Therapeutic pharmaceutical composition employing anti-SLC6A6 antibody

10214584 ยท 2019-02-26

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention aims to provide a pharmaceutical composition for cancer treatment, which comprises a novel monoclonal antibody binding to SLC6A6 or its extracellular region and a chemotherapeutic agent conjugated therewith, as well as a therapeutic method in which the monoclonal antibody or a therapeutic agent composed of the monoclonal antibody conjugated with a chemotherapeutic agent is used in combination with a chemotherapeutic agent. The present invention provides a pharmaceutical composition comprising an antibody conjugate configured such that a monoclonal antibody having higher affinity than conventional antibodies and recognizing native SLC6A6 or a native polypeptide of an extracellular region of SLC6A6 is conjugated with an anticancer agent or the like having activity against cancer and other hyperproliferative diseases.

Claims

1. A monoclonal antibody or antigen-binding fragment thereof, wherein the antibody or antigen-binding fragment thereof binds SLC6A6, wherein the monoclonal antibody is at least one selected from the group consisting of: (a) an antibody which comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 125 in SEQ ID NO: 24 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 44 to 54, positions 70 to 76 and positions 109 to 116 in SEQ ID NO: 26 as light chain CDR1, CDR2 and CDR3, respectively; (b) an antibody which comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 126 in SEQ ID NO: 28 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 46 to 57, positions 73 to 79 and positions 112 to 119 in SEQ ID NO: 30 as light chain CDR1, CDR2 and CDR3, respectively; (c) an antibody which comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 128 in SEQ ID NO: 32 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 48 to 58, positions 74 to 80 and positions 113 to 120 in SEQ ID NO: 34 as light chain CDR1, CDR2 and CDR3, respectively; (d) an antibody which comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 131 in SEQ ID NO: 36 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 44 to 54, positions 70 to 76 and positions 109 to 116 in SEQ ID NO: 38 as light chain CDR1, CDR2 and CDR3, respectively; (e) an antibody which comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 129 in SEQ ID NO: 40 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 44 to 54, positions 70 to 76 and positions 109 to 116 in SEQ ID NO: 42 as light chain CDR1, CDR2 and CDR3, respectively; and (f) an antibody which comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 126 in SEQ ID NO: 44 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 46 to 57, positions 73 to 79 and positions 112 to 119 in SEQ ID NO: 46 as light chain CDR1, CDR2 and CDR3, respectively.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

(1) The patent or application file contains at least one color drawing. Copies of this patent or patent application publication with color drawing will be provided by the USPTO upon request and payment of the necessary fee.

(2) FIG. 1 shows immunohistological staining in two lines of colorectal cancer cells (HT-29 and LoVo) for monoclonal antibody clones 204, 205, 303, 419, 402, 422 and 430.

(3) FIG. 2 shows the results analyzed for the activity of monoclonal antibodies produced from hybridoma cells, as measured by FACS using human renal epithelial cells (293T cells).

(4) FIG. 3 shows the FACS analysis of antibody clones 204, 205, 303, 419, 402, 422 and 430 using colorectal cancer cells (HCT116).

(5) FIG. 4 shows the FACS analysis of antibody clones 205, 419, 402 and 430 using two lines of colorectal cancer cells (SW480 and HT-29).

(6) FIG. 5 shows the results (typical examples) of immunohistological staining with anti-SLC6A6 monoclonal antibody (antibody clone 419) in 51 cases of colorectal cancer tissue (Colorectal cancer) and 8 cases of normal colorectal mucosa (Normal tissue).

(7) FIG. 6 shows the results of immunohistological staining in tissues of breast and uterine cancers (Cancer) and tissues of their respective normal organs (Normal).

(8) FIG. 7 shows the analysis results indicating that the binding reaction of antibody clone 402 to SLC6A6 on the colorectal cancer cell membrane is competitively inhibited by a partial protein (E. coli recombinant) of the extracellular region of SLC6A6.

(9) FIG. 8 shows the results analyzed for the number of side population cells upon transient expression of SLC6A6 in human colorectal cancer cells. Fractions within lines each represent SP cells, and the numeral in each panel represents the ratio (%) of SP cells contained. This figure shows that the number of SP cells is increased upon overexpression of the SLC6A6 gene.

(10) FIG. 9 shows the results compared and analyzed for the expression level of SLC6A6 between populations of SP cells and non-SP cells.

(11) FIG. 10 shows the results analyzed for the ratio of SP cells upon addition of taurine to the medium.

(12) FIG. 11A shows the results analyzed for antibody uptake into cells.

(13) FIG. 11B shows the analysis on whether or not c402 antibody (402 human-mouse chimeric antibody) reacted with human colorectal cancer cells (HCT116 cells) or human breast cancer cells (SK-BR3 cells) is internalized.

