TREATMENT STRATEGY FOR NON-RESPONDERS TO 100MG SUBCUTANEOUS MEPOLIZUMAB
20190062421 ยท 2019-02-28
Inventors
Cpc classification
A61K9/0019
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2039/545
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
International classification
Abstract
Disclosed herein are methods of treating severe glucocorticoid-dependent eosinophilic asthma in a subject whose asthma has been inadequately controlled with subcutaneously-administered mepolizumab. Also provided are methods of predicting responsiveness to anti-IL-5 antibody treatment in a subject having severe glucocorticoid-dependent eosinophilic asthma.
Claims
1. A method of treating severe glucocorticoid-dependent eosinophilic asthma in a subject whose asthma has been inadequately controlled with subcutaneously-administered mepolizumab, the method comprising: intravenously administering a therapeutically effective dose of an anti-IL-5 antibody to the subject.
2. The method of claim 1, wherein, prior to the intravenous administering, the subject has a sputum eosinophilia level of greater than 3%.
3. The method of claim 1, wherein, prior to the intravenous administering, the subject's blood eosinophil levels are greater than 300/l.
4. The method of claim 1, wherein, prior to the intravenous administering, the subject received subcutaneously-administered mepolizumab for at least 1 year.
5. The method of claim 4, wherein the subject received 100 mg of subcutaneously-administered mepolizumab every four weeks.
6. The method of claim 1, wherein the intravenously-administered anti-IL-5 antibody is reslizumab or mepolizumab.
7. The method of claim 6, wherein the therapeutically effective dose of reslizumab is at least 3.0 mg/kg every four weeks.
8. The method of claim 6, wherein the therapeutically effective dose of mepolizumab is about 750 mg every four weeks.
9. The method of claim 1, wherein the intravenously-administered anti-IL-5 antibody leads to sputum eosinophilia of less than 3%, a blood eosinophil level of less than 300/l, or both.
10. The method of claim 9, wherein the reduction in blood eosinophils comprises at least about 50% compared to a pretreatment level.
11. The method of claim 1, wherein the intravenously-administered anti-IL-5 antibody leads to a clinically significant improvement in FEV.sub.1, ACQ, or both.
12. The method of claim 11, wherein the improvement in FEV.sub.1 comprises a greater than or equal to about 20% increase compared to a control.
13. The method of claim 11, wherein the improvement in ACQ comprises a greater than or equal to about 50% increase compared to a control.
14. A method of predicting responsiveness to anti-IL-5 antibody treatment in a subject having severe glucocorticoid-dependent eosinophilic asthma comprising: comparing a level of IL-5 present in a pre-anti-IL-5 antibody treatment sputum sample from the subject to a level of IL-5 present in a post-anti-IL-5 antibody treatment sputum sample from the subject, wherein an increased level of IL-5 in the post-anti-IL-5 antibody treatment sputum sample from the subject compared to the pre-anti-IL-5 antibody treatment sputum sample from the subject is predictive of non-responsiveness to the anti-IL-5 antibody treatment.
15. Use of an anti-IL-5 antibody in the manufacture of an intravenously-administered medicament for the treatment of severe glucocorticoid-dependent eosinophilic asthma in a subject whose asthma has been inadequately controlled with subcutaneously-administered mepolizumab.
16. An intravenously-administered anti-IL-5 antibody for use in the treatment of severe glucocorticoid-dependent eosinophilic asthma in a subject whose asthma has been inadequately controlled with subcutaneously-administered mepolizumab.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0010] The summary, as well as the following detailed description, is further understood when read in conjunction with the appended drawings. For the purpose of illustrating the disclosed methods and uses, there are shown in the drawings exemplary embodiments of the methods and uses; however, the methods and uses are not limited to the specific embodiments disclosed. In the drawings:
[0011]
[0012]
[0013]
[0014]
[0015]
DETAILED DESCRIPTION OF ILLUSTRATIVE EMBODIMENTS
[0016] The disclosed methods and uses may be understood more readily by reference to the following detailed description taken in connection with the accompanying figures, which form a part of this disclosure. It is to be understood that the disclosed methods and uses are not limited to the specific methods and uses described and/or shown herein, and that the terminology used herein is for the purpose of describing particular embodiments by way of example only and is not intended to be limiting of the claimed methods and uses.
