exist?
[0242] Summary Statement of Unmet Need: There is currently a need to prospectively distinguish potentially fatal from nonfatal changes in kidney function at the point of patient contact, thereby correcting mismatches between clinical urgency, level of care, and costs.
[0243] Discovery of the Unmet Clinical Need: Imagine presenting to the Emergency Department (ED), and a few hours after a patients blood is drawn, the physician informs the patient that they have Acute Kidney Injury (AKI) and that they must stay in the hospital because of this perilous condition. Chances are that the patient will receive intravenous fluids or be placed on a near starvation diet. If the patient's presentation included fever, the concern would be Septic or Ischemic-AKI, or if the patient takes certain medications, the concern would be Nephrotoxic-AKI, both potentially fatal (Septic or Ischemic or Nephrotoxic AKI=Tubular Damage). At this point, the doctor mentions the possibility of dialysis. Now imagine that the patient's blood is taken again at 24 hrs and 48 hrs. Will these new levels show that the doctor was correct, or that his concern was misplaced? From studies of >3000 patients, the Barasch lab knows that the discussions were premature (>75% of cases) and that the initial therapy was misapplied (>25% of cases). Does this ever happen? Unfortunately it is commonplace for the 12.4M patients presenting to the ED (7% of admitted patients have elevated serum creatinine (sCr)) diagnosed with fatal or non-fatal AKI.sup.1 and for some hospitalized in ICUs (30-50% of critical care patients have increased sCr).sup.2-4.
[0244] The genesis of the problem is clear: Nephrology depends on a single analyte, the serum creatinine test, sCr which unfortunately is elevated both in cases of simple volume depletion non-fatal AKI (
[0245] Current Cycle of Care is shown in
[0246] Stakeholder Analysis: (i) Patients would support the diagnostic tool described herein-the Urine Dip-Chip, or other rapid measurement devices including, but not limited to, microfluidics, lateral flow dip sticks, and rapid western blotting technology, because they are a non-invasive method that reduces unintended risks, reduces LOS and opportunity costs, and fewer changes in medications/treatments due to delayed diagnosis. (ii) Physicians and nephrologists can support the method of diagnosis and treatment described herein because it enhances workflow and guides therapy, reducing malpractice risk by prospectively directing medication adjustments, transfusions, electrolyte treatments and preparation for dialysis. Reduced referrals may be a risk for nephrologists, but interpretation of reciprocal biomarker values in the context of sCr can support even greater numbers of referrals. Downcoding of some patients can also reduce enthusiasm and provide a barrier, but this depends on payers (see Value). (iii) Hospitals will appreciate the increased efficiency and turnover in the ED/ICU/Post-Op due to matching illness with the level of care, providing cost avoidance, reducing LOS, and obviating downcoding (see Value) (iv) Clinical Labs will not be adverse to the Urine Dip-Chip, or other rapid measurement devices including, but not limited to, microfluidics, lateral flow dip sticks, and rapid western blotting technology, because they are an add-on rather than a substitute for sCr. In fact, CPT codes already exist for biomarkers of other diseases and for related lab techniques such as ELISA and Immunoblot. A significant issue arises if there is a demand for gold standard levels from a clinical lab analyzer, but given the paucity of kidney diagnostics to date, and the clarity of the findings described herein, it is expected that this demand can be downstream of the introduction of the new biomarkers described herein. In addition, while it is understood that training and maintenance would increase cost, it is the case that labs currently service the ubiquitous Abbott iSTAT POC, (v) Biotech and Investors will enter an entirely new space with new devices that have the flexibility to configure different biomarkers identified herein, providing many alternative opportunities (vi) Payers and Insurance (see Value) will be supportive, because based on primary research, biomarkers reduce costs ($408-522 ppt)5 because they circumvent unnecessary treatments and LOS.
[0247] Customer Discovery Validates the Unmet Need and Identifies Investors. Key Opinion Leaders Validate the Unmet Need and agree that volume depletion and tubular damage need to be distinguished6. The ED is obligated to treat all comers (Emergency Medical Treatment and Active Labor Law), but cannot bill for observational stays, a problem compounded by fact that these patients cannot meet the two-midnight rule if admitted. Consequently, key opinion leaders are supportive if one can rapidly identify correctable volume depleted patients to help reduce his census. Some have pointed out that the current flu epidemic (Flu.gov) is a case in point where an elevated sCr may represent volume depletion or septic AKI, both common occurrences with the flu. Hence, they were supportive that the device described herein will help triage patients in anticipation of ICU admission, particularly because increasing nursing staff from 2:1 to 1:1 is required for dialysis. The culture in the ICU is accepting of POC. One key opinion leader who manages the POC, was accepting, if the device described herein matched the results of a Clinical Lab Analyzer (which requires an investment) in thorough clinical trials. In addition, it was indicated that extensive optimization of sample preparation was needed7. Another was supportive as the technology described herein allows physicians to concentrate on higher acuity patients, which result in higher reimbursement. Furthermore, while DRGs and older CPT codes combine AKI patients, fractionation into lower cost volume depletion and higher cost tubular injury could result in profitability under shared savings models with insurers. It was also stressed that a hospital's biggest liabilities are Standard of Care targets and thus the biomarkers described herein will have to be incorporated into SOC. One nephrologist stressed that AKI bills at a high acuity, but down-coding to volume depletion is a barrier, which could be compensated by saving on DRG/ACO mandates and increasing consultations.
[0248] Section IIValue Proposition
[0249] State-of-the Art: (#1) sCr (since 1929)8 purports to meet the unmet need but cannot provide adequate guidance because of its intrinsic characteristics: Delay: A positive test requires accumulating grams of creatinine in the blood, and this process usually requires >24-48 hours. The delay confounds care plans. Sensitivity: Tubular damage may not elevate sCr because >50% of renal mass must be damaged9. Misdiagnosis: sCr also increases in volume depletion (
[0250] Emerging Solutions and Investments: The goal is to find biomarkers with the following test characteristics: higher sensitivity than sCr, rapid expression in urine or blood and specificity for potentially non-fatal (volume) vs fatal (ischemic, septic) presentations1,4. NGAL13,14 has a number of these attributes, but it is expressed as a continuous logarithmic function, meaning that volume depleted patients have a 2 fold elevation (injury >10 fold) debating its specificity. In addition, because its expression is so rapid, before sCr rise, the dissociation of NGAL with sCr has lead authors to suggest a complex 4 fold characterization: normal (sCrNGAL), loss of function without injury (sCr+NGAL), damage without loss of function (sCrNGAL+) and finally damage with loss of function (sCr+NGAL+). While such embellishments can be useful, the scheme does not recognize the distinction between volume depletion and intrinsic injury. Assay platforms include the NGAL Test ($33/test) (BioPorto) and the Architect NGAL assay (35/test) (Abbott, JAPAN). Kim1 is another injury biomarker, but it is expressed 12 hrs after the event, and it is difficult to measure (pg range) because it fragments in the urine. Kim1 may not be dose responsive with injury. Timp2IGFBP7 is a combination of new biomarkers used in NephroCheck POC, but non-specificity (50% false positive rate according to FDA)15 is problematic.
[0251] Envisioned Product: The product described herein is an automated diagnostic test that distinguishes volume depletion from tubular injury. The platform, called the mChip, can run a diagnostic test from start to finish using 1 L of urine, replicating all the key steps of ELISA and POC (or other rapid measurement devices including, but not limited to, microfluidics, lateral flow dip sticks, and rapid western blotting technology), but at low cost without complex instrumentation. Initial versions of mChip have been field-tested to detect HIV and sexually transmitted diseases 16-18. Most recently, this device was moved into a form factor that is cheaper, smaller, and easier-to-use including a $34 dongle (replacing a $100,000 instrument) which connects to Smartphones and a mChip ($1.44 ppt) to read out what were otherwise traditionally sophisticated ELISA tests (
[0252] Enabling Innovation: By massive sequencing of transcriptome and proteome of mouse and human analytes were identified which address: Delay in Diagnosis: The markers described herein are activated within 3 hrs of AKI. Lack of Sensitivity: Only nanogram quantities of urine proteins are required. Misdiagnosis: One biomarker responds to volume depletion (PAPPA2) while the others respond to tubular damage (Cytokeratin20, Tacstd2, NGAL); because the markers are mutually exclusive, the ratio between the two biomarkers enhances specificity for the diagnosis in either direction (e.g. volume depletion+, tubular damage or volume depletion, tubular damage+). Combination of markers (volume depletion+, tubular damage+) would indicate damage. Hence, the technology described herein (
[0253] The Smartphone mChip platform is perfectly suited to urine diagnostics because it matches the performance of lab ELISA systems in quantitative readout, high sensitivity due to log order amplification chemistry and multiplexing capability. Other suitable platforms can be used but lateral flow tests are hindered by subjective interpretation of bands, low sensitivity and lack of multiplexing.
[0254] Preliminary Results: The anticipated limits of detection and required cutoffs (ng/mL) are well within the capabilities of the mChip platform. The reproducibility of mChip has matched those of ELISA, with quantitative performance at 3 ng/mL t-PSA. Excellent agreement with the gold-standard Siemens ADVIA Centaur assay was found. And of course mChip platform has been tested head-to-head against lateral flow tests, with superior sensitivity.
[0255] Value Proposition: Excellent preliminary data (suggesting disruptive refocusing of nephrology) and low costs for the technology described herein are drivers of the Value Proposition herein. In addition, each stakeholder has idiosyncratic value added: (A) Hospitals are the Key Customers: On the basis of health economics research, the Urine Dip-Chip, or other rapid measurement devices including, but not limited to, microfluidics, lateral flow dip sticks, and rapid western blotting technology, would provide cost-avoidance and net revenue increases. (i) If a patient is diagnosed with Tubular Damage, yet sCr rapidly returns to normal (e.g. volume depletion), then the admission would be down-coded to observation, a 60% loss of revenue for community hospitals, and additionally an unnecessary consumption of nursing and administrative coverage. Moreover a case of greater severity would not be awarded a hospital bed if such a patient were admitted (which is required at Columbia where observation cannot be billed), an opportunity loss. Even when the patient remains in the ED until the sCr has resolved, such a patient blocks more acute patients from occupying the ED, which then must divert patients (Columbia ED >300% of capacity).
[0256] Given that ED evaluation is mandated by EMTALA, confusion over AKI diagnoses looses money. (ii) Lack of diagnostic clarity in hospitalized patients increases effort and LOS with repetitive testing to meet SOC. This scenario was modeledbiomarkers of injury5 and it was found that while treatment costs were $50pp higher upon the addition of a NGAL, NGAL+Scr resulted in 1,578-1,973/10,000 fewer patients with delayed diagnosis and treatment than Scr alone (calculated retrospectively). Consequently, total costs declined by $408-$522 pp (av $465). Therefore, the Urine Dip-Chip described herein, or other rapid measurement devices including, but not limited to, microfluidics, lateral flow dip sticks, rapid western blotting technology, with two biomarkers, would avoid those costs and reduce length of stay by prospectively providing diagnosis. (B) Healthcare Providers: Allows triage towards higher acuity with greater accuracy. In addition, if the payee model is bundled, or a shared savings model the hospital and the providers share in the savings. (C) Payers: Potential to share in cost savings achieved by the hospital through the shared savings model. Reduction in unnecessary treatments helps payers justify reimbursement for therapies. (D) Investors: Opportunity to invest in an area of diagnostics with limited competition through innovative POC technology; significant scope to expand market by moving into other settings (clinics/homecare POC). (E) Regulatory: Non-invasive rapid point-of-care testing on routine samples; current SOC needs improvement.