(14) FIG. 12 shows the analysis on whether or not the internalization of c402 antibody is inhibited by Concanavalin A (ConA).

(15) FIG. 13A shows the analysis on the internalization of c402 antibody when labeled directly with a fluorescent dye.

(16) FIG. 13B shows the analysis on the internalization of isotype control (Isotype control) (whole human IgG was used as a negative control), cetuximab (Cetuximab), 402 human-mouse chimeric antibody (Chimeric 402), 430 human-mouse chimeric antibody (Chimeric 430) and 4B9b human-mouse chimeric antibody (Chimeric 4B9b), each being directly labeled with a fluorescent dye.

(17) FIG. 14A shows the results indicating that toxicity is exerted in cells as a result of internalization of monoclonal antibody.

(18) FIG. 14B shows the results indicating that upon reaction between anti-mouse antibody labeled with saporin (which is a ribosome inhibitory toxin) and 402 antibody, 430 antibody or monoclonal antibody mouse IgG-converted 4B9b antibody, toxicity is exerted when the antibodies are taken up into cells through internalization.

DESCRIPTION OF EMBODIMENTS

(19) The present invention will be described in more detail below. It should be noted that the present invention is not limited to the following embodiments and can be implemented with modifications, as appropriate, within the spirit of the present invention. In addition, all reference documents cited herein, including patents, patent applications and other documents, are incorporated herein by reference in their entirety.

(20) The present invention is based on the finding that the membrane protein SLC6A6 is a protein overexpressed in cancer tissues and is a useful marker as a target of treatment. Further, the present invention is also based on the finding that SLC6A6 is expressed at a higher level in cancer stem cells serving as a major factor for cancer recurrence and/or metastasis than in common cancer cells. In the present invention, there is provided an antibody having higher affinity than conventional anti-SLC6A6 antibodies. Moreover, it has been found that such an antibody of the present invention allows effective delivery of anticancer agents or the like to cancer cells and further allows their uptake into the cells.

(21) The present invention relates to a pharmaceutical composition comprising a monoclonal antibody or an antigen-binding fragment thereof, which recognizes the extracellular region of a molecule called SLC6A6 (solute carrier family 6 (neurotransmitter transpoter, taurine), member 6). Since SLC6A6 is expressed in colorectal cancer, this antibody specifically binds to particularly colorectal cancer cells.

(22) More specifically, the present invention relates to a pharmaceutical composition comprising an antibody conjugate, whose mechanism of action involves using an antibody conjugate comprising the above antibody linked (hereinafter expressed as conjugated) with an anticancer agent (e.g., a chemotherapeutic agent), a toxin or a radioisotope to thereby cause uptake of the chemotherapeutic agent or the like into cancer cells. Thus, the pharmaceutical composition of the present invention is useful for treatment of cancer, particularly colorectal cancer.

(23) 1. The Monoclonal Antibody of the Present Invention

(24) (1) The Monoclonal Antibody of the Present Invention

(25) The monoclonal antibody to be used in the pharmaceutical composition of the present invention (hereinafter also referred to as the monoclonal antibody of the present invention) is capable of recognizing native SLC6A6. The term native is intended to mean being in a state of retaining the intact three-dimensional structure which is taken by the intended protein in an in vivo environment.

(26) Moreover, the monoclonal antibody of the present invention is capable of recognizing the extracellular region of SLC6A6. More specifically, the monoclonal antibody of the present invention binds to a three-dimensionally structured epitope within the extracellular region of SLC6A6. In particular, it is capable of recognizing a region covering amino acid residues 143 to 216 of SLC6A6 (SEQ ID NO: 4) as an extracellular region.

(27) Within the range of retaining the binding activity to a polypeptide having the amino acid sequence shown in SEQ ID NO: 4, i.e., as long as a target polypeptide has functions as the extracellular region of SLC6A6, the monoclonal antibody of the present invention may also recognize a mutated polypeptide comprising substitution, deletion or insertion of one or several (e.g., 2 to 20, preferably 2 to 10, more preferably 2, 3, 4 or 5) amino acids in the amino acid sequence shown in SEQ ID NO: 4 or a mutated polypeptide sharing a homology of 70% or more, preferably 80% or more, 90% or more, 95% or more, or 98% or more with the amino acid sequence shown in SEQ ID NO: 4.