[0017] Unless specifically stated otherwise, any description as to a possible mechanism or mode of action or reason for improvement is meant to be illustrative only, and the disclosed methods and uses are not to be constrained by the correctness or incorrectness of any such suggested mechanism or mode of action or reason for improvement.
[0018] Where a range of numerical values is recited or established herein, the range includes the endpoints thereof and all the individual integers and fractions within the range, and also includes each of the narrower ranges therein formed by all the various possible combinations of those endpoints and internal integers and fractions to form subgroups of the larger group of values within the stated range to the same extent as if each of those narrower ranges was explicitly recited. Where a range of numerical values is stated herein as being greater than a stated value, the range is nevertheless finite and is bounded on its upper end by a value that is operable within the context of the methods and uses as described herein. Where a range of numerical values is stated herein as being less than a stated value, the range is nevertheless bounded on its lower end by a non-zero value. It is not intended that the scope of the disclosed methods and uses be limited to the specific values recited when defining a range. All ranges are inclusive and combinable.
[0019] When values are expressed as approximations, by use of the antecedent about, it will be understood that the particular value forms another embodiment. Reference to a particular numerical value includes at least that particular value, unless the context clearly dictates otherwise.
[0020] It is to be appreciated that certain features of the disclosed methods and uses which are, for clarity, described herein in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the disclosed methods and uses that are, for brevity, described in the context of a single embodiment, may also be provided separately or in any subcombination.
[0021] As used herein, the singular forms a, an, and the include the plural.
[0022] Various terms relating to aspects of the description are used throughout the specification and claims. Such terms are to be given their ordinary meaning in the art unless otherwise indicated. Other specifically defined terms are to be construed in a manner consistent with the definitions provided herein.
[0023] The term comprising is intended to include examples encompassed by the terms consisting essentially of and consisting of; similarly, the term consisting essentially of is intended to include examples encompassed by the term consisting of.
[0024] As used herein a subject with Severe glucocorticoid-dependent eosinophilic asthma refers to a subject exhibiting airway hyper responsiveness in addition to a level of eosinophils as 3% of total sputum cells measured in a sputum sample and/or blood eosinophils 300/L despite maintenance treatment with systemic glucocorticoids (5 to 30 mg per day of prednisone or its equivalent) as defined in the 2017 Global Initiative for Asthma (GINA) guidelines (www.ginasthma.org).
[0025] Inadequate control of severe glucocorticoid-dependent eosinophilic asthma in a subject refers to the continuing presence of eosinophils as >3% of the total cells in a sputum sample from the subject or ongoing asthma exacerbations following standard inhaled and/or oral glucocorticoid treatment.
[0026] As used herein, treating and like terms refer to a reduction in the severity and/or frequency of asthma symptoms, eliminating asthma symptoms and/or the underlying cause of said symptoms, reducing the frequency or likelihood of asthma symptoms and/or their underlying cause, and improving or remediating damage caused, directly or indirectly, by asthma. In some aspects, successful treating refers to a reduction in sputum eosinophilia to a value of less than 3%, a reduction of blood eosinophils to a value of less than 300/l, or both
[0027] Therapeutically effective dose refers to an amount of an anti-IL-5 antibody, as described herein, effective to treat severe glucocorticoid-dependent eosinophilic asthma. The therapeutically effective dose may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the anti-IL-5 mAb to cause a desired response in a subject.
[0028] As used herein, forced expiratory volume in 1 second (FEV.sub.1) refers to the maximal amount of air that can forcefully be exhaled in one second.
[0029] As used herein, asthma control questionnaire 5 (ACQ-5) refers to a questionnaire used to measure the adequacy of asthma control and change in asthma control which occurs either spontaneously or as a result of treatment.
[0030] As used herein, forced vital capacity (FVC) refers to the volume delivered during an expiration made as forcefully and completely as possible starting from full inspiration.
[0031] Mepolizumab (SB-240563; marketed in the U.S. as NUCALA) is a fully humanized monoclonal antibody (IgG.sub.1, kappa, mAb) which is specific for human interleukin-5 (IL-5).