References for Example 1
[0257] 1. Nickolas, T. L. et al. Sensitivity and specificity of a single emergency department measurement of urinary neutrophil gelatinase-associated lipocalin for diagnosing acute kidney injury. Ann. Intern. Med. 148, 810-819 (2008). [0258] 2. Centers for Disease Control and Prevention. National Center for Health Statistics: Emergency Department Visits. at http://www.cdc.gov/nchs/fastats/emergency-department.htm [0259] 3. Philip R. Lee Institute for Health Policy Studies. ICU Outcomes (Mortality and Length of Stay) Methods, Data Collection Tool and Data. at www.healthpolicy.ucsf.edu/content/icu-outcomes. [0260] 4. Mandelbaum, T. et al. Outcome of critically ill patients with acute kidney injury using the Acute Kidney Injury Network criteria*. Crit. Care Med. 39, (2011). [0261] 5. A., P., J., R., D., C. & T., N. Does NGAL reduce costs? A cost analysis of urine NGAL (UNGAL) and serum creatinine (SCR) for acute kidney injury (AKI) diagnosis. Crit. Care Med. 38, A106 (2010). [0262] 6. Yuen, P. S. T., Jo, S.-K., Holly, M. K., Hu, X. & Star, R. A. Ischemic and nephrotoxic acute renal failure are distinguished by their broad transcriptomic responses. Physiol. Genomics 25, 375-86 (2006). [0263] 7. Rai, A. J. The Urinary Proteome: Methods and Protocols (Methods in Molecular Biology, 641). Springer 1-362 (2010). at <papers2://publication/uuid/F8636D6E-36B2-4196-87D2-7B401B614D67> [0264] 8. Jaffe, M. Ueber den Niederschlag welchen Pikrinsa{umlaut over ( )} ure in normalen Ham erzeugt and u{umlaut over ( )} ber eine neuereaction des Kreatinins. Z Physiol Chem 10, 391-400 (1886). [0265] 9. Sise, M. E. et al. Urine neutrophil gelatinase-associated lipocalin identifies unilateral and bilateral urinary tract obstruction. Nephrol. Dial. Transplant 26, 4132-5 (2011). [0266] 10. Schrier, R. W. Diagnostic value of urinary sodium, chloride, urea, and flow. J. Am. Soc. Nephrol. 22, 1610-3 (2011). [0267] 11. Nickolas, T. L. et al. Article Annals of Internal Medicine Sensitivity and Specificity of a Single Emergency Department Measurement of Urinary Neutrophil GelatinaseAssociated Lipocalin for Diagnosing Acute Kidney Injury. Ann. Intern. Med. 148, 810-819 (2008). [0268] 12. Kidney Disease Statistics for the United States National Institute of Diabetes and Digestive and Kidney Diseases (NIDDK). at http://www.niddk.nih.gov/health-information/healthstatistics/Pages/kidney-disease-statistics-united-states.aspx#8 [0269] 13. Mishra, J. et al. Neutrophil gelatinase-associated lipocalin: A novel early urinary biomarker for cisplatin nephrotoxicity. Am. J. Nephrol. 24, 307-315 (2004). [0270] 14. Mishra, J. et al. Identification of neutrophil gelatinase-associated lipocalin as a novel early urinary biomarker for ischemic renal injury. J. Am. Soc. Nephrol. 14, 2534-2543 (2003). [0271] 15. FDA. Press AnnouncementsFDA allows marketing of the first test to assess risk of developing acute kidney injury. at http://www.fda.gov/newsevents/newsroom/pressannouncements/ucm412910.htm [0272] 16. Chin, C. D. et al. Microfluidics-based diagnostics of infectious diseases in the developing world. Nat. Med. 17, 1015-9 (2011). [0273] 17. Chin, C. D. et al. Mobile device for disease diagnosis and data tracking in resource-limited settings. Clin. Chem. 59, 629-40 (2013). [0274] 18. Laksanasopin, T. et al. A smartphone dongle for diagnosis of infectious diseases at the point of care. Sci. Transl. Med. 7, 273re1 (2015). [0275] 19. Chertow, G. M., Burdick, E., Honour, M., Bonventre, J. V & Bates, D. W. Acute kidney injury, mortality, length of stay, and costs in hospitalized patients. J. Am. Soc. Nephrol. 16, 3365-70 (2005). [0276] 20. Rewa, O. & Bagshaw, S. M. Acute kidney injury-epidemiology, outcomes and economics. Nat. Rev. Nephrol. 10, 193-207 (2014). [0277] 21. Kalorama. The United States Market for In Vitro Diagnostic Tests: Market Research Report. At http://www.kaloramainformation.com/United-States-Vitro-8079142/22. [0278] 22. Hsu, C.-Y. et al. Community-based incidence of acute renal failure. Kidney Int 72, 208-12 (2007). [0279] 23. Siew, E. D. et al. Predictors of Recurrent AKI. J. Am. Soc. Nephrol. (2015). doi:10.1681/ASN.2014121218 [0280] 24. Kalorama. The World Market for Point of Care (POC) Diagnostics: Market Research Report
Example 2Unique Transcriptional Programs Identify Subtypes of Acute Kidney Injury
[0281] Abstract
[0282] Acute kidney failure was traditionally categorized by etiology including prerenal/transient kidney failure, intrinsic/prolonged kidney failure (ATN), or postrenal kidney failure. In contrast, more recent classifications focus on two metrics, the rise in serum creatinine (sCr) or a decrease in urine output as tantamount to kidney injury (Acute Kidney Injury, AKI), without emphasis on its potential etiologies or on clinical heterogeneity. While any form of AKI worsens patient outcomes, it has remained an open question how hemodynamic or volume vAKI is related to intrinsic tubular damage iAKI. To clarify their relationship, transcriptional profiling was performed in mouse models with matched sCr levels. Thousands of genes responding specifically to vAKI or to iAKI were found, but very few responded to both stimuli. These gene sets were not only members of different signal transduction pathways and were functionally unrelated, but they were expressed by different regions of the kidney. Moreover some of these proteins demonstrated distinctive patterns in human urine as potential biomarkers of either vAKI or iAKI. Hence, despite similar sCr levels, vAKI and iAKI in the models herein were biologically distinct, implying that tests for these genes could refine and enhance current definitions of acute injury of the kidney.
[0283] The critical function of the kidney is the preservation of water and electrolytes. These functions are conserved throughout the animal kingdom from planaria to mammals.sup.1,2. When Na+ and water are scarce (volume depletion), the kidney's excretory responses decrease, causing Na+, water, and urea retention.sup.3-6. When volume depletion is more severe, the serum creatinine, sCr, is also retained. A similar scenario occurs in the setting of non-renal diseases that mimic volume depletion such as severe congestive heart and liver failure, because similar drivers (angiotensin-aldosterone systems) and effectors of volume retention (ENac, Na/KATPase and osmolytes) are activated (currently called cardio-renal and hepato-renal syndromes). Adding further complexity, destruction of kidney epithelia by toxic stimuli (e.g. ischemia, sepsis, nephrotoxins) also blocks water, electrolyte, urea, and sCr excretion. Hence, it is not surprising that increases in urea and sCr of different etiologies are associated with poor prognoses.sup.7,8, but it remains challenging to prospectively distinguish subtypes of diminished excretion on the basis of current blood or urine measurements.
[0284] It may be the case that different forms of diminished kidney excretory activity are highly related to one another, as indicated by the application of the RIFLE, the Acute Kidney Injury Network, and the Kidney Disease Improving Global Outcomes.sup.9 scales to a wide range of clinical settings.sup.7. These scales focus on sCr as the principal metric of acute injury to the kidney (AKI), since sCr has an unequivocal dose-responsive relationship with clinical outcomes. In this light, equivalent levels of sCr should be associated with similar patterns of cellular damage. Less severe elevations of sCr should be a forme-fruste of more severe elevations, expressing attenuated, but similar patterns of cellular responses. On the other hand, it is also possible that the relationship between sCr and tissue damage differs across etiologies and varies during the course of an acute illness, for example as a result of changing extracellular volume.sup.10. By this logic, different etiologies could induce different types of epithelial damage, and different types of protective and repair mechanisms (e.g. prostaglandins, NO, HIF).sup.8,11-15 at similar levels of sCr. Mapping the nephron may be required to understand the relationship between elevated sCr and cellular responses.
[0285] The inherent characteristics of sCr may also confound its association with a single cellular response. The level of sCr can only represent the extent of damage after a specific time interval has elapsed, because it accumulates at variable rates as a function of muscle mass.sup.16, nutrition.sup.17, body surface area, and Scr reabsorption.sup.18,19 in fact complicating the relationship between sCr and GFR..sup.18,20-24 Moreover, recruitment of the renal reserve.sup.25 may obscure the rise in sCr and limit detection of a significant loss of renal mass, even partial obstruction.sup.26 or kidney donation.sup.27 (called subclinical AKI.sup.28). Finally, different sCr metrics capture different patients.sup.29,30 and false positive AKI diagnoses in up to 30% of cases have been modeled. Hence, it is not surprising that sCr dissociates from renal histology in critical care..sup.8,31,32 In sum, in kinetically active, non-steady state conditions, the level of sCr may not reflect the level of acute injury.
[0286] To examine the relationship between sCr and cellular responses, mouse models of volume depletion (vAKI) and ischemia (iAKI) were compared at matched levels of sCr. Kidney histology, serum measurements, and the regional expression of thousands of genes were divergent. These data translated to human AKI because the different genes could distinguish subsets of patients with elevated sCr. In sum, the extra-renal environment elicited specific cellular and molecular responses in specific domains of the kidney, which could not have been directly predicted by the level of sCr.
[0287] Results
[0288] Differential Responses to vAKI and iAKI in Mouse Models: iAKI was induced by 10 minutes of bilateral renal artery ischemia which raised sCr 1.5 fold at the 24 hr point (p<0.03). vAKI was induced by 72 hours of water deprivation.sup.33 and reduced food intake (6.20.3 vs 1.20.4 g on day 3; p<0.001) which raised sCr 1.9 fold (p<0.01). Nonetheless, despite achieving similar sCr at RIFL-R levels (p=NS), the models differed in clinical, serum, and histologic measurements. iAKI mice maintained activity, whereas the vAKI mice appeared lethargic. iAKI mice maintained weight (17.81.2 g vs 15.21.1 g; NS) and a normal BUN/Cr ratio, whereas volume depleted mice lost 20% weight (18.50.2 g vs 14.60.5 g; p<0.001) and became azotemic, hypernatremic and hemoconcentrated. The iAKI kidneys consistently demonstrated regions of coagulative necrosis at the outer edge of the outer stripe of the outer medulla (OSOM), a region known to be most sensitive to ischemic damage.sup.34, while vAKI kidneys failed to demonstrate cellular derangements (
[0289] To examine transcriptional differences in microanatomic regions of the kidney, laser capture microdissection (LCM) of unfixed frozen sections from vAKI (n=5), iAKI (n=3), and control (n=3) whole kidney, glomeruli, cortex, outer stripe of the outer medulla (OSOM), and inner stripe of the outer medulla (ISOM) (50 independent samples) was used. Both RNA sequencing and quantitative real-time PCR confirmed the appropriate enrichment of segment specific genes from podocytes, proximal, and distal tubules.sup.35,36 in the captured RNA pools (
[0290] To determine the relationship between different kidney regions and their responses to stimuli, an unsupervised hierarchical clustering analysis (
[0291] Differential Expression of Known and Novel AKI Genes: To identify specific genes that might distinguish iAKI from vAKI, known biomarkers of kidney tubular injury.sup.43 upregulated >2-fold (p-value<10-5) after 10 min of ischemia (Table 1) were first examined. Prominent iAKI genes included Sppl (OPN), Cxcl1 (GRO-), Lcn2 (NGAL) with p-values<10-21 and Clu, Havcr (Kim1), Timp1 with p-values<10-10. These genes were predominately expressed in OSOM. For example, Lcn2 RNA was intensely expressed by the TALH and Intercalated Cells after iAKI (
[0292] In contrast to the genes listed above, a subset of biomarkers were unchanged or downregulated (2Microglobulin, Timp2, Netrin, Igfbp7, Tnfsf10, HGF) after 10 min of ischemia, in agreement with published data.sup.44,45. Consequently, to determine whether there were additional stimulus-specific genes, all upregulated genes (>2-fold; p-value<10-5) were cataloged and it was found 92.3% (1158) of iAKI regulated genes were not expressed in the vAKI model (Table 2A) and conversely, 51.7% (103 genes) of vAKI regulated genes were not expressed in the iAKI model (Table 2B). In addition, iAKI specific genes were generally localized to the OSOM (e.g. Trop2/Tactstd2, 4.26 fold, p<10-9 and Cytokeratin 20, 1643 fold, p<10-12) demonstrating prominent expression (
[0293] Examination of vAKI and iAKI Genes in Human Urine: Statistically significant, 2-fold upregulated mouse genes (p-value<10-5) were compared with the Secreted Protein Database and the Max Plank Unified Proteome to identify putatively secreted iAKI (267, Table 3A) and vAKI (30, Table 3B) proteins in human urine. Candidates from different regions of the kidney were tested using urine collected from patients in Emergency Departments.sup.48,49. Their clinical histories were previously adjudicated by strict criteria (see Methods; reference 48), including clinical history, time to resolution of elevated sCr (vAKI<72 hrs; iAKI7 days), and rapid response to volume challenges. Representative iAKI patients had acute illnesses due to obstructive uropathy, sepsis and rhabdomyolysis with a 2.56 fold rise in sCr at the time of admission from the Emergency Department and prolonged azotemia 7 days; these patients were seen by a renal consultant. Representative vAKI patients had an acute illness due to hyperglycemia, gastroenteritis, syncope, drug overdose with a 2.14 fold rise in sCr which resolved within <72 hrs, but were not visited by a renal consultant. Normal patients had acute illnesses due to gastroenteritis and cardiovascular disease and trauma with no rise in sCr.