(28) Moreover, the monoclonal antibody of the present invention may recognize a polypeptide having functions as the extracellular region of SLC6A6 and being a polypeptide encoded by a polynucleotide consisting of the nucleotide sequence shown in SEQ ID NO: 3, a polypeptide encoded by a polynucleotide comprising the nucleotide sequence shown in SEQ ID NO: 3, a mutated polypeptide encoded by a polynucleotide sharing a homology of 70% or more, preferably 80% or more, 90% or more, 95% or more, 98% or more, or 99% or more with the nucleotide sequence shown in SEQ ID NO: 3, or a mutated polypeptide encoded by a polynucleotide comprising a nucleotide sequence hybridizable under high stringent conditions with the nucleotide sequence shown in SEQ ID NO: 3. For this purpose, hybridization may be accomplished in a known manner (e.g., Molecular Cloning 2nd Ed (Cold Spring Harbor Lab. Press, 1989). High stringent conditions refer to so-called conditions under which a specific hybrid is formed and any non-specific hybrid is not formed. For example, high stringent conditions refer to conditions at a sodium concentration of 10 mM to 300 mM, preferably 20 mM to 100 mM and at a temperature of 25 C. to 70 C., preferably 42 C. to 55 C.

(29) The extracellular region of SLC6A6 is predicted to be responsible for binding with taurine and transport of taurine into cells. Confirmation of whether or not a mutated polypeptide has functions as an extracellular domain of SLC6A6 will be able to be accomplished by forcing the mutated polypeptide to be expressed in animal cells or the like and analyzing taurine uptake by the activation method (J. Membr. Biol, 76, 1-15, 1983).

(30) Alternatively, since the monoclonal antibody of the present invention binds to SLC6A6, among the above mutated polypeptides, those to which the monoclonal antibody of the present invention can bind indicate that the antibody maintains its binding activity to a polypeptide having the amino acid sequence shown in SEQ ID NO: 4, i.e., they fall within polypeptides having functions as the extracellular region of SLC6A6.

(31) Binding between a mutated polypeptide and the monoclonal antibody of the present invention may be confirmed by ELISA, immunoprecipitation, western blotting, etc.

(32) Moreover, the extracellular region of SLC6A6 corresponds to a cell surface site of a marker protein whose expression is increased in cancer cells. Confirmation of whether or not a mutated polypeptide has functions as an extracellular domain of SLC6A6 may be accomplished by comparing the expression of the mutated polypeptide between normal cells and cancer cells by means of immunostaining, ELISA, immunoprecipitation, western blotting, FACS, etc.

(33) The monoclonal antibody of the present invention is of subclass IgG, unlike the SLC6A6 antibodies of subclass IgM disclosed in WO2012/029990, and is shown to have higher affinity against SLC6A6 when analyzed by immunohistological staining and/or with a flow cytometer. Moreover, the monoclonal antibody of the present invention has the property of being taken up into cells through a mechanism called internalization.

(34) The monoclonal antibody of the present invention also recognizes proteins encoded by mRNA variants of slc6a6. The monoclonal antibody of the present invention can bind not only to full-length SLC6A6, but also to partially deficient mutants thereof, and is therefore capable of binding to a wide range of SLC6A6-expressing cancer cells.

(35) In the present invention, various genetic engineering and protein engineering procedures can be used to prepare antigen-binding fragments which are portions of the monoclonal antibody, for example, antibody fragments, antibody-like molecules (e.g., low molecular antibody, genetically recombinant antibody, modified antibody), or a protein fused with the monoclonal antibody. More specifically, examples include H chain, L chain, Fv, Fab, Fab, F(ab)2, scFv, sdFv, sc(Fv)2, (scFv)2, DiAbody, chimeric antibody, humanized antibody, human antibody, single chain antibody, multi-specific antibody (e.g., bispecific antibody), labeled antibody and so on. All of them fall within the monoclonal antibody of the present invention as long as they are molecules having the ability to bind to the extracellular region of SLC6A6.

(36) SLC6A6 recognized by the monoclonal antibody of the present invention is a molecular marker which is expressed in cancer cells, but not in normal cells, in a population of cells to be detected and which further shows higher expression in cancer stem cells than in cancer cells. Thus, the antibody binds to both cancer and cancer stem cells, and binds more to cancer stem cells.

(37) In the context of the present invention, the term cancer cells is intended to mean a population of cells characterized by having high proliferative ability, having no limit on the number of cell divisions, and causing invasion and/or metastasis to surrounding tissues, when compared to normal cells.

(38) In the context of the present invention, the term cancer stem cells is intended to mean cells with stem cell properties among cancer cells. Stem cells refer to cells retaining the ability to differentiate even after cell divisions. When stained with a Hoechst fluorescent dye (Hoechst 33342) and detected by flow cytometry using a UV laser (wavelength: about 350 nm) as an excitation light, cancer stem cells are confirmed as cells enriched in the side population (SP) fraction. In contrast to the main population (MP) fraction which is stained with the Hoechst fluorescent dye, the SP fraction refers to a fraction which is not or weakly stained because the dye is effluxed into the extracellular environment through ABC transporters or the like (The American Journal of Pathology, 178, 4, 1805-1813, 2011).