[0032] Reslizumab (SCH 55700) is a humanized (from rat) divalent monoclonal antibody (mAb) with an IgG4 kappa isotype, with binding affinity for a specific epitope on the human interleukin-5 (IL-5) molecule. Reslizumab is a neutralizing antibody that is believed to block IL-5 dependent cell proliferation and/or eosinophil production. Reslizumab is described in, for example, Walsh, GM (2009) Reslizumab, a humanized anti-IL-5 mAb for the treatment of eosinophil-mediated inflammatory conditions Current opinion in molecular therapeutics 11 (3): 329-36; U.S. Pat. No. 6,056,957 (Chou); U.S. Pat. No. 6,451,982 (Chou); U.S. Pat. No. RE39,548 (Bodmer), each of which is incorporated herein by reference. The sequences of the heavy and light chains of reslizumab are as follows:
TABLE-US-00001 TABLE1 Reslizumabsequences HeavyChain EVQLVESGGGLVQPGGSLRLSCAVSGLSLTSNSVNWIRQAPGKGLEW (SEQID VGLIWSNGDTDYNSAIKSRFTISRDTSKSTVYLQMNSLRAEDTAVYYC NO:1) AREYYGYFDYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALG CLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSS SLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKT KPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTIS KAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEA LHNHYTQKSLSLSLGK LightChain DIQMTQSPSSLSASVGDRVTITCLASEGISSYLAWYQQKPGKAPKLLIY (SEQID GANSLQTGVPSRFSGSGSATDYTLTISSLQPEDFATYYCQQSYKFPNTF NO:2) GQGTKVEVKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVY ACEVTHQGLSSPVTKSFNRGEC
[0033] The following abbreviations are used throughout the disclosure: EoPs (eosinophil progenitor cells); IL-5 (interleukin-5); IV (intravenous); mAb (monoclonal antibodies); SC (subcutaneous); FEV.sub.1 (forced expiratory volume in 1 second); ACQ (asthma control questionnaire).
[0034] Disclosed herein are methods of treating severe glucocorticoid-dependent eosinophilic asthma in a subject whose asthma has been inadequately controlled with subcutaneously-administered mepolizumab. The methods comprise intravenously-administering a therapeutically effective dose of an anti-IL-5 antibody to the subject, wherein prior to the administering, the subject's symptoms are inadequately controlled with systemic glucocorticoid and subcutaneously-administered mepolizumab. Also provided are methods of treating severe glucocorticoid-dependent eosinophilic asthma comprising, to a subject whose asthma has been inadequately controlled with subcutaneously-administered mepolizumab, intravenously-administering a therapeutically effective dose of an anti-IL-5 antibody.
[0035] Subjects having severe glucocorticoid-dependent eosinophilic asthma which is inadequately controlled with systemic glucocorticoid include those subjects exhibiting airway hyperresponsiveness and a sputum eosinophilia level of greater than or equal to 3% (i.e. greater than or equal to 3% of the total cells present in the sputum are eosinophils), a blood eosinophil level greater than or equal to 300/l, or both. In some embodiments, prior to the intravenous administering of the anti-IL-5 antibody, the subject has a sputum eosinophilia level of greater than 3%. In some embodiments, prior to the intravenous administering of the anti-IL-5 antibody, the subject has a blood eosinophil level of greater than 300/l. In some embodiments, prior to the intravenous administering of the anti-IL-5 antibody, the subject has a sputum eosinophilia level of greater than 3% and a blood eosinophil level of greater than 300/l.
[0036] In some aspects of the disclosed methods, prior to the intravenous administering of anti-IL-5 antibody, the subject received subcutaneously-administered mepolizumab for at least 1 year. In some embodiments, the subcutaneously-administered mepolizumab was administered at 100 mg every four weeks.
[0037] Suitable anti-IL-5 antibodies for use in the disclosed methods include reslizumab or mepolizumab or other anti-IL-5 ligand antibodies approved for human use. In some embodiments, the methods comprise intravenously-administering a therapeutically effective dose of reslizumab to the subject, wherein prior to the administering, the subject's symptoms have been inadequately controlled with subcutaneously-administered mepolizumab. The therapeutically effective dose of reslizumab can be at least about 3.0 mg/kg administered every four weeks. In some embodiments, the methods comprise intravenously-administering a therapeutically effective dose of mepolizumab to the subject, wherein prior to the administering, the subject's symptoms have been inadequately controlled with subcutaneously-administered mepolizumab. The therapeutically effective dose of intravenously administered mepolizumab can be about 750 mg every four weeks.