[0294] Chi311, Trop2 (Tacstd2), Plat, Krt20 (
[0295] Prevalence of Transient vs Sustained Azotemia: Analysis of >2000 Emergency Department patients.sup.48,49 demonstrated that prolonged sCr elevation associated with high levels of urinary biomarkers, whereas brief azotemia, including volume sensitive reversal of sCr, was far less inductive (e.g. NGAL remained in the normal range.sup.57). To identify the predominate kinetics of sCr in New York City, an algorithm was developed to detect baseline sCr values (available in 52,391 patients) and 0.3 mg/dL deflections above baseline (which occurred 1 time in 25,348 patients during the same hospitalization, i.e. 54,435 events) in the New York Presbyterian-Columbia University Clinical Data Warehouse (3.8 million patients). It was found that sCr resolved in 33% of patients after 1 day, 60% after 2 days and 73% after 3 days. In sum, increased sCr, definitional for AKI criteria, is elevated only briefly in the majority of cases, once the patient comes to medical attention.
DISCUSSION
[0296] The failure to excrete of salt and water and even urea and sCr by the kidney is a common result of tubular injury, volume depletion and a myriad of other diseases including heart and liver failure. As a result, it can be quite challenging to distinguish these entities at the point of patient contact, especially at lower elevations of urea and sCr. Consequently, it can be the case that each of these entities invokes an etiologically indifferent final common pathway best measured by sCr. On the other hand, if stimulus-specific genetic readouts accompanied elevations of sCr, one can obtain information reflecting pathogenesis and consequently revise definitions of AKI.
[0297] In fact, known biomarkers can demonstrate stimulus specific expression.sup.60. For example, numerous studies show that NGAL expression is linked to sepsis, nephrotoxicity, and ischemia in rats, mice, pigs, dogs.sup.33,49,61 as well as in human neonates, children, adults.sup.62 subject to poor outcomes.sup.49,13, but in contrast, NGAL is poorly responsive to volume deficits.sup.33,49 and to diuretics.sup.33 which nonetheless elevate sCr in patients.sup.49,63 and in animal models.sup.33. It was hypothesized that these discriminating characteristics were not specific to NGAL but rather intrinsic to AKI. Consequently, iAKI and vAKI models should express different cellular and genetic programs. In fact, kidney histology demonstrated that while tubular damage was obvious in iAKI, vAKI kidneys failed to show any evidence of injury. Study by RNA-seq, in situ hybridization, immunocytochemistry and immunoblotting human urine identifying hundreds of genes biased to either iAKI or vAKI, highlighted differences between the models. These data were supported by ongoing efforts in gene mapping, adapting the method of Gay et al. of cell specific labeling of RNA.sup.64, using HoxB7-Cre-driven phosphoribosyltransferase to isolate the response of the collecting duct to iAKI and vAKI. 86.3% (139) of iAKI genes (>2-fold; p-value<0.05) were not expressed in vAKI model, and conversely, 95.9% (522) of vAKI genes were not expressed in the iAKI model, similar to LCM analysis of kidney domains. These findings are also in agreement with transcriptomic analysis by Star and colleagues.sup.39 and with measurements of tubular cell energetics, which were preserved in vAKI but not in iAKI.sup.58. The data described herein are also reminders of the well-known mismatches between sCr and renal pathology.sup.8,31,32, and the limited changes in sCr even when there is significant damage by partial obstruction.sup.26 or even the loss of an entire kidney (donation).sup.7,59, a phenomenon that has been called subclinical AKI.sup.28. The data herein solves these conundrums by demonstrating that a specific level of sCr can reflect a variety of distinct genetic programs.
[0298] Hence, it was not shown that vAKI is an attenuated form of iAKI; rather, each activated a distinct genetic program despite a similar level of sCr. iAKI induced changes in inflammatory, epithelial growth and repair genes. These included the Hippo-signaling pathway, in particular, YAP, an anti-apoptotic transcription cofactor, 1.7-fold (p<105) increased while its inactivator, LATS2, 0.65-fold downregulated (p<104), suggesting mechanisms of epithelial regeneration after injury. In addition, the iAKI model described herein (10 min of ischemia) activated Wnt7a 80.5-fold (p<104), an essential gene promoting tubular repair and regeneration.sup.65, while driving AKI to CKD fibrosis when the pathway is sustained. Other classical inflammatory and repair pathways, such as MAPK, JAK/STAT, NFB, TLR, and Chemokines were also markedly activated in iAKI, in agreement with many landmark studies. Yet none of these pathways were activated in the vAKI model, which instead reflected metabolic and osmotic regulatory pathways in the ISOM, consistent with food and water scarcity.
[0299] Perhaps the distinct patterning of gene expression may be the result of differential sensitivity of different nephron segments to potentially injurious stimuli. The patterning could also result from differentially expressed protective mechanisms. For example, PAPPA2 which is expressed in mouse and human vAKI is a metalloproteinase secreted by the TALH, that may play a role in salt sensitive volume stress66. PAPPA2 targets the IGFBP system, permitting IGF mediated cell survival and growth.sup.67,68. This protein appears to be lost in iAKI due to its own proteolysis, demonstrating the potential loss of a protective pathway.
[0300] While the iAKI and vAKI models diverged in clinical, transcriptional and biochemical assays, they can converge at a different time point, or if the severity of vAKI can be increased. Without being bound by theory, vAKI mice already manifest severe volume derangements over many days and cannot survive further volume depletion. Moreover, even if further manipulation of the vAKI model were possible, sCr would no longer be matched. It is also possible that other models of vAKI (e.g. bleeding, severe heart failure) might better overlap iAKI, yet this remains to be tested, especially since the two models (diuretics) which are consistent with human presentations to Emergency Departments induced the same volume sensitive genes. In this light, vAKI and iAKI can converge only because vAKI sensitizes the kidney to a second hit, for example by increasing the risk of nephrotoxicity69, contrast70, chemotherapy.sup.71, and sepsis induced AKI.sup.54.
[0301] The distinct patterning of vAKI and iAKI genes has a number of clinical applications including the possible utility of a new class of biomarkers responsive to reversible volume stresses. Pending the testing of the multitude of secreted vAKI genes, simple ratios (iAKI/vAKI genes) can detect the mechanism of sCr elevation in patients. Additionally, since the vAKI genes rapidly reversed with volume resuscitation, these proteins can also serve as reporters to guide rehydration therapy and limit water/volume intoxication.
[0302] Finally, the data described herein provide an explanation for the dissociation of biomarkers of iAKI with sCr at lower levels of RIFL, AKIN, KDIGO scores. Elevation of sCr by volume depletion (which causes lower levels of elevation) should not be compared with an iAKI biomarker, but rather with vAKI induced proteins. Pooling molecularly and spatially distinct programs reduces the utility of iAKI biomarkers, since these proteins are minimally expressed when sCr rises due to volume depletion.
[0303] In sum, the kidney has a fine tuned response to environmental challenges based on different genetic readouts in different cells in different parts of the nephron. Transient elevation of sCr dominates our hospital records, and if these rapid fluctuations are due to volume sensitivity as was indicated by our Emergency Department series, then new tools specific to iAKI or vAKI may permit prospective diagnoses and treatments at the point of patient contact. Based on clinical, pathological, transcriptional and proteomic data shown here there is evidence that these new tools that may refine our understanding of the AKI syndromes.
[0304] Concise Methods
[0305] Clinical Samples: Emergency Room urine samples were selected at random from a multicenter prospective cohort study49, using published criteria for iAKI, vAKI and control. In brief, the total cohort was followed solely by sCr kinetics, and in a separate analysis, the cohort was adjudicated using strict criteria aimed at identifying only gold standard patients, to identify normals (no fluctuations in sCr, no history of exposure to agents that might cause iAKI such as nephrotoxins, sepsis, obstructive uropathy, rhabdomyolysis), vAKI (RIFL-R and historical or clinical data suggesting decreased renal perfusion for example due to hyperglycemia, diarrhea, but no history of exposure to agents that might cause iAKI such as nephrotoxins, semis, obstructive uropathy, rhabdomyolysis and time limited resolution <3 days with fluid therapy or diuretic withdrawal), and finally iAKI (RIFL-R, with evidence of exposure to stimuli known to induce AKI, but lack of resolution for 168 hrs). Patients in the later category were more likely to require a renal consultant and undergo dialysis. Hence the iAKI and vAKI cohorts differed by time to resolution but also by their history and severity of clinical outcome. Patients with documented urinary tract infections and chronic kidney disease were excluded. Standard blood chemistries were collected each day for 7 days post admission as previously published49.
[0306] Mouse husbandry: Female wild-type C57Bl/6 mice, aged 10-12 weeks (Jackson Labs, Bar Harbor, Me.) were used according to approved protocols.
[0307] Renal ischemia reperfusion injury model: Mice were anesthetized with isoflurane and placed on a warming table to maintain a rectal temperature of 37 C. Left and right renal pedicles were clamped using microvascular clamps (Fine Science Tools, Foster City, Calif.) for 10 minutes. After the clamps were removed, reperfusion of the kidneys was visually confirmed. The kidneys and blood were harvested at 24 hrs.
[0308] Renal volume depletion model: Water was withheld from mice for 72 hours. Body weight and food intake were measured daily. Food intake was determined by weighing chow pellets and spillage. Kidneys were harvested and blood was collected at 72 hrs or mice were rehydrated for an additional 24 hrs.
[0309] Clinical Measurements: Serum creatinine, sodium and blood urea nitrogen, were measured using Creatinine and EC8+ cartridges read by an i-STAT Handheld (Abbott Point of Care, Princeton, N.J.).