(39) In the context of the present invention, the term normal cells refers to cells having normal functions in vivo or in tissue activities. Such normal cells may include somatic stem cells, but are preferably mature cells.

(40) The monoclonal antibody of the present invention is preferably one which is ubiquitously expressed in cancer cells of multiple cancer types and more strongly binds to cancer stem cells, and is able to bind to multiple cancer types. Preferred are multiple cancer types of cellular or tissue origin (e.g., heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, leukocytes, colon, stomach, bone marrow, colon and rectum, and peripheral blood mononuclear cells), and more preferred are cancer cells from colorectal cancer, breast cancer and uterine cancer.

(41) Further, the monoclonal antibody of the present invention does not bind to normal cells. Preferably, the monoclonal antibody of the present invention does not bind to normal cells in at least one or more of heart, brain, placenta, lung, skeletal muscle, kidney, spleen, thymus, prostate, testis, ovary, small intestine, leukocytes, colon, bone marrow, colon and rectum, and peripheral blood mononuclear cells, by way of example.

(42) Preferred cell lines (hybridomas) producing the monoclonal antibody of the present invention are, for example:

(43) mouse-mouse hybridoma 204 (hereinafter referred to as 204);

(44) mouse-mouse hybridoma 205 (hereinafter referred to as 205);

(45) mouse-mouse hybridoma 303 (hereinafter referred to as 303);

(46) mouse-mouse hybridoma 419 (hereinafter referred to as 419);

(47) mouse-mouse hybridoma 402 (hereinafter referred to as 402);

(48) mouse-mouse hybridoma 422 (hereinafter referred to as 422); and

(49) mouse-mouse hybridoma 430 (hereinafter referred to as 430).

(50) The present invention provides these hybridomas and antibodies produced therefrom. When these hybridomas are cultured, it is possible to prepare homogeneous monoclonal antibodies.

(51) The antibody produced from 205 comprises a heavy chain variable region comprising an amino acid sequence located at positions 21 to 135 in SEQ ID NO: 24 and a light chain variable region comprising an amino acid sequence located at positions 21 to 127 in SEQ ID NO: 26.

(52) Alternatively, the antibody produced from 205 comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 125 in SEQ ID NO: 24 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 44 to 54, positions 70 to 76 and positions 109 to 116 in SEQ ID NO: 26 as light chain CDR1, CDR2 and CDR3, respectively.

(53) The antibody produced from 402 comprises a heavy chain variable region comprising an amino acid sequence located at positions 21 to 136 in SEQ ID NO: 28 and a light chain variable region comprising an amino acid sequence located at positions 23 to 130 in SEQ ID NO: 30.

(54) Alternatively, the antibody produced from 402 comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 126 in SEQ ID NO: 28 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 46 to 57, positions 73 to 79 and positions 112 to 119 in SEQ ID NO: 30 as light chain CDR1, CDR2 and CDR3, respectively.

(55) The antibody produced from 419 comprises a heavy chain variable region comprising an amino acid sequence located at positions 21 to 138 in SEQ ID NO: 32 and a light chain variable region comprising an amino acid sequence located at positions 25 to 131 in SEQ ID NO: 34.

(56) Alternatively, the antibody produced from 419 comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 128 in SEQ ID NO: 32 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 48 to 58, positions 74 to 80 and positions 113 to 120 in SEQ ID NO: 34 as light chain CDR1, CDR2 and CDR3, respectively.

(57) The antibody produced from 303 comprises a heavy chain variable region comprising an amino acid sequence located at positions 21 to 141 in SEQ ID NO: 36 and a light chain variable region comprising an amino acid sequence located at positions 21 to 127 in SEQ ID NO: 38.

(58) Alternatively, the antibody produced from 205 comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 131 in SEQ ID NO: 36 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 44 to 54, positions 70 to 76 and positions 109 to 116 in SEQ ID NO: 38 as light chain CDR1, CDR2 and CDR3, respectively.

(59) The antibody produced from 422 comprises a heavy chain variable region comprising an amino acid sequence located at positions 21 to 139 in SEQ ID NO: 40 and a light chain variable region comprising an amino acid sequence located at positions 21 to 127 in SEQ ID NO: 42.

(60) Alternatively, the antibody produced from 205 comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 129 in SEQ ID NO: 40 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 44 to 54, positions 70 to 76 and positions 109 to 116 in SEQ ID NO: 42 as light chain CDR1, CDR2 and CDR3, respectively.