[0038] The intravenously-administered anti-IL-5 antibody may lead to sputum eosinophilia of less than 3%, a blood eosinophil level of less than 300/l, or both. In some embodiments, the intravenously-administered anti-IL-5 antibody leads to sputum eosinophilia of less than 3%. In other words, the intravenously-administered anti-IL-5 antibody can lead to an amount of eosinophils in the sputum of less than 3% of the total cells present in the sputum. In some embodiments, the intravenously-administered anti-IL-5 antibody can lead to a blood eosinophil level of less than 300/l. In some embodiments, the intravenously-administered anti-IL-5 antibody can lead to sputum eosinophilia of less than 3% and a blood eosinophil level of less than 300/l.
[0039] The intravenously-administered anti-IL-5 antibody can lead to a clinically significant improvement in FEV.sub.1, ACQ, or both. A clinically significant improvement in FEV.sub.1 may comprise a greater than or equal to about 20% increase compared to a control. A clinically significant improvement in ACQ may comprise a greater than or equal to about 50% increase compared to a control. The control may be the FEV.sub.1 or ACQ value of the subject at baseline before treatment with subcutaneously administered mepolizumab or at baseline before intravenous treatment with an anti-IL-5 antibody, such as reslizumab.
[0040] Also provided is the use of an anti-IL-5 antibody in the manufacture of an intravenously-administered medicament for the treatment of severe glucocorticoid-dependent eosinophilic asthma in a subject whose asthma has been inadequately controlled with subcutaneously-administered mepolizumab.
[0041] Also provided herein is an intravenously-administered anti-IL-5 antibody for use in the treatment of severe glucocorticoid-dependent eosinophilic asthma in a subject whose asthma has been inadequately controlled with subcutaneously-administered mepolizumab.
[0042] Also provided herein are methods of predicting a subject's responsiveness to anti-IL-5 antibody treatment, wherein the subject has severe glucocorticoid-dependent eosinophilic asthma. The methods comprise comparing a level of IL-5 present in a pre-anti-IL-5 antibody treatment sputum sample from the subject with a level of IL-5 present in a post-anti-IL-5 antibody treatment sputum sample from the subject, wherein an increased level of IL-5 in the post-anti-IL-5 antibody treatment sputum sample from the subject compared to the pre-anti-IL-5 antibody treatment sputum sample from the subject is predictive of non-responsiveness to the anti-IL-5 antibody treatment. In some embodiments, the increased level IL-5 in the post-treatment sputum sample from the subject comprises greater than 100 pg/ml, greater than 110 pg/ml, greater than 120 pg/ml, greater than 130 pg/ml, greater than 140 pg/ml, or greater than 150 pg/ml.
[0043] In some embodiments, the IL-5 present in the pre-anti-IL-5 antibody sputum sample and post-anti-IL-5 antibody sputum sample comprises the total IL-5 level, which includes both free and immunoglobulin-bound IL-5.
[0044] In some embodiments, the methods of predicting the subject's responsiveness to anti-IL-5 antibody treatment further comprises, prior to the comparing, determining a level of IL-5 present in a pre-anti-IL-5 antibody treatment sputum sample from the subject, determining a level of IL-5 present in a post-anti-IL-5 antibody treatment sputum sample from the subject, or both.
EXAMPLES
[0045] The following examples are provided to further describe some of the embodiments disclosed herein. The examples are intended to illustrate, not to limit, the disclosed embodiments.
Methods
[0046] Trial design and patient recruitment: While mepolizumab is approved as a fixed dose of 100 mg SC, reslizumab is approved as a weight-adjusted dose of 3 mg/kg IV. Since mepolizumab was not available for clinical use by IV administration to treat asthma, the cellular and clinical outcomes of patients with severe glucocorticoid-dependent eosinophilic asthma who were treated with mepolizumab 100 mg SC and with reslizumab 3 mg/kg IV (Clinicaltrials.gov NCT02559791) were compared. The study was divided into two treatment phases separated by a wash-out period where the patients were not on any anti-IL-5 monoclonal antibody therapy (
[0047] The baseline demographic characteristics of the ten recruited patients at the start of both interventions (mepolizumab group and reslizumab group) are provided in Table 1. As shown in Table 1, the mean baseline ACQ scores, FEV.sub.1% predicted, sputum and blood eosinophilia, and maintenance prednisone dose was comparable and well-balanced (Wilcoxon ranked test, P>0.05) prior to treatment with mepolizumab and reslizumab. All patients had: (i) evidence of asthma confirmed by bronchodilator reversibility of 12% and 4200 ml after 200-400 g of short-acting beta-2 agonist, and/or methacholine challenge test <8 mg/mL; and (ii) documented history of severe eosinophilia (sputum eosinophils 3% and/or blood eosinophils 300/L) despite maintenance treatment with systemic glucocorticoids (5 to 30 mg per day of prednisone or its equivalent) before entering the study.