[0310] Immunohistochemistry: Kidneys were fixed (4% PFA/0.1M PB at 4 C. overnight), transferred to 30% sucrose/0.1M PB (4C overnight), and embedded in O.C.T. Compound (Tissue-Tek). Frozen sections of 20 m were used for immunofluorescence staining with rabbit anti-KRT20 (1:200; ab118574; Abcam), goat anti-AQP2 (1:400; sc-9880; Santa Cruz Biotechnology), and Fluorescein-labeled Lotus Tetragonolobus Lectin (1:200; FL-1321; Vector Laboratories). Fluorescent secondary antibodies, Alexa Fluor 594-AffiniPure F(ab)2 Fragment Donkey Anti-Rabbit IgG and Alexa Fluor 647-AffiniPure F(ab)2 Fragment Donkey Anti-Goat IgG (1:1000; Jackson Immunoresearch Laboratories), were used for KRT20 and AQP2 identification, respectively. All slides were co-stained with 4,6-diamidino-2-phenylindole to identify nuclei.
[0311] Laser capture microdissection: Kidneys were embedded in O.C.T. Compound (Tissue-Tek) and immediately snap frozen in dry ice and kept in 80C. until time of sectioning. Sections of 8-10 m (20 m for glomeruli) were collected on nuclease-free glass slides covered with a thin membrane (Zeiss Microscopy, Thornwood, N.Y.), fixed in 70% ethanol for 30 seconds, stained with 1% cresyl violet acetate solution and dehydrated in 70% and 100% ethanol followed by air-drying for 30 minutes. Regions of interest were identified morphologically and 15-20 cross sections (for Cortex, OSOM, ISOM) or 1500 cross sections (glomerulus) were microdissected (PALM MicroBeam, Zeiss Microscopy, Thornwood, N.Y.).
[0312] RNA extraction and RNA sequencing: Total RNA was isolated from segment-specific laser captured kidney sections using Ambion RNAqueous Micro Kit (Life Technologies, Carlsbad, Calif.). RNA concentration and integrity for each sample were assessed on RNA 6000 Chips using an Agilent 2100 Bioanalyzer (Agilent Technologies, Santa Clara, Calif.). Poly-A pull-down was used to enrich mRNAs (200 ng-1 ug per sample, sample RIN was above 8.0) and then libraries were prepared using single-end 100 bp reads for each sample with Illumina TruSeq RNA prep kits (Illumina, San Diego, Calif.). Libraries were sequenced using Illumina HiSeq2000. Illumina RTA was used to perform base calling whilst CASAVA (version 1.8.2) for converting base call files (.BCL) to FASTQ format and also perform sequence adaptor trimming. Reads were then mapped to the mouse reference genome (mm9) using Tophat72 (version 2.0.4) allowing 4 mismatches (--read-mismatches=4) and a maximum of 10 multiple hits (--max-multihits=10). The relative expression was calculated using cufflinks73 (version 2.0.2) with default settings. Gene expression levels were normalized by library size and gene length into FPKMs74 and log 2 transformed. Counts tables were generated with HTSeq (http://www-huber.embl.de/users/anders/HTSeq) version 0.6.1. Transcripts with 0 counts across all samples were removed and mathematical artifacts (e.g. negative infinites) were replaced with NA. Statistical analysis was performed in R version 3.1.0 and additional Bioconductor packages were part of release 2.14. Unsupervised cluster analysis was performed on log 2 transformed FPKM values using Spearman correlation as distance and complete linkage as similarity method. No significant differences were seen in mRNA integrity (RIN Agilent 2100 Bioanalyzer) from different samplings and all samples passed the quality controls on post sequencing analysis.
[0313] Generation of heatmaps: Genes that were differentially expressed in iAKI vs. control and vAKI vs. control were included. The expression data shown is the variance stabilized data generated using the DESeq package from Bioconductor according to the DESeq vignette (bioconductor.org/packages/release/bioc/html/DESeq.html, bioconductor.org/packages/release/bioc/vignettes/DESeq/inst/doc/DESeq.pdf). Hierarchical clustering used Pearson Correlation distance plus single linkage. The variance stabilized expression values were visualized with heatmap.2 (gplots package, cran.r-project.org/web/packages/gplots/index.html).
[0314] Identification of genes and pathways: Differentially expressed genes were identified using edgeR package75 version 3.6. The Benjamini & Hochberg76 procedure was used for controlling false discovery rate (FDR) of the multiple tests and accepted as significant a q-value<0.01. Enrichment analysis was performed using PathwayGuide (Advaita Corporation www.advaitabio.com/)20 against KEGG77 and Reactome78 and GSEA19 against MSigDB canonical pathways from the curated gene sets v4.019.
[0315] Identification of biomarkers: Candidate biomarkers were filtered according to the Max Plank Unified Proteome (1542 proteins assessed Mar. 20, 2014), Secreted ProteinDB79, or by prediction (signal peptide and without a transmembrane domainaccording to Ensemb180,81. The proteins that were exclusive to condition were identified, demonstrated 2-fold changed compared to control and were expressed with an FPKM>1.
[0316] Real-time PCR analysis: Total RNA was isolated and first-strand cDNA was synthesized with Superscript III (Invitrogen). Real-time PCR was performed using LightCycler96 (Roche) with a SYBR green Supermix reagent (Bio-Rad) and specific primers (Supplementary Table x). -actin was quantified as an internal control. Ct was used to calculate fold amplification of transcripts.
[0317] Western Blot: Urine (8.34) was loaded on 4-15% SDS-polyacrylamide-gel (Bio-Rad Laboratories), blotted using nitrocellulose (GE Healthcare, Pittsburgh, Pa.) and proteins detected using anti-human antibodies: polyclonal human CHI3L1 (1:1000; AF2599; R&D Systems), polyclonal human TROP2 (1:1000; AF650; R&D Systems), monoclonal human TPA (PLAT) (1:1000; ab157469; Abcam), monoclonal human KRT20 (1:1000; ab118574; Abcam), polyclonal human PAPPA2 (1:1000; AF1668; R&D Systems), monoclonal human NGAL (1:1,000; BPD-HYB-211-01-02; Enzo Lifesciences), monoclonal human VITDBP (1:1000; MAB3778; R&D), polyclonal human IGFBP7 (1:1000; AF1334; R&D Systems), polyclonal human TIMP2 (1:1000; AF971; R&D Systems).
[0318] Probe synthesis for in situ hybridization: Mouse kidney mRNA was reverse transcribed using SuperScript III First-Strand Synthesis SuperMix for qRT-PCR (Invitrogen), and target genes were amplified using the following primers: Timp2, Forward: 5-gatcagagccaaagcagtgag-3 and T7 embedded Reverse: 5-ggattaccTAATACGACTCACTATAGGGttctctgtgacccagtccatc-3; IGFBP7, Forward: 5-ctctcctcttcctcctcttcg-3 and T7 embedded Reverse: 5-ggattaccTAATACGACTCACTATAGGG tgacctcacagctcaagaaca-3; Ngal, Forward: 5-aaaaacagaaggcagctttacg-3 and T7 embedded Reverse: 5-ggattaccTAATACGACTCACTATAGGGaaagatggagtggcagacaga-3; Pappa2, Forward: 5-CAGAGGGAGGACAGAGCAA-3 and T7 embedded Reverse: 5-GGCCAGTGAATTGTAATACGACTCACTATAGGGAGGCGG GTAAAGGTGACAGAATCTCAGG-3; STC1, Forward: 5-TGCTCCAAAACTCAGCAGTG-3, T7 embedded Reverse: 5-GGCCAGTGAATTGTAATACGACTCACTATAGGGAGGCGG CGCCTCCTATTGAAGTCAGC-3; Trop2, Forward: 5-GCAATGGGCTCACAGGTATT-3, and T7-embedded Reverse: 5-GGCCAGTGAATTGTAATACGACTCACTATAGGGAGGCGG TTTGTATTTGCCCGACTTCC-3. The PCR products were used as templates for in vitro transcription. Probes were synthesized by T7 RNA polymerase (Roche) and Digoxigenin (DIG)-labeled RNAs were subsequently purified by PureLink RNA Mini Kit (Life tech).
[0319] In situ hybridization for frozen sections: Kidneys fixed in 4% PFA, were sectioned (8 m), air-dried for 1-3 hours, then refixed in 4% PFA for 10 minutes and treated with proteinase K (1 g/ml), acetylated and prehybridized and hybridizations at 68-72 C. overnight in 50% formamide, 5SSC, 5Denhardts, 250 g/ml baker's yeast RNA (Sigma), 500 g/ml herring sperm DNA(Sigma). Washes were at 72 C. in 5SSC for 5-10 minutes, then at 72 C. in 0.2SSC for 1 hour. Sections were stained overnight with anti-digoxigenin antibody (Boehringer-Mannheim, 1:5000 dilution) and alkaline phosphatase activity detected with BCIP, NBT (Boehringer-Mannheim) and 0.25 mg/ml levamisole. Sections were dehydrated and mounted in Permount (Fisher Scientific).