(61) The antibody produced from 430 comprises a heavy chain variable region comprising an amino acid sequence located at positions 21 to 136 in SEQ ID NO: 44 and alight chain variable region comprising an amino acid sequence located at positions 23 to 130 in SEQ ID NO: 46.

(62) Alternatively, the antibody produced from 205 comprises a heavy chain variable region comprising amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 126 in SEQ ID NO: 44 as heavy chain CDR1, CDR2 and CDR3, respectively, and a light chain variable region comprising amino acid sequences located at positions 46 to 57, positions 73 to 79 and positions 112 to 119 in SEQ ID NO: 46 as light chain CDR1, CDR2 and CDR3, respectively.

(63) The monoclonal antibody of the present invention may be an antibody whose heavy chain has an amino acid sequence sharing an identity of at least 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% with the amino acid sequence shown in SEQ ID NO: 24, 28, 32, 36, 40 or 44 and whose light chain has an amino acid sequence sharing an identity of at least 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% with the amino acid sequence shown in SEQ ID NO: 26, 30, 34, 38, 42 or 46.

(64) Further, the monoclonal antibody of the present invention may be an antibody:

(65) whose heavy chain variable region comprises an amino acid sequence sharing an identity of at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% with an amino acid sequence located at positions 21 to 135 in SEQ ID NO: 24, with an amino acid sequence located at positions 21 to 136 in SEQ ID NO: 28, with an amino acid sequence located at positions 21 to 138 in SEQ ID NO: 32, with an amino acid sequence located at positions 21 to 141 in SEQ ID NO: 36, with an amino acid sequence located at positions 21 to 139 in SEQ ID NO: 40 or with an amino acid sequence located at positions 21 to 136 in SEQ ID NO: 44; and

(66) whose light chain variable region comprises an amino acid sequence sharing an identity of at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% with an amino acid sequence located at positions 21 to 127 in SEQ ID NO: 26, with an amino acid sequence located at positions 23 to 130 in SEQ ID NO: 30, with an amino acid sequence located at positions 25 to 131 in SEQ ID NO: 34, with an amino acid sequence located at positions 21 to 127 in SEQ ID NO: 38, with an amino acid sequence located at positions 21 to 127 in SEQ ID NO: 42 or with an amino acid sequence located at positions 23 to 130 in SEQ ID NO: 46.

(67) Further, the monoclonal antibody of the present invention may be an antibody:

(68) whose heavy chain variable region comprises amino acid sequences sharing an identity of at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% with amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 125 in SEQ ID NO: 24, with amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 126 in SEQ ID NO: 28, with amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 128 in SEQ ID NO: 32, with amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 131 in SEQ ID NO: 36, with amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 129 in SEQ ID NO: 40 or with amino acid sequences located at positions 50 to 54, positions 69 to 86 and positions 118 to 126 in SEQ ID NO: 44, as heavy chain CDR1, CDR2 and CDR3, respectively; and

(69) whose light chain variable region comprises amino acid sequences sharing an identity of at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% with amino acid sequences located at positions 44 to 54, positions 70 to 76 and positions 109 to 116 in SEQ ID NO: 26, with amino acid sequences located at positions 46 to 57, positions 73 to 79 and positions 112 to 119 in SEQ ID NO: 30, with amino acid sequences located at positions 48 to 58, positions 74 to 80 and positions 113 to 120 in SEQ ID NO: 34, with amino acid sequences located at positions 44 to 54, positions 70 to 76 and positions 109 to 116 in SEQ ID NO: 38, with amino acid sequences located at positions 44 to 54, positions 70 to 76 and positions 109 to 116 in SEQ ID NO: 42 or with amino acid sequences located at positions 46 to 57, positions 73 to 79 and positions 112 to 119 in SEQ ID NO: 46, as light chain CDR1, CDR2 and CDR3, respectively.

(70) Moreover, an amino acid sequence sharing a given identity with the amino acid sequence of SEQ ID NO: 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44 or 46 may be encoded by a nucleotide sequence sharing a given identity, e.g., an identity of at least 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% with the nucleotide sequence of SEQ ID NO: 21, 23, 25, 27, 29, 31, 33, 35, 37, 39, 41, 43 or 45, respectively.

(71) The monoclonal antibody of the present invention having these features is obtained by immunization procedures where cells engineered to express a membrane protein are allowed to be engrafted, as disclosed in WO2010/098471, unlike commonly used procedures for monoclonal antibody preparation. The monoclonal antibody of the present invention is expected to be difficult to prepare by procedures commonly used by those skilled in the art. This is because:

(72) (1) when a surfactant is used to prepare a membrane protein for use as an antigen, the membrane protein will lose its three-dimensional structure, whereas when no surfactant is used, aggregation will occur between hydrophobic regions in the membrane protein; and
(2) no immune response is induced because the expression level on the cell surface is low or because the extracellular region is small.