TABLE-US-00002 TABLE 2 Patient demographics Mepolizumab Reslizumab Group Group Patient Characteristics (n = 10) (n = 10) P value FEV.sub.1 % predicted 53.7 13.7 47.6 14.8 0.11 VC % predicted 66.3 10.1 65.1 15.9 0.57 FEV.sub.1/VC 57.4 9.3 63 9.7 0.002 ACQ-5 1.52 0.7 2.04 1.4 0.32 Blood eosinophil (10.sup.9/L) 0.349 0.2 0.54 0.2 0.06 Sputum eosinophil (%) 14.9 18 30.43 15 0.07 Prednisone dose mg/daily 15 10 0.11 (median, max-min) (7.5, 30) (5, 25) Inhaled corticosteroid (mcg 1750 1625 0.19 daily) (1000, 2500) (1000, 2400) (median, max-min) Data for the mepolizumab group and reslizumab group are represented as mean SD, unless otherwise stated; inhaled corticosteroid as equivalent of fluticasone propionate; Values are those recorded at the time patients were evaluated for mepolizumab treatment, and start of reslizumab trial. VC (vital capacity), FEV.sub.1 (forced expiratory volume in 1 second), ACQ (asthma control questionnaire).
[0048] Clinical end-points: therapeutic benefits: All end-point measurements were made at baseline (pre-mepolizumab), end of mepolizumab Rx, start of placebo (pre-reslizumab baseline), end of placebo, and end of reslizumab Rx (
[0049] Molecular end-points: assessment of airway inflammation: Eosinophil activity in sputum was assessed by measuring eosinophil peroxidase (EPX) in the cell-free sputum supernatants using an in-house ELISA as described in Nair P., et al. Eosinophil peroxidase in sputum represents a unique biomarker of airway eosinophilia. Allergy 2013; 68: 1177-1184 and Ochkur S. I., et al. A sensitive high throughput ELISA for human eosinophil peroxidase: A specific assay to quantify eosinophil degranulation from patient-derived sources. Journal of Immunological Methods 2012; 384: 10-20. Sputum IL-5 was detected using an ELISA platform (IL-5 Duo-set, R&D Systems) modified for alkaline phosphatase-based colorimetric detection instead of horseradish peroxidase reagents to avoid interference from the endogenous peroxidases in sputum. Since the secondary detection antibodies supplied in the Duo-set were biotinylated, BluePhos Microwell Phosphatase Substrate System (KPL Inc.) was used for color development. IL-5 levels were measured in the immunoprecipitated fraction of the sputum supernatants (as described in Mukherjee M., et al. Airway autoimmune responses in severe eosinophilic asthma following low-dose Mepolizumab therapy. Allergy, Asthma, and Clinical Immunology: Official Journal of the Canadian Society of Allergy and Clinical Immunology 2017; 13: 2) and in the whole supernatant. The total sputum IL-5 levels were presented as a sum of immunoglobulin-bound (Ig-bound) and free IL-5, respectively. As Ig-bound IL-5 can serve as a cytokine depot and increase in vivo potency, Ig-bound IL-5 was included in the total sputum IL-5 levels.
[0050] Statistical Analysis: Statistical analysis was performed using Graphpad Prism version 7.0 (La Jolla, Calif., USA) and SPSS version 23 (Chicago, Ill.). For individual drug effect, the change in the respective outcomes between placebo and drug was assessed by Wilcoxon paired analysis. For assessing significant difference in the measured outcomes between the two treatments, analysis of covariance (ANCOVA) was conducted, adjusting for baseline prednisone use.