References for Example 2
[0320] 1. Laverty G, Skadhauge E. Adaptive strategies for post-renal handling of urine in birds. Comp Biochem Physiol A Mol Integr Physiol. 2008; 149(3):246-254. doi:10.1016/j.cbpa.2008.01.014. [0321] 2. Van Sant M J, Oufiero C E, Muoz-Garcia A, Hammond K A, Williams J B. A phylogenetic approach to total evaporative water loss in mammals. Physiol Biochem Zool. 2012; 85(5):526-532. doi:10.1086/667579. [0322] 3. SMITH H W. The fate of sodium and water in the renal tubules. Bull N Y Acad Med. 1959; 35(5):293-316. http://www.pubmedcentral.nih.gov/articlerender.fcgi?artid=1806157&tool=pmcentrez&renderty pe=abstract. Accessed May 5, 2016. [0323] 4. Brenner B M, Berliner R W. Relationship between extracellular volume and fluid reabsorption by the rat nephron. Am J Physiol. 1969; 217(1):6-12. http://www.ncbi.nlm.nih.gov/pubmed/5785902. Accessed May 6, 2016. [0324] 5. Skorecki K L, Brenner B M. Body fluid homeostasis in man. A contemporary overview. Am J Med. 1981; 70(1):77-88. http://www.ncbi.nlm.nih.gov/pubmed/7006395. Accessed May 5, 2016. [0325] 6. Feinstein E I, Quion-Verde H, Kaptein E M, Massry S G. Severe hyperuricemia in patients with volume depletion. Am J Nephrol. 1984; 4(2):77-80. http://www.ncbi.nlm.nih.gov/pubmed/6720757. Accessed May 5, 2016. [0326] 7. Uchino S, Bellomo R, Bagshaw S M, Goldsmith D. Transient azotaemia is associated with a high risk of death in hospitalized patients. Nephrol Dial Transplant. 2010; 25(6):1833-1839. doi:10.1093/ndt/gfp624. [0327] 8. Parikh C R, Coca S G. Acute kidney injury: defining prerenal azotemia in clinical practice and research. Nat Rev Nephrol. 2010; 6(11):641-642. doi:10.1038/nrneph.2010.128. [0328] 9. Kidney Disease: Improving Global Outcomes (KDIGO) Acute Kidney Injury Work Group. KDIGO Clinical Practice Guideline for Acute Kidney Injury. Kidney Int Suppl. 2012; 2:1-138. [0329] 10. Macedo E, Bouchard J, Soroko S H, et al. Fluid accumulation, recognition and staging of acute kidney injury in critically-ill patients. Crit Care. 2010; 14(3):R82. doi:10.1186/cc9004. [0330] 11. Arany I, Megyesi J K, Reusch J E B, Safirstein R L. CREB mediates ERK-induced survival of mouse renal tubular cells after oxidant stress. Kidney Int. 2005; 68(4):1573-1582. doi:10.1111/j.1523-1755.2005.00569.x. [0331] 12. di Mari J F, Davis R, Safirstein R L. MAPK activation determines renal epithelial cell survival during oxidative injury. Am J Physiol. 1999; 277(2 Pt 2):F195-F203. http://www.ncbi.nlm.nih.gov/pubmed/10444573. Accessed May 6, 2016. [0332] 13. Goldfarb M, Abassi Z, Rosen S, Shina A, Brezis M, Heyman S N. Compensated heart failure predisposes to outer medullary tubular injury: studies in rats. Kidney Int. 2001; 60(2):607-613. doi:10.1046/j.1523-1755.2001.060002607.x. [0333] 14. Gob G, Willgoss D, Hogg N, Schoch E, Endre Z. Cell survival or death in renal tubular epithelium after ischemia-reperfusion injury. Kidney Int. 1999; 56(4):1299-1304. doi:10.1046/j.1523-1755.1999.00701.x. [0334] 15. Bonventre J V. Dedifferentiation and proliferation of surviving epithelial cells in acute renal failure. J Am Soc Nephrol. 2003; 14 Suppl 1:S55-S61. http://www.ncbi.nlm.nih.gov/pubmed/12761240. Accessed Mar. 24, 2016. [0335] 16. Moretti C, Frajese G V, Guccione L, et al. Androgens and body composition in the aging male. J Endocrinol Invest. 2005; 28(3 Suppl):56-64. http://www.ncbi.nlm.nih.gov/pubmed/16042362. Accessed May 6, 2016. [0336] 17. Kimmel P L, Lew S Q, Bosch J P. Nutrition, ageing and GFR: is age-associated decline inevitable? Nephrol Dial Transplant. 1996; 11 Suppl 9:85-88. http://www.ncbi.nlm.nih.gov/pubmed/9050040. Accessed May 6, 2016. [0337] 18. Musso C G, Michelngelo H, Vilas M, et al. Creatinine reabsorption by the aged kidney. Int Urol Nephrol. 2009; 41(3):727-731. doi:10.1007/s11255-008-9508-7. [0338] 19. Sjstrm P A, Odlind B G, Wolgast M. Extensive tubular secretion and reabsorption of creatinine in humans. Scand J Urol Nephrol. 1988; 22(2):129-131. http://www.ncbi.nlm.nih.gov/pubmed/3206217. Accessed May 6, 2016. [0339] 20. Gault M H, Cockcroft D W. Letter: Creatinine clearance and age. Lancet (London, England). 1975; 2(7935):612-613. http://www.ncbi.nlm.nih.gov/pubmed/51444. Accessed May 6, 2016. [0340] 21. Cockcroft D W, Gault M H. Prediction of creatinine clearance from serum creatinine. Nephron. 1976; 16(1):31-41. http://www.ncbi.nlm.nih.gov/pubmed/1244564. Accessed Feb. 26, 2015. [0341] 22. Inker L A, Schmid C H, Tighiouart H, et al. Estimating glomerular filtration rate from serum creatinine and cystatin C. N Engl J Med. 2012; 367(1):20-29. doi:10.1056/NEJMoa1114248. [0342] 23. Schaeffner E S, Ebert N, Delanaye P, et al. Two novel equations to estimate kidney function in persons aged 70 years or older. Ann Intern Med. 2012; 157(7):471-481. doi:10.7326/0003-4819-157-7-201210020-00003. [0343] 24. Sutherland S M, Byrnes J J, Kothari M, et al. AKI in hospitalized children: comparing the pRIFLE, AKIN, and KDIGO definitions. Clin J Am Soc Nephrol. 2015; 10(4):554-561. doi:10.2215/CJN.01900214. [0344] 25. Sharma A, Mucino M J, Ronco C. Renal functional reserve and renal recovery after acute kidney injury. Nephron Clin Pract. 2014; 127(1-4):94-100. doi:10.1159/000363721. [0345] 26. Sise M E, Forster C, Singer E, et al. Urine neutrophil gelatinase-associated lipocalin identifies unilateral and bilateral urinary tract obstruction. Nephrol Dial Transplant. 2011; 26(12):4132-4135. doi:10.1093/ndt/gfr569. [0346] 27. Ramcharan T, Matas A J. Long-term (20-37 years) follow-up of living kidney donors. Am J Transplant. 2002; 2(10):959-964. http://www.ncbi.nlm.nih.gov/pubmed/12482149. Accessed May 6, 2016. [0347] 28. Haase M, Kellum J A, Ronco C. Subclinical AKIan emerging syndrome with important consequences. Nat Rev Nephrol. 2012; 8(12):735-739. doi:10.1038/nrneph.2012.197. [0348] 29. Garner A E, Lewington A J P, Barth J H. Detection of patients with acute kidney injury by the clinical laboratory using rises in serum creatinine: comparison of proposed definitions and a laboratory delta check. Ann Clin Biochem. 2012; 49(Pt 1):59-62. doi:10.1258/acb.2011.011125. [0349] 30. Lin J, Fernandez H, Shashaty M G S, et al. False-Positive Rate of AKI Using Consensus Creatinine-Based Criteria. Clin J Am Soc Nephrol. 2015; 10(10):1723-1731. doi:10.2215/CJN.02430315. [0350] 31. Labban B, Arora N, Restaino S, Markowitz G, Valeri A, Radhakrishnan J. The role of kidney biopsy in heart transplant candidates with kidney disease. Transplantation. 2010; 89(7):887-893. doi:10.1097/TP.0b013e3181cd4abb. [0351] 32. Bergler-Klein J, Pinch C, Laufer G, et al. The long-term effect of simultaneous heart and kidney transplantation on native renal function. Transplantation. 2001; 71(11):1597-1600. http://www.ncbi.nlm.nih.gov/pubmed/11435971. Accessed May 6, 2016. [0352] 33. Paragas N, Qiu A, Zhang Q, et al. The Ngal reporter mouse detects the response of the kidney to injury in real time. Nat Med. 2011; 17(2):216-222. doi:10.1038/nm.2290. [0353] 34. Heyman S N, Evans R G, Rosen S, Rosenberger C. Cellular adaptive changes in AKI: mitigating renal hypoxic injury. Nephrol Dial Transplant. 2012; 27(5):1721-1728. doi:10.1093/ndt/gfs100. [0354] 35. Igarashi P. Kidney-specific gene targeting. J Am Soc Nephrol. 2004; 15(8):2237-2239. doi:10.1097/01.ASN.0000136298.09488.D7. [0355] 36. Dworniczak B, Skryabin B, Tchinda J, et al. Inducible Cre/loxP recombination in the mouse proximal tubule. Nephron Exp Nephrol. 2007; 106(1):e11-e20. doi:10.1159/000100554. [0356] 37. Mather A, Pollock C. Glucose handling by the kidney. Kidney Int Suppl. 2011; 79(120):S1-S6. doi:10.1038/ki.2010.509. [0357] 38. Brire N, Martel M, Plante G, Petitclerc C. Heterogeneous distribution of alkaline phosphatase and gamma-glutamyl transpeptidase in the mouse nephron. Acta Histochem. 1984; 74(1):103-108. http://www.ncbi.nlm.nih.gov/pubmed/6145277. Accessed May 6, 2016. [0358] 39. Yuen P S T, Jo S-K, Holly M K, Hu X, Star R A. Ischemic and nephrotoxic acute renal failure are distinguished by their broad transcriptomic responses. Physiol Genomics. 2006; 25(3):375-386. doi: 10.1152/physiolgenomics. 00223.2005. [0359] 40. Subramanian A, Tamayo P, Mootha V K, et al. Gene set enrichment analysis: a knowledge-based approach for interpreting genome-wide expression profiles. Proc Natl Acad Sci USA. 2005; 102(43):15545-15550. doi:10.1073/pnas.0506580102. [0360] 41. Tarca A L, Draghici S, Khatri P, et al. A novel signaling pathway impact analysis. Bioinformatics. 2009; 25(1):75-82. doi:10.1093/bioinformatics/btn577. [0361] 42. Beck F-X, Neuhofer W. Response of renal medullary cells to osmotic stress. Contrib Nephrol. 2005; 148:21-34. doi:10.1159/000086041. [0362] 43. Vanmassenhove J, Vanholder R, Nagler E, Van Biesen W. Urinary and serum biomarkers for the diagnosis of acute kidney injury: an in-depth review of the literature. Nephrol Dial Transplant. 2013; 28(2):254-273. doi:10.1093/ndt/gfs380. [0363] 44. Gauer S, Sichler O, Obermller N, et al. IL-18 is expressed in the intercalated cell of human kidney. Kidney Int. 2007; 72(9):1081-1087. doi:10.1038/sj.ki.5002473. [0364] 45. Mar D, Gharib S A, Zager R A, Johnson A, Denisenko O, Bomsztyk K. Heterogeneity of epigenetic changes at ischemia/reperfusion- and endotoxin-induced acute kidney injury genes. Kidney Int. 2015; 88(4):734-744. doi:10.1038/ki.2015.164. [0365] 46. Dennen P, Altmann C, Kaufman J, et al. Urine interleukin-6 is an early biomarker of acute kidney injury in children undergoing cardiac surgery. Crit Care. 2010; 14(5):R181. doi:10.1186/cc9289. [0366] 47. Lee C-T, Chen H-C, Lai L-W, Yong K-C, Lien Y-H H. Effects of furosemide on renal calcium handling. Am J Physiol Renal Physiol. 2007; 293(4):F1231-F1237. doi:10.1152/ajprenal.00038.2007. [0367] 48. Nickolas T L, Schmidt-Ott K M, Canetta P, et al. Diagnostic and prognostic stratification in the emergency department using urinary biomarkers of nephron damage: a multicenter prospective cohort study. J Am Coll Cardiol. 2012; 59(3):246-255. doi:10.1016/j.jacc.2011.10.854. [0368] 49. Nickolas T L, O'Rourke M J, Yang J, et al. Sensitivity and specificity of a single emergency department measurement of urinary neutrophil gelatinase-associated lipocalin for diagnosing acute kidney injury. Ann Intern Med. 2008; 148(11):810-819. doi:148/11/810 [pii]. [0369] 50. Vicente-Vicente L, Ferreira L, Gonzlez-Buitrago J M, Lpez-Hernndez F J, Lpez-Novoa J M, Morales A I. Increased urinary excretion of albumin, hemopexin, transferrin and VDBP correlates with chronic sensitization to gentamicin nephrotoxicity in rats. Toxicology. 