(73) The monoclonal antibody of the present invention has acquired advantageous features over conventional antibodies as a result of inventive modifications made by the inventors of the present invention to procedures for antibody preparation (particularly immunization procedures).

(74) The monoclonal antibody of the present invention has the following features.

(75) The antibody of the present invention can recognize native SLC6A6 because it is prepared based on the three-dimensional structure originally possessed by SLC6A6. For this reason, the antibody of the present invention has very strong binding ability in comparison with a conventional antibody (HPA015028) which recognizes the same epitope, and hence the antibody of the present invention achieves sufficient binding to SLC6A6 on the cell membrane, which has been difficult with conventional antibodies. Moreover, unlike a conventional monoclonal antibody (sc-166640) which recognizes the intramembrane and intracellular regions of SLC6A6, the antibody of the present invention has a recognition site in the extracellular region, and is therefore capable of binding to living cells and can be used as a carrier for therapeutic agents or anticancer agents.

(76) In addition, conventional antibodies are polyclonal antibodies and have been difficult to produce continuously as homogeneous antibodies, whereas the antibody of the present invention is a monoclonal antibody and hence can be mass-produced with high reproducibility. In terms of these features, the antibody of the present invention can be used for cancer treatment.

(77) Moreover, the monoclonal antibody in the present invention is preferably a monoclonal antibody against SLC6A6 produced from the above hybridoma 204, 205, 303, 419, 402, 422 or 430 (hereinafter referred to as 204, 205, 303, 419, 402, 422 or 430 antibody, respectively), with 402 antibody or 430 antibody being particularly preferred. Moreover, the present invention is not limited only to monoclonal antibodies produced from the above hybridomas, and any other antibodies also fall within the monoclonal antibody against SLC6A6 in the present invention as long as they bind to an epitope which is recognized by monoclonal antibodies produced from these hybridomas. As used herein, the term epitope refers to an epitope which is recognized by monoclonal antibodies produced from the above hybridomas (i.e., amino acid residues 145 to 213 in the amino acid sequence of SLC6A6, or a partial region thereof).

(78) The monoclonal antibody against SLC6A6 in the present invention may be a chimeric antibody, a humanized antibody or a complete human antibody. A humanized antibody, e.g., a mouse-human chimeric antibody, may be prepared by isolating antibody genes from mouse cells producing an antibody against SLC6A6 protein and causing recombination between its heavy chain (H chain) constant region and human IgG H chain constant region gene, followed by introduction into mouse myeloma cells. On the other hand, a human antibody may be prepared by immunizing the SLC6A6 protein into mice whose immune system has been replaced with the human immune system, as disclosed in WO2010/098471. Moreover, a protein fused with a monoclonal antibody may be prepared using the antigen-binding variable region of the antibody and another protein through existing procedures for gene recombination. Alternatively, it may be prepared by crosslinking the monoclonal antibody and the protein via a crosslinker.

(79) Thus, a human-mouse chimeric antibody of the monoclonal antibody against SLC6A6 produced from the above hybridoma 204, 205, 303, 419, 402, 422 or 430 also falls within the scope of the present invention. For example, human-mouse chimeric antibody 205 comprises a heavy chain comprising the amino acid sequence shown in SEQ ID NO: 24 and a light chain comprising the amino acid sequence shown in SEQ ID NO: 26, human-mouse chimeric antibody 402 comprises a heavy chain comprising the amino acid sequence shown in SEQ ID NO: 28 and a light chain comprising the amino acid sequence shown in SEQ ID NO: 30, human-mouse chimeric antibody 419 comprises a heavy chain comprising the amino acid sequence shown in SEQ ID NO: 32 and a light chain comprising the amino acid sequence shown in SEQ ID NO: 34, human-mouse chimeric antibody 303 comprises a heavy chain comprising the amino acid sequence shown in SEQ ID NO: 36 and a light chain comprising the amino acid sequence shown in SEQ ID NO: 38, human-mouse chimeric antibody 422 comprises a heavy chain comprising the amino acid sequence shown in SEQ ID NO: 40 and a light chain comprising the amino acid sequence shown in SEQ ID NO: 42, and human-mouse chimeric antibody 430 comprises a heavy chain comprising the amino acid sequence shown in SEQ ID NO: 44 and a light chain comprising the amino acid sequence shown in SEQ ID NO: 46. Likewise, such a human-mouse chimeric antibody may be a human-chimeric antibody comprising a heavy chain variable region comprising mouse antibody-derived CDRs and a light chain variable region comprising mouse antibody-derived CDRs.