[0051] Sputum induction and processing: Sputum was induced and processed using the method described by Pizzichini et al. 1996. Briefly, following inhalation of hypotonic aerosolized saline, cell plugs were collected from the expectorated sputum sample and processed using 0.1% dithiothreitol (SPUTOLYSIN, Calbiochem) and Dulbecco's Phosphate-Buffered Saline (GIBCO). The dispersed sputum was filtered through Accufilter filter units (Cellometrics Inc., Hamilton, ON, Canada). Following centrifugation (1500 rpm, 10 mins), cytospins were prepared from the pelleted cells on glass slides and stained with Diff-Quik (American Scientific Products, McGaw Park, Ill., USA) for differential counts, which were enumerated by an observer blinded to the treatment period. For each cell population, means of duplicate slides were obtained (400 cells counted per slide) and expressed as a percentage of the total cell count.
[0052] Asthma Control Questionnaire 5 score: The ACQ-5 is a five-item self-completed questionnaire that has been developed as a measure of patients' asthma control and can be quickly and easily completed in clinical practice (Juniper E F, et al., Eur Respir J 1999; 14). The questions enquire about the frequency and/or severity of symptoms (including nocturnal awakenings recorded upon waking in the morning, activity limitation, shortness of breath, and wheeze) over the previous week. The response options for all questions consisted of a zero (no impairment/limitation) to five (total impairment/limitation) scale. The questionnaire is scored from zero to five, with greater numbers indicating poorer control and a minimally important difference of 0.5.
[0053] Spirometry: Spirometry was conducted as per the American Thoracic Society/European Respiratory Society (ATS/ERS) Task Force: Standardization of Lung Function Testing (Eur Respir J 2005; 26: 319-338) by a trained respiratory therapist. For reproducibility criteria, a minimum of 3 acceptable curves up to a maximum of 8 (depending on patient condition) were recorded.
Results
[0054] Reslizumab reduced sputum eosinophilia by 91.2% (absolute values by 29.314) from baseline compared to placebo (P=0.003, Wilcoxon paired test) (
[0055] Attenuation of sputum and blood eosinophilia by reslizumab treatment was associated with significant improvement in lung function (20% increase in FEV.sub.1% predicted, P=0.004, Wilcoxon paired test) and ACQ-5 symptom scores by 58.9% (P=0.006, Wilcoxon paired test) compared to its placebo control (
[0056] Thus, 3.0 mg/kg (monthly) IV reslizumab was superior to 100 mg SC mepolizumab in reducing sputum eosinophils numbers and improving asthma control in certain severe prednisone-dependent eosinophilic asthmatic subjects.
[0057] Response to anti-IL-5 therapy was considered not to be of clinical relevance if there was <50% reduction in sputum and blood eosinophils (absolute values) and/or reaching normal values (i.e. >3% sputum eosinophils, >300 cells/L in blood), improvement in ACQ score <1.5, and/or exacerbations requiring additional prednisone dose (burst) or IV Solu-Medrol. Based on these criteria, 6 (out of 10) patients showed inadequate response to mepolizumab, and 1 for reslizumab (P=0.02, Chi-square Test). As expected, the non-responders at the end of both drug treatments had sputum eosinophils >3%, except one (data not shown). It is important to note that this patient from the reslizumab study, though fulfilling the criteria of a responder (i.e., had an improvement in ACQ of 2.4 score and a 59% reduction in sputum eosinophils (blood eosinophils <300 cells/L)) (data not shown), showed increase in sputum IL-5. This individual at the end of the reslizumab treatment had documented sputum eosinophils of 15.5% with many free granules, and has remained symptomatic. He was referred to as a non-responder and therefore, his data-point was plotted in the non-responder sub-group (
[0058] Immunoglobulin-bound IL-5 was significantly more detectable in the sputum of patients receiving mepolizumab compared to reslizumab (
[0059] Thus, the formation of IL-5-immunoglobulin complexes, detectable in the sputum, appeared to associate with non-responsiveness to mepolizumab.
SUMMARY
[0060] Reslizumab administered intravenously using a weight-adjusted dosage, was analyzed for its ability to decrease sputum eosinophilia and improve clinical outcomes. Treatment response of weight-adjusted IV reslizumab in patients previously treated with 100 mg SC mepolizumab was compared. It was found that: [0061] 1. 3.0 mg/kg (monthly) IV reslizumab was superior to 100 mg SC mepolizumab in decreasing sputum eosinophils, with improved asthma control in prednisone-dependent asthmatics. IV reslizumab also was effective at suppressing blood eosinophils. [0062] 2. The magnitude of the treatment effect of IV reslizumab was greater than that observed with one year (12 doses) of treatment with 100 mg SC mepolizumab. [0063] 3. Suppression of airway eosinophilia was associated with a clinically meaningful improvement in asthma control and FEV1. [0064] 4. An increase in interleukin-5 (IL-5) levels in the sputum post anti-IL-5 therapy was a predictor for response. The levels of sputum IL-5, rather than blood eosinophil count, seem to be a determinant of response to anti-IL-5 therapy. [0065] 5. Patients with increased sputum IL-5 demonstrated IL-5 immunoglobulin complexes. A possible mechanism of non-responsiveness is the formation of IL-5-immunoglobulin complexes detectable in the sputum of mepolizumab non-responders.