2013; 304:83-91. doi:10.1016/j.tox.2012.12.006. [0370] 51. Banay-Schwartz M, Bracco F, Dahl D, Deguzman T, Turk V, Lajtha A. The pH dependence of breakdown of various purified brain proteins by cathepsin D preparations. Neurochem Int. 1985; 7(4):607-614. http://www.ncbi.nlm.nih.gov/pubmed/20492966. Accessed May 12, 2016. [0371] 52. Aregger F, Uehlinger D E, Witowski J, et al. Identification of IGFBP-7 by urinary proteomics as a novel prognostic marker in early acute kidney injury. Kidney Int. 2014; 85(4):909-919. doi:10.1038/ki.2013.363. [0372] 53. Svara T, Pogacnik M, Juntes P. Distribution and amount of cathepsin B in gentamicin-induced acute kidney injury in rats. Pol J Vet Sci. 2010; 13(1):75-82. http://www.ncbi.nlm.nih.gov/pubmed/21077434. Accessed May 10, 2016. [0373] 54. Bagshaw S M, Uchino S, Bellomo R, et al. Septic acute kidney injury in critically ill patients: clinical characteristics and outcomes. Clin J Am Soc Nephrol. 2007; 2(3):431-439. doi:10.2215/CJN.03681106. [0374] 55. Bengatta S, Arnould C, Letavernier E, et al. MMP9 and SCF protect from apoptosis in acute kidney injury. J Am Soc Nephrol. 2009; 20(4):787-797. doi:10.1681/ASN.2008050515. [0375] 56. Basu R K, Wang Y, Wong H R, Chawla L S, Wheeler D S, Goldstein S L. Incorporation of biomarkers with the renal angina index for prediction of severe AKI in critically ill children. Clin J Am Soc Nephrol. 2014; 9(4):654-662. doi: 10.2215/CJN.09720913. [0376] 57. Nejat M, Pickering J W, Devarajan P, et al. Some biomarkers of acute kidney injury are increased in pre-renal acute injury. Kidney Int. 2012; 81(12):1254-1262. doi:10.1038/ki.2012.23. [0377] 58. Zager R A. Alterations of intravascular volume: influence on renal susceptibility to ischemic injury. J Lab Clin Med. 1986; 108(1):60-69. http://www.ncbi.nlm.nih.gov/pubmed/3711726. Accessed May 12, 2016. [0378] 59. Hood B, Attman P O, Ahlmn J, Jagenburg R. Renal hemodynamics and limitations of creatinine clearance in determining filtration rate in glomerular disease. Scand J Urol Nephrol. 1971; 5(2):154-161. doi:10.3109/00365597109133594. [0379] 60. Murray P T, Mehta R L, Shaw A, et al. Potential use of biomarkers in acute kidney injury: report and summary of recommendations from the 10th Acute Dialysis Quality Initiative consensus conference. Kidney Int. 2014; 85(3):513-521. doi:10.1038/ki.2013.374. [0380] 61. Parravicini E, Nemerofsky S L, Michelson K A, et al. Urinary neutrophil gelatinase-associated lipocalin is a promising biomarker for late onset culture-positive sepsis in very low birth weight infants. Pediatr Res. 2010; 67(6):636-640. doi:10.1203/PDR.0b013e3181da75c1. [0381] 62. Haase-Fielitz A, Haase M, Devarajan P. Neutrophil gelatinase-associated lipocalin as a biomarker of acute kidney injury: a critical evaluation of current status. Ann Clin Biochem. 2014; 51(Pt 3):335-351. doi:10.1177/0004563214521795. [0382] 63. Basu R K, Wong H R, Krawczeski C D, et al. Combining functional and tubular damage biomarkers improves diagnostic precision for acute kidney injury after cardiac surgery. J Am Coll Cardiol. 2014; 64(25):2753-2762. doi:10.1016/j.jacc.2014.09.066. [0383] 64. Gay L, Miller M R, Ventura P B, et al. Mouse TU tagging: a chemical/genetic intersectional method for purifying cell type-specific nascent RNA. Genes Dev. 2013; 27(1):98-115. doi:10.1101/gad.205278.112. [0384] 65. Humphreys B D, Valerius M T, Kobayashi A, et al. Intrinsic epithelial cells repair the kidney after injury. Cell Stem Cell. 2008; 2(3):284-291. doi:10.1016/j.stem.2008.01.014. [0385] 66. Cowley A W, Yang C, Kumar V, et al. Pappa2 is linked to salt-sensitive hypertension in Dahl S rats. Physiol Genomics. 2016; 48(1):62-72. doi:10.1152/physiolgenomics.00097.2015. [0386] 67. Christians J K, Bath A K, Amiri N. Pappa2 deletion alters IGFBPs but has little effect on glucose disposal or adiposity. Growth Horm IGF Res. 2015; 25(5):232-239. doi:10.1016/j.ghir.2015.07.001. [0387] 68. Yan X, Baxter R C, Firth S M. Involvement of pregnancy-associated plasma protein-A2 in insulin-like growth factor (IGF) binding protein-5 proteolysis during pregnancy: a potential mechanism for increasing IGF bioavailability. J Clin Endocrinol Metab. 2010; 95(3):1412-1420. doi:10.1210/jc.2009-2277. [0388] 69. Ghane Shahrbaf F, Assadi F. Drug-induced renal disorders. J Ren Inj Prev. 2015; 4(3):57-60. doi:10.12861/jrip.2015.12. [0389] 70. Goldfarb S, McCullough P A, McDermott J, Gay S B. Contrast-induced acute kidney injury: specialty-specific protocols for interventional radiology, diagnostic computed tomography radiology, and interventional cardiology. Mayo Clin Proc. 2009; 84(2):170-179. doi: 10.1016/S0025-6196(11)60825-2. [0390] 71. Perazella M A. Onco-nephrology: renal toxicities of chemotherapeutic agents. Clin J Am Soc Nephrol. 2012; 7(10):1713-1721. doi:10.2215/CJN.02780312. [0391] 72. Trapnell C, Pachter L, Salzberg S L. TopHat: discovering splice junctions with RNA-Seq. Bioinformatics. 2009; 25(9):1105-1111. doi:10.1093/bioinformatics/btp120. [0392] 73. Trapnell C, Williams B A, Pertea G, et al. Transcript assembly and quantification by RNA-Seq reveals unannotated transcripts and isoform switching during cell differentiation. Nat Biotechnol. 2010; 28(5):511-515. doi:10.1038/nbt.1621. [0393] 74. Mortazavi A, Williams B A, McCue K, Schaeffer L, Wold B. Mapping and quantifying mammalian transcriptomes by RNA-Seq. Nat Methods. 2008; 5(7):621-628. doi:10.1038/nmeth.1226. [0394] 75. Robinson T J, Dinan M A, Dewhirst M, Garcia-Blanco M A, Pearson J L. SplicerAV: a tool for mining microarray expression data for changes in RNA processing. BMC Bioinformatics. 2010; 11(1):108. doi:10.1186/1471-2105-11-108. [0395] 76. Benjamini Y, Hochberg Y. Controlling the False Discovery Rate: A Practical and Powerful Approach to Multiple Testing. J R Stat Soc Ser B. 1995; 57(1):289-300. http://www.jstor.org/stable/2346101. [0396] 77. Kanehisa M. KEGG: Kyoto Encyclopedia of Genes and Genomes. Nucleic Acids Res. 2000; 28(1):27-30. doi:10.1093/nar/28.1.27. [0397] 78. Croft D, Mundo A F, Haw R, et al. The Reactome pathway knowledgebase. Nucleic Acids Res. 2014; 42(Database issue):D472-D477. doi:10.1093/nar/gkt1102. [0398] 79. Chen Y, Zhang Y, Yin Y, et al. SPDa web-based secreted protein database. Nucleic Acids Res. 2005; 33(Database issue):D169-D173. doi:10.1093/nar/gki093. [0399] 80. Flicek P, Amode M R, Barrell D, et al. Ensembl 2014. Nucleic Acids Res. 2014; 42(Database issue):D749-D755. doi:10.1093/nar/gkt1196. [0400] 81. Activities at the Universal Protein Resource (UniProt). Nucleic Acids Res. 2014; 42(Database issue):D191-D198. doi:10.1093/nar/gkt1140.
Example 3Novel Kidney Biomarker for Volume Depletion, with Sample Preparation
[0401] As described herein, Pappa2 was identified as a marker of volume depletion. The molecular weight is approximately 250 KDa when studied in volume depletion (vAKI). In ischemic or toxic AKI (iAKI) on the other hand the 250 KDa protein appears to be degraded to 50 KDa-70 KDa (
[0402] To separate these forms for analysis of the two different clinical states of vAKI and iAKI the following protocol was identified:
1. Human urine is reduced with 5% beta-mercatoethanol for 10 min at Room Temperature.
2. The sample is then subjected to filtration in a 300 KDa centrifugal device.
3. The fragment 50 KDa-70 KDa mostly passes through the filtration unit while the full length Pappa2 mostly remains in the retentate.
4. Consequently the retentate is used for assay of vAKI.
Example 4Unique Transcriptional Programs Identify Subtypes of Acute Kidney Injury
[0403] Abstract
[0404] Acute kidney failure was traditionally categorized as prerenal/transient, intrinsic/prolonged (ATN), or postrenal in etiology. However, current metrics rely solely on a rise in serum creatinine (sCr), considered tantamount to Acute Kidney Injury (AKI), without distinguishing its potential etiologies or its biological heterogeneity. While there is no doubt that each form of AKI worsens patient outcomes and raises some biomarkers (1), it has remained an open question how volume related or transient pAKI is related to intrinsic or prolonged iAKI. Given that the biomarker NGAL (Siderocalin) is strictly predictive of iAKI rather than pAKI2-7, the alternative hypothesis is that these entities are biologically independent. To clarify their relationship, transcriptional profiling was performed in mouse models with matched sCr levels using laser capture microscopy. Thousands of genes responding to pAKI and to iAKI were found, but very few responded to both stimuli. In addition, pAKI and iAKI genes were expressed by different regions of the kidney, were members of different signal transduction pathways, were functionally unrelated, and demonstrated distinctive patterns in human urine. Hence, despite similar sCr levels, pAKI and iAKI were biologically unrelated, implying that tests for these genes will refine the definition of acute kidney failure.
[0405] The critical function of the kidney is the preservation of water and electrolytes. These functions are conserved throughout the animal kingdom from planaria to mammals.sup.33,34. When Na.sup.+ and water are scarce (volume depletion), the kidney's excretory responses decrease, causing Na.sup.+, water, and urea retention. When volume depletion is more severe, the serum creatinine, sCr, is also retained. A similar scenario occurs in the setting of non-renal diseases that mimic volume depletion such as severe congestive heart and liver failure, because similar drivers (angiotensin-aldosterone systems) and effectors of volume retention (ENac, Na/KATPase and osmolytes) are activated. Adding further complexity, direct destruction of kidney epithelia by toxic stimuli (e.g. ischemia, sepsis, nephrotoxins) also blocks water, electrolyte, urea, and sCr excretion. Hence, it is not surprising that increases in urea and sCr of any etiology are associated with poor prognoses (Uchino; Chirag), but it remains challenging to prospectively distinguish these subtypes. It also remains unclear whether they induce similar types of damage to the nephron.
[0406] The duration of elevated sCr can also be quite variable. Using a series of algorithms to study 68,000 patients at the NY Presbyterian Hospital, it was found that transient azotemia (often due to volume sensitive AKI) is more common than prolonged azotemia. Transient azotemia was associated with lower rates of hyperkalemia, hyponatremia and acidosis, nephrology consult and renal replacement therapy, suggesting limited nephron dysfunction. Yet it remains unclear whether the duration of azotemia reflects different types of tubular damage.
[0407] It may be the case that elevated sCr of any etiology or duration reflects a stereotyped pattern of injured cells, and that pAKI is simply a forme-fruste of iAKI rather than an independent entity (KDIGO).sup.33. Kidney biomarkers however, may begin to distinguish these subtypes (Murray and Mehta). For example, numerous studies show that NGAL is an iAKI biomarker.sup.3,4,8 but it is poorly responsive to transient increases in sCr (48 hrs), or to volume deficits in patients (4).sup.36 or animal models).sup.2,4. Consequently, elevated NGAL predicted poor patient outcomes, including renal replacement therapy and in-hospital mortality.sup.3,11 typical of iAKI, whereas low levels of NGAL was more likely associated with transient pAKI. These data implied that different AKI stimuli regulate different genetic responses.