(80) (2) The Antibody Conjugate of the Present Invention

(81) In another embodiment of the present invention, the monoclonal antibody of the present invention (including an antigen-binding fragment thereof) is conjugated with at least one anticancer agent, toxin or radioisotope. Such a monoclonal antibody of the present invention conjugated with an anticancer agent(s), a toxin(s) or a radioisotope(s) also falls within the scope of the present invention. Moreover, an antibody conjugate comprising the monoclonal antibody of the present invention and at least one anticancer agent, toxin or radioisotope (hereinafter also referred to as the antibody conjugate of the present invention) also falls with the scope of the present invention. The monoclonal antibody of the present invention used in the antibody conjugate of the present invention is preferably, for example, the 204, 205, 303, 419, 402, 422 or 430 antibody or a chimeric antibody thereof, and more preferably the 402 antibody or the 430 antibody or a chimeric antibody thereof.

(82) For example, in yet another embodiment of the present invention, there is provided an antibody conjugate comprising the monoclonal antibody of the present invention and a radioisotope, wherein the monoclonal antibody of the present invention forms a conjugate with a detectable radioisotope. Such a detectable radioisotope may be for example .sup.3H, .sup.14C, .sup.35S, .sup.90Y, .sup.99Tc, .sup.111In, .sup.125I, .sup.131I, .sup.177Lu, .sup.166Ho or .sup.153Sm.

(83) For example, in yet another embodiment of the present invention, there is provided an antibody conjugate comprising the monoclonal antibody of the present invention and an anticancer agent or a toxin, wherein the monoclonal antibody of the present invention forms a conjugate with the anticancer agent or toxin. The above anticancer agent is preferably a chemotherapeutic agent. On the other hand, examples of a toxin include diphtheria toxin, Pseudomonas endotoxin and exotoxin, Staphylococcal enterotoxin A, fungal (e.g., -sarcine, restrictocin), plant (e.g., abrin, ricin, modeccin, viscumin, pokeweed), antiviral proteins, saporin, gelonin, momordin, trichosanthin, barley toxin, Aleurites fordii proteins, dianthin proteins, Phytolacca americana proteins (PAPI, PAPII and PAP-S), Momordica charantia inhibitor, curcin, crotin, Sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, neomycin, and trichothecene, etc.

(84) Chemotherapeutic agents are chemical compounds useful in cancer treatment, regardless of their mechanism of action. The types of chemotherapeutic agents include, but are not limited to, alkylating agents, antimetabolites, spindle poison plant alkaloids, cytotoxic/antitumor antibiotics, topoisomerase inhibitors, antibodies, photosensitizers and kinase inhibitors. Chemotherapeutic agents include not only compounds used for targeting therapy but also compounds used for conventional chemotherapy. Examples of chemotherapeutic agents include erlotinib (TARCEVA, Genentech/OSI Pharm.), docetaxel (TAXOTERE, Sanofi-Aventis), 5-FU (fluorouracil, 5-fluorouracil, CAS No. 51-21-8), gemcitabine (GEMZAR, Lilly), PD-0325901 (CAS No. 391210-10-9, Pfizer), cisplatin (cis-diamine, dichloroplatinum(II), CAS No. 15663-27-1), carboplatin (CAS No. 41575-94-4), paclitaxel (TAXOL, Bristol-MyersSquibb Oncology, Princeton, N.J.), trastuzumab (HERCEPTIN, Genentech), temozolomide (4-methyl-5-oxo-2,3,4,6,8-pentazabicyclo[4.3.0]nona-2,7,9-triene-9-carboxamide, CAS No. 85622-93-1, TEMODAR, TEMODAL, Schering Plough), tamoxifen ((Z)-2-[4-(1,2-diphenylbut-1-enyl)phenoxy]-N,N-dimethyl-ethaneamide, NOLVADEX, ISTUBAL, VALODEX), and doxorubicin (ADRIAMYCIN), Akti-1/2, HPPD and rapamycin.