[0066] As shown herein, the dose of anti-IL-5 mAb was relevant in patients with severe prednisone-dependent asthma compared to patients with mild-to-moderate asthma who require inhaled corticosteroids to control their asthma. Indeed, the dose response of mepolizumab on sputum eosinophils has been previously observed (Pavord I. D., et al. Mepolizumab for severe eosinophilic asthma (DREAM): a multicentre, double-blind, placebo-controlled trial. Lancet 2012; 380: 651-659), but this was considered to be not clinically relevant because of lack of apparent correlation with clinical outcomes of exacerbation reductions. However, the effect on the prednisone-dependent sub-population, who are likely to have higher eosinophil-mediated disease, was not examined. In fact, there is no study that reports the efficacy of reslizumab therapy in prednisone-dependent severe asthmatics, and this is the first data-set on the said patient sub-set. These patients are likely to have both local and systemically derived IL-5 from both classical (e.g. CD4.sup.+ lymphocytes) and non-classical (e.g. ILC2 cells) sources. The locally derived IL-5, which may not be effectively neutralized by low dose SC anti-IL-5 mAb, could promote the local differentiation of eosinophil progenitor cells to mature eosinophils and contribute to on-going symptoms. Furthermore, in an event when the administered mAb is not in excess to the target antigen, mAb: cytokine immune complexes may be formed. These act as cytokine depots and can lead to increase in in vivo potency of the bound cytokine (i.e. contribute to IL-5 related pathology), and worsen symptoms.
[0067] Early studies from the 1990s report that cytokine: anti-cytokine complexes exhibit increased in vivo half-lives, functional potency, and downstream biological activity of the bound cytokine. For instance, in a 2:1 molar ratio, IL-4:anti-IL-4 mAb increased IgE production from B cells, in comparison to recombinant IL-4 or the mAb administered alone. A more unique observation is that neutralizing mAbs are more effective than non-neutralizing mAbs in forming potent complexes. The most accepted explanation for this paradox is that neutralizing mAb in contrast to non-neutralizing mAbs bind to the active site of the cytokine and protect it from in vivo degradation/modification and increases bioavailability to its target receptors. As demonstrated herein, detectable levels of Ig-bound IL-5 were found in the sputum of mepolizumab non-responders (
[0068] With this data, it is not implied that reslizumab has higher effective bioavailability than mepolizumab by virtue of the administration of a greater amount of reslizumab, but simply that more drug may have reached the airway when administered by the intravenous route. While reslizumab has been shown to have a greater affinity and in vitro potency compared to mepolizumab (Liddament, M., et al., P155 higher binding affinity and in-vitro potency of reslizumab for interleukin-5 compared with mepolizumab. Annals of Allergy, Asthma & Immunology. 117(5): p. S68) it cannot be determined whether this contributed to the difference in observed responses. The current discovery will aid physicians to treat patients who are poor responders/non-responders to low dose SC mepolizumab therapy with weight-adjusted IV reslizumab. It also demonstrates that monitoring sputum eosinophils is superior to blood eosinophils for assessing therapeutic response to anti-IL-5 mAbs in prednisone-dependent severe asthmatics. Finally, the discovery will allow physicians to understand the reason underlying the observed non-response (no clinical benefit) to low dose SC mepolizumab in some eosinophilic asthma patients by examining the IL-5 levels in the sputum, with a possible explanation of IL-5 immune complexes formed in vivo.
[0069] Those skilled in the art will appreciate that numerous changes and modifications can be made to the preferred embodiments of the disclosed methods and uses and that such changes and modifications can be made without departing from the spirit of the invention. It is, therefore, intended that the appended claims cover all such equivalent variations as fall within the true spirit and scope of the invention.
[0070] The disclosures of each patent, patent application, and publication cited or described in this document are hereby incorporated herein by reference, in its entirety.