[0408] Additional biomarkers including Timp2 and IGFBP7 were examined in 168 general surgical patients. Immunoblots were used to identify the canonical gene products among the different molecular forms, but while NGAL correlated with sustained elevations of sCr, Timp2 and IGFBP7 could not be significantly associated with either sustained or transient elevations of sCr (
[0409] First, ischemic iAKI mice maintained weight (17.81.2 g vs 15.21.1 g; NS) and a normal BUN/Cr ratio, whereas volume depleted mice lost 21% weight (18.50.2 g vs 14.60.5 g; p<0.001), and were azotemic, hypernatremic and hemoconcentrated. Second, iAKI kidneys demonstrated coagulative necrosis at the outer edge of the OSOM, a region sensitive to ischemic damage, whereas pAKI kidneys lacked any evidence of cellular abnormalities (
[0410] Ischemic injury was the dominant agglomerative factor in Cortex, OSOM, and ISOM, whereas pAKI genes aggregated with the control set (
[0411] The distinction between iAKI and pAKI was confirmed by comparison with published biomarkers.sup.20 (Table 1). Whereas genes with glomerular expression, Timp2, Igfbp7, Vegf, and 2M were surprisingly down-regulated by ischemia (Table 1, right), as confirmed by in situ hybridization and by urinary blots (
[0412] The specificity of iAKI biomarkers raised the possibility of pAKI specific biomarkers. 103 novel pAKI DEGs were predominately associated with ISOM (Tables 4B) including Tuba4a, Stc1, Impa1, Ip6k2, Ddit4l Pappa2, Enpp2, Hpd. A model using furosemide reproducibly elevated the same pAKI genes, but not any iAKI genes. Consistent with the clinical characteristics of pAKI, refeeding and rehydration rapidly reverted pAKI genes, the sCr, and the sNa to baseline (n=5; p<0.05;
[0413] To examine whether iAKI and pAKI genes were relevant to diverse clinical presentations, the general surgery cohort as well as our extensive urinary studies in Emergency Departments and screened genes (upregulated >2-fold; p-value <10.sup.5) that were also referenced in the Secreted Protein Database or in the Max Plank Unified Proteome were used. 108 iAKI (Table 5A) and 10 pAKI (Table 5B) secreted proteins were identified. For example, iAKI candidates NGAL and CHI3L1 and TROP2 (Tacstd2) were prominently expressed by mouse iAKI kidneys (
[0414] sCr currently defines kidney injury (RIFL, AKIN, KDIGO scales).sup.21,22. Yet, while tubular damage was obvious in iAKI, pAKI kidneys failed to show any evidence of injury at the same level of sCr and despite the prolonged course of our pAKI model. These findings are consistent with well known mismatches between sCr and renal pathology.sup.33,34,35 including data that partial obstruction.sup.33 or even kidney donation.sup.33 may produce modest changes in Scr.sup.41 (subclinical AKI.sup.42).
[0415] iAKI activated inflammatory and proliferation genes compatible with the repopulation of denuded cells.sup.12 in the OSOM (1,158 novel and known iAKI genes), whereas pAKI activated metabolic and osmotic regulatory pathways, consistent with food and water scarcity in the ISOM. The specific responses of different cell types is consistent with a myriad of studies including in situ hybridization, reporter gene constructs, RNA-seq analysis, and urine measurements in mice and humans (confirmed in this paper).sup.2-7 as well as in rats, pigs, dogs demonstrating that NGAL was induced strictly in the ischemic domain (ie after ligation of a polar artery), by specialized intercalated and TALH cells. Hence, different environmental signals are sensed by different cells of the nephron and these cells express specific genetic programs relevant to the stimulus.
[0416] It is possible that the iAKI and pAKI models converge at a different time point or after increasing severity of pAKI. Nonetheless, it could be argued that the pAKI mice already manifest severe volume derangements already over many days. Moreover, even if further manipulation of the pAKI model were possible, sCr will no longer be matched. It is also possible that other models of pAKI (i.e. bleeding, severe heart failure) might better overlap iAKI, yet this remains to be tested especially since our two models (diuretics) induced the same volume sensitive genes.
[0417] The distinct patterning of pAKI and iAKI genes has a number of applications including a new class of kidney biomarkers responsive to reversible volume stresses. The pAKI and iAKI genes can be tested in new bioassays for example in simple ratios of iAKI/pAKI genes (e.g. the data herein shows that sCr.sup.+ and the NGAL.sup./Pappa2.sup.+ ratio rules out iAKI and indicates pAKI, whereas sCr.sup.+ and NGAL.sup.+/Pappa2.sup. ratio indicates iAKI). Secondly, the data herein explains the dissociation between sCr and condition specific biomarkers. For example, the elevation of sCr by volume depletion should not be compared with an iAKI biomarker, which is not even expressed in this setting. This indiscriminate matching of different stimuli with different transcriptomes (that are molecularly and spatially distinct) inappropriately limits interpretation of these analytes. Finally, since the pAKI genes rapidly reversed with volume resuscitation, these proteins may serve as reporters to avoid fluid intoxication. In sum, the clinical, pathological, and transcriptional data provides biological evidence for new tools in the precision diagnosis in acute kidney disease.
[0418] Concise Methods
[0419] Clinical Samples. Emergency Room urine samples were selected at random from our multicenter prospective cohort study.sup.43, using published criteria for iAKI, pAKI and control. Patients with documented urinary tract infections and chronic kidney disease were excluded. Standard blood chemistries were collected each day for 7 days post admission. General Surgical urine samples were collected within 2-3 hours following the procedures for abdominal surgery (Whipple procedure, exploratory laparotomy, colectomy or gastric bypass surgery) or orthopedic surgery (total knee or total hip replacement and open reduction and internal fixation of hip fractures) using our published criteria for iAKI, pAKI and control. Standard blood chemistries were collected each day for 7 days post admission. Patients with evidence of UTI or chronic kidney disease were excluded.
[0420] Mouse husbandry Female wild-type C57B1/6 mice, aged 10-12 weeks (Jackson Labs, Bar harbor, ME) were used according to approved protocols.
[0421] Renal ischemia reperfusion injury model Mice were anesthetized with isoflurane and placed on a warming table to maintain a rectal temperature of 37 C. Left and right renal pedicles were clamped using microvascular clamps (Fine Science Tools, Foster City, Calif.) for 10 minutes. After the clamps were removed, reperfusion of the kidneys was visually confirmed. The kidneys and blood were harvested at 24 hrs.
[0422] Renal volume depletion model. Water was withheld from mice for 72 hours. Body weight and food intake were measured daily. Food intake was determined by weighing chow pellets and chow spillage. Kidneys were harvested and blood was collected at 72 hrs or mice were rehydrated for an additional 24 hrs.
[0423] Clinical Measurements Serum creatinine, sodium and blood urea nitrogen, were measured using Creatinine and EC8+cartridges read by an i-STAT Handheld (Abbott Point of Care, Princeton, N.J.).
[0424] Laser capture microdissection Kidneys were fixed (4% PFA/0.1M PB at 4 C. overnight), transferred to 30% sucrose/0.1M PB (4 C. overnight), embedded in O.C.T. Compound (Tissue-Tek) and kept in 80 C. until time of sectioning. Sections of 8-10 m (20 m for glomeruli) were collected on nuclease-free glass slides covered with a thin membrane (Zeiss Microscopy, Thornwood, N.Y.), fixed in 70% ethanol for 30 seconds, stained with 1% cresyl violet acetate solution and dehydrated in 70% and 100% ethanol followed by air-drying for 30 minutes. Regions of interest (cortex, inner medulla, outer medulla, or glomerulus) were identified morphologically and 15-20 cross sections (for Cortex, OSOM, ISOM) or 1500 cross sections (glomerulus) were microdissected (PALM MicroBeam, Zeiss Microscopy, Thornwood, N.Y.).
[0425] RNA extraction and RNA sequencing Total RNA was isolated from segment-specific laser captured kidney sections using Ambion RNAqueous Micro Kit (Life Technologies, Carlsbad, Calif.). RNA concentration and integrity for each sample were assessed on RNA 6000 Chips using an Agilent 2100 Bioanalyzer (Agilent Technologies, Santa Clara, Calif.). Poly-A pull-down was used to enrich mRNAs (200 ng-1 ug per sample, sample RIN was above 8.0) and then libraries were prepared using single-end 100 bp reads for each sample with Illumina TruSeq RNA prep kits (Illumina, San Diego, Calif.). Libraries were sequenced using Illumina HiSeq2000 at Columbia Genome Center. Illumina RTA was used to perform base calling whilst CASAVA (version 1.8.2) for converting base call files (.BCL) to FASTQ format and also perform sequence adaptor trimming. Reads were then mapped to the mouse reference genome (mm9) using Tophat.sup.23 (version 2.0.4) allowing 4 mismatches (--read-mismatches=4) and a maximum of 10 multiple hits (--max-multihits=10). The relative expression was calculated using cufflinks.sup.24 (version 2.0.2) with default settings. Gene expression levels were normalized by library size and gene length into FPKMs.sup.25 and log.sub.2 transformed. Transcripts with 0 counts across all samples were removed and mathematical artifacts (e.g. negative infinites) were replaced with NA. Statistical analysis was performed in R version 3.1.0 and additional Bioconductor packages were part of release 2.14. Unsupervised cluster analysis was performed on log 2 transformed FPKM values using Spearman correlation as distance and complete linkage as similarity method. No significant differences were seen in mRNA integrity (RIN Agilent 2100 Bioanalyzer) from different samplings and all samples passed the quality controls on post sequencing analysis.
[0426] Generation of heatmaps Genes that were differentially expressed in iAKI vs. control and pAKI vs. control were included. The expression data shown is the variance stabilized data generated using the DESeq package from Bioconductor according to the DESeq vignette (bioconductor.org/packages/release/bioc/html/DESeq.html, /bioconductor.org/packages/release/bioc/vignettes/DESeq/inst/doc/DESeq.pdf). Hierarchical clustering used Pearson Correlation distance plus single linkage. The variance stabilized expression values were visualized with heatmap.2 (gplots package, cran.r-project.org/web/packages/gplots/index.html).
[0427] Identification of genes and pathways Differentially expressed genes were identified using edgeR package.sup.26 version 3.6. We used Benjamini & Hochberg.sup.27 procedure for controlling false discovery rate (FDR) of the multiple tests and accepted as significant a q-value <0.01. Enrichment analysis was performed using PathwayGuide (Advaita Corporation www.advaitabio.com/).sup.18 against KEGG.sup.28 and Reactome.sup.29 and GSEA.sup.17 against MSigDB canonical pathways from the curated gene sets v4.0.sup.17.
[0428] Identification of biomarkers Candidate biomarkers were filtered according to the Max Plank Unified Proteome, Secreted ProteinDB.sup.30, or by prediction (signal peptide and/or without a transmembrane domainaccording to Ensembl!.sup.31,32.
[0429] Real-time PCR analysis Total RNA was isolated and first-strand cDNA was synthesized with Superscript III (Invitrogen). Real-time PCR was performed using LightCycler96 (Roche) with a SYBR green Supermix reagent (Bio-Rad) and specific primers. -actin was quantified as an internal control. Ct was used to calculate fold amplification of transcripts.
[0430] Western Blot Western blots used polyclonal antibodies. Briefly, Urine (8.34) was loaded on 4-15% SDS-polyacrylamide-gel, blotted using nitrocellulose (GE Healthcare, Pittsburgh, Pa.) and proteins detected using polyclonal antibodies.
[0431] Probe synthesis for in situ hybridization Mouse kidney mRNA was reverse transcribed using SuperScript III First-Strand Synthesis SuperMix for qRT-PCR (Invitrogen), and target genes were amplified using the following primers: Timp2, Forward: 5-gatcagagccaaagcagtgag-3 and T7 embedded Reverse: 5-ggattaccTAATACGACTCACTATAGGGttctctgtgacccagtccatc-3; IGFBP7, Forward: 5-ctctcctcttcctcctcttcg-3 and T7 embedded Reverse: 5-ggattaccTAATACGACTCACTATAGGG tgacctcacagctcaagaaca-3; Ngal, Forward: 5-aaaaacagaaggcagctttacg-3 and T7 embedded Reverse: 5-ggattaccTAATACGACTCACTATAGGGaaagatggagtggcagacaga-3; Pappa2, Forward: 5-CAGAGGGAGGACAGAGCAA-3 and T7 embedded Reverse: 5-GGCCAGTGAATTGTAATACGACTCACTATAGGGAGGCGG GTAAAGGTGACAGAATCTCAGG-3; STC1, Forward: 5-TGCTCCAAAACTCAGCAGTG-3, T7 embedded Reverse: 5-GGCCAGTGAATTGTAATACGACTCACTATAGGGAGGCGG CGCCTCCTATTGAAGTCAGC-3; Trop2, Forward: 5-GCAATGGGCTCACAGGTATT-3, and T7-embedded Reverse: 5-GGCCAGTGAATTGTAATACGACTCACTATAGGGAGGCGG TTTGTATTTGCCCGACTTCC-3. The PCR products were used as templates for in vitro transcription. Probes were synthesized by T7 RNA polymerase (Roche) and Digoxigenin (DIG)-labeled RNAs were subsequently purified by PureLink RNA Mini Kit (Life tech).
[0432] In situ hybridization for frozen sections Kidneys fixed in 4% PFA, were sectioned (8 m), air-dried for 1-3 hours, then refixed in 4% PFA for 10 minutes and treated with proteinase K (1 g/ml), acetylated and prehybridized and hybridizations at 68-72 C. overnight in 50% formamide, 5SSC, 5Denhardts, 250 g/ml baker's yeast RNA (Sigma), 500 g/ml herring sperm DNA(Sigma). Washes were at 72 C. in 5 xSSC for 5-10 minutes, then at 72 C. in 0.2SSC for 1 hour. Sections were stained overnight with anti-digoxigenin antibody (Boehringer-Mannheim, 1:5000 dilution) and alkaline phosphatase activity detected with BCIP, NBT (Boehringer-Mannheim) and 0.25 mg/ml levamisole. Sections were dehydrated and mounted in Permount (Fisher Scientific).
References for Example 4
[0433] 1. Endre Z. [0434] 2. Nickolas T L, O'Rourke M J, Yang J, et al. Sensitivity and Specificity of a Single Emergency Department Measurement of Urinary Neutrophil GelatinaseAssociated Lipocalin for Diagnosing Acute Kidney Injury. Annals of internal medicine. 2008; 148(11):810-819. [0435] 3. Nickolas T L, Schmidt-Ott K M, Canetta P, et al. Diagnostic and Prognostic Stratification in the Emergency Department Using Urinary Biomarkers of Nephron Damage: A Multicenter Prospective Cohort Study. Journal of the American College of Cardiology. 2012; 59(3):246-255. [0436] 4. Paragas N, Qiu A, Zhang Q, et al. The Ngal Reporter Mouse Detects the Response of the Kidney to Injury in Real Time. Nature medicine. Jan. 16, 2011; 17(2):216-222. [0437] 5. Singer E, Elger A, Elitok S, et al. Urinary neutrophil gelatinase-associated lipocalin distinguishes pre-renal from intrinsic renal failure and predicts outcomes. Kidney international. Mar. 16, 2011; 80(4):10.1038/ki.2011.1041. [0438] 6. Belcher J M, Sanyal A J, Peixoto A J, et al. Kidney biomarkers and differential diagnosis of patients with cirrhosis and acute kidney injury. Hepatology. 2014; 60(2):622-632. [0439] 7. Basu R K, Wong H R, Krawczeski C D, et al. Combining Functional and Tubular Damage Biomarkers Improves Diagnostic Precision for Acute Kidney Injury After Cardiac Surgery. Journal of the American College of Cardiology. 2014; 64(25):2753-2762. [0440] 8. Parravicini E, Nemerofsky S L, Michelson K A, et al. Urinary Neutrophil Gelatinase-Associated Lipocalin Is a Promising Biomarker for Late Onset Culture-Positive Sepsis in Very Low Birth Weight Infants. Pediatr Res. 06//print 2010; 67(6):636-640. [0441] 9. Paragas N, Kulkarni R, Werth M, et al. -Intercalated cells defend the urinary system from bacterial infection. The Journal of Clinical Investigation. June 17 July 1/received April 24/accepted 2014; 124(7):2963-2976. [0442] 10. Goetz D H, Holmes M A, Borregaard N, Bluhm M E, Raymond K N, Strong R K. The Neutrophil Lipocalin NGAL Is a Bacteriostatic Agent that Interferes with Siderophore-Mediated Iron Acquisition. Molecular Cell. 11//2002; 10(5):1033-1043. [0443] 11. Haase. 2011. [0444] 12. Humphreys B D, Valerius M T, Kobayashi A, et al. Intrinsic epithelial cells repair the kidney after injury. Cell stem cell. Mar. 6, 2008; 2(3):284-291. [0445] 13. Lee S, Huen S, Nishio H, et al. Distinct macrophage phenotypes contribute to kidney injury and repair. Journal of the American Society of Nephrology: JASN. February 2011; 22(2):317-326. [0446] 14. Igarashi P. Kidney-specific gene targeting. Journal of the American Society of Nephrology: JASN. August 2004; 15(8):2237-2239. [0447] 15. Dworniczak B, Skryabin B, Tchinda J, et al. Inducible Cre/loxP recombination in the mouse proximal tubule. Nephron. Experimental nephrology. 2007; 106(1):e11-20. [0448] 16. Yuen P S, Jo S K, Holly M K, Hu X, Star R A. Ischemic and nephrotoxic acute renal failure are distinguished by their broad transcriptomic responses. Physiological genomics. May 16, 2006; 25(3):375-386. [0449] 17. Subramanian A, Tamayo P, Mootha V K, et al. Gene set enrichment analysis: a knowledge-based approach for interpreting genome-wide expression profiles. Proceedings of the National Academy of Sciences of the United States of America. Oct. 25, 2005; 102(43):15545-15550. [0450] 18. Tarca A L, Draghici S, Khatri P, et al. A novel signaling pathway impact analysis. Bioinformatics (Oxford, England). Jan. 1, 2009; 25(1):75-82. [0451] 19. Beck F X, Neuhofer W. Response of renal medullary cells to osmotic stress. Contributions to nephrology. 2005; 148:21-34. [0452] 20. Vanmassenhove J, Vanholder R, Nagler E, Van Biesen W. Urinary and serum biomarkers for the diagnosis of acute kidney injury: an in-depth review of the literature. Nephrology, dialysis, transplantation: official publication of the European Dialysis and Transplant AssociationEuropean Renal Association. February 2013; 28(2):254-273. [0453] 21. Mehta R L, Kellum J A, Shah S V, et al. Acute Kidney Injury Network: report of an initiative to improve outcomes in acute kidney injury. Critical care (London, England). 2007; 11(2):R31. [0454] 22. Kidney Disease: Improving Global Outcomes (KDIGO) Acute Kidney Injury Work Group. KDIGO Clinical Practice Guideline for Acute Kidney Injury. Kidney International.Suppl. 2012(2):1-138. [0455] 23. Trapnell C, Pachter L, Salzberg S L. TopHat: discovering splice junctions with RNA-Seq. Bioinformatics (Oxford, England). May 1, 2009; 25(9):1105-1111. [0456] 24. Trapnell C, Williams B A, Pertea G, et al. Transcript assembly and quantification by RNA-Seq reveals unannotated transcripts and isoform switching during cell differentiation. Nature biotechnology. May 2010; 28(5):511-515. [0457] 25. Mortazavi A, Williams B A, McCue K, Schaeffer L, Wold B. Mapping and quantifying mammalian transcriptomes by RNA-Seq. Nature methods. July 2008; 5(7):621-628. [0458] 26. Robinson T J, Dinan M A, Dewhirst M, Garcia-Blanco M A, Pearson J L. SplicerAV: a tool for mining microarray expression data for changes in RNA processing. BMC bioinformatics. 2010; 11:108. [0459] 27. Benjamini Y, Hochberg Y. Controlling the False Discovery Rate: A Practical and Powerful Approach to Multiple Testing. Journal of the Royal Statistical Society. Series B (Methodological). 1995; 57(1):289-300. [0460] 28. Kanehisa M, Goto S. KEGG: kyoto encyclopedia of genes and genomes. Nucleic acids research. Jan. 1, 2000; 28(1):27-30. [0461] 29. Croft D, Mundo A F, Haw R, et al. The Reactome pathway knowledgebase. Nucleic acids research. January 2014; 42(Database issue):D472-477. [0462] 30. Chen Y, Zhang Y, Yin Y, et al. SPDa web-based secreted protein database. Nucleic acids research. Jan. 1, 2005; 33(Database issue):D169-173. [0463] 31. Flicek P, Amode M R, Barrell D, et al. Ensembl 2014. Nucleic acids research. January 2014; 42(Database issue):D749-755. [0464] 32. Activities at the Universal Protein Resource (UniProt). Nucleic acids research. January 2014; 42(Database issue):D191-198. [0465] 33. Van Sant M J, Oufiero C E, Muoz-Garcia A, Hammond K A, Williams J B. A phylogenetic approach to total evaporative water loss in mammals. Physiol Biochem Zool. 2012 September-October; 85(5):526-32. doi: 10.1086/667579. Epub 2012 Aug. 6. PubMed PMID: 22902381. [0466] 34. Laverty G, Skadhauge E. Adaptive strategies for post-renal handling of urine in birds. Comp Biochem Physiol A Mol Integr Physiol. 2008 March; 149(3):246-54. doi: 10.1016/j.cbpa.2008.01.014. Epub 2008 Jan. 18. Review. PubMed PMID: 18276178. [0467] 35. Kidney Disease: Improving Global Outcomes (KDIGO) Acute Kidney Injury Work Group. KDIGO Clinical Practice Guideline for Acute Kidney Injury. Kidney inter., Suppl. 2012; 2: 1-138. [0468] 36. Labban B, Arora N, Restaino S, Markowitz G, Valeri A, Radhakrishnan J. The role of kidney biopsy in heart transplant candidates with kidney disease. Transplantation. 2010 Apr. 15; 89(7):887-93. doi: 10.1097/TP.0b013e3181cd4abb. PubMed PMID: 20220572. [0469] 37. Bergler-Klein J, Pinch C, Laufer G, Grimm M, Regele H, Mayer G, Oberbauer R. The long-term effect of simultaneous heart and kidney transplantation on native renal function. Transplantation. 2001 Jun. 15; 71(11):1597-600. PubMed PMID:11435971. [0470] 38. Parikh C R, Coca S G. Acute kidney injury: defining prerenal azotemia in clinical practice and research. Nat Rev Nephrol. 2010 November; 6(11):641-2. doi:10.1038/nrneph.2010.128. PubMed PMID: 20981121. [0471] 39. Sise M E, Forster C, Singer E, Sola-Del Valle D, Hahn B, Schmidt-Ott K M, Barasch J, Nickolas T L. Urine neutrophil gelatinase-associated lipocalin identifies unilateral and bilateral urinary tract obstruction. Nephrol Dial Transplant. 2011 December; 26(12):4132-5. doi: 10.1093/ndt/gfr569. Epub 2011 Nov. 1. PubMed PMID: 22049182; PubMed Central PMCID: PMC3254163. [0472] 40. Ramcharan T, Matas A J. Long-term (20-37 years) follow-up of living kidney donors. Am J Transplant. 2002 November; 2(10):959-64. PubMed PMID: 12482149. [0473] 41. Hood B, Attman P O, Ahlmn J, Jagenburg R. Renal hemodynamics and limitations of creatinine clearance in determining filtration rate in glomerular disease. Scand J Urol Nephrol. 1971; 5(2):154-61. PubMed PMID: 4937335. [0474] 42. Haase M, Kellum J A, Ronco C. Subclinical AKIan emerging syndrome with important consequences. Nat Rev Nephrol. 2012 December; 8(12):735-9. doi: 10.1038/nmeph.2012.197. Epub 2012 Sep. 25. PubMed PMID: 23007617. [0475] 43. Nickolas T L, Schmidt-Ott K M, Canetta P, Forster C, Singer E, Sise M, Elger A, Maarouf O, Sola-Del Valle D A, O'Rourke M, Sherman E, Lee P, Geara A, Imus P, Guddati A, Polland A, Rahman W, Elitok S, Malik N, Giglio J, El-Sayegh S, Devarajan P, Hebbar S, Saggi S J, Hahn B, Kettritz R, Luft F C, Barasch J. Diagnostic and prognostic stratification in the emergency department using urinary biomarkers of nephron damage: a multicenter prospective cohort study. J Am Coll Cardiol. 2012 Jan. 17; 59(3):246-55. doi: 10.1016/j.jacc.2011.10.854. PubMed PMID: 22240130; PubMed Central PMCID: PMC3487165.