(85) Other examples of chemotherapeutic agents include DM1 (N2-deacetyl-N2-(3-mercapto-1-oxopropyl)-maytansine), DM4 (N2-deacetyl-N2-(4-mercapto-4-methyl-1-oxopentyl)-maytansine), MMAE (Monomethyl auristatin E), oxaliplatin (ELOXATIN, Sanofi), bortezomib (VELCADE, Millennium Pharm.), sutent (SUNITINIB, SU11248, Pfizer), letrozole (FEMARA, Novartis), imatinib mesylate (GLEEVEC, Novartis), XL-518 (Mek inhibitor, Exelixis, WO2007/044515), ARRY-886 (Mek inhibitor, AZD6244, Array BioPharma, Astra Zeneca), SF-1126 (PI3K inhibitor, Semafore Pharmaceuticals), BEZ-235 (PI3K inhibitor, Novartis), XL-147 (PI3K inhibitor, Exelixis), PTK787/ZK 222584 (Novartis), fulvestrant (FASLODEX, AstraZeneca), leucovorin (folinic acid), rapamycin (sirolimus, RAPAMUNE, Wyeth), lapatinib (TYKERB, GSK572016, Glaxo Smith Kline), lonafarnib (SARASAR, SCH 66336, Schering Plough), sorafenib (NEXAVAR, BAY43-9006, Bayer Labs), gefitinib (IRESSA, AstraZeneca), irinotecan (CAMPTOSAR, CPT-11, Pfizer), SN-38, tipifarnib (ZARNESTRA, Johnson & Johnson), ABRAXANE (cremophor-free), an albumin-modified nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, vandetanib (rINN, ZD6474, ZACTIMA, AstraZeneca), chlorambucil, AG1478, AG1571 (SU5271; Sugen), temsirolimus (TORISEL, Wyeth), pazopanib (GlaxoSmithKline), canfosfamide (TELCYTA, Telik), thiotepa, and cyclophosphamide (CYTOXAN, NEOSAR); alkyl sulfonates such as busulphan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethyleneimines and methylamelamines including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphaoramide and trimethylolomelamine; acetogenins (particularly bullatacin and bullatacinone); camptothecin (including the synthetic analog topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogs); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogs, KW-2189 and CBI-TM1); eleutherobin; pancratistatin; sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide and uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine and ranimustine; antibiotics such as enediyne antibiotics (e.g., calicheamicin, calicheamicin gamma 1I and calicheamicin omega I1 (see, e.g., Agnew Chem Intl. Ed. Engl., 33:183-186 (1994)); dynemicin, dynemicinA; bisphosphonates such as clodronate; esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycin, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU); folic acid analogs such as denopterin, methotrexate, pteropterin and trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine and thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine and floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; antiadrenal agents such as aminoglutethimide, mitotane and trilostane; folic acid replenishers such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfornithine; elliptinium acetate; epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidamine; maytansinoids such as maytansine and ansamitocin; mitoguazone; mitoxantrone; mopidamol; nitracrine; pentostatin; phenamet; pirarubicin; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK polysaccharide complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2,2-trichlorotriethylamine; trichothecenes (T-2 toxin, verracurin A, roridin A and anguidine); urethane; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside (Ara-C); cyclophosphamide; thiotepa; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin; vinblastine; etoposide (VP-16); mitoxantrone; vincristine; vinorelbine (NAVELBINE); navelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; capecitabine (XELODA, Roche); ibandronate; CPT-11; topoisomerase inhibitor RFS2000; difluoromethylornithine (DMFO); retinoids such as retinoic acid; as well as pharmaceutically acceptable salts, acids and derivatives of the above members.

(86) Also included in the definition of chemotherapeutic agents are: (i) anti-hormonal agents that act to regulate or inhibit the action of hormones on tumors, e.g., anti-estrogens and selective estrogen receptor modulators (SERMs), as exemplified by tamoxifen (NOLVADEX tamoxifen citrate), raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone and FARESTON (toremifene citrate); (ii) aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, as exemplified by 4(5)-imidazoles, aminoglutethimide, MEGASE (megestrol acetate), AROMASIN (exemestane, Pfizer), formestanie, fadrozole, RIVISOR (vorozole), FEMARA (letrozole, Novartis) and ARIMIDEX (anastrozole, AstraZeneca); (iii) anti-androgens, as exemplified by flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); (iv) protein kinase inhibitors, as exemplified by MEK inhibitors (WO2007/044515); (v) lipid kinase inhibitors; (vi) antisense oligonucleotides, particularly those which inhibit the expression of genes in signaling pathways implicated in aberrant cell proliferation, e.g., PKC-, Raf and H-Ras, as exemplified by oblimersen (GENASENSE, Genta Inc.); (vii) ribozymes, as exemplified by VEGF expression inhibitors (e.g., ANGIOZYME) and HER2 expression inhibitors; (viii) gene therapy vaccines, as exemplified by vaccines such as ALLOVECTIN, LEUVECTIN and VAXID; PROLEUKIN rIL-2; topoisomerase 1 inhibitors such as LURTOTECAN; ABARELIX rmRH; (ix) anti-angiogenic agents, as exemplified by bevacizumab (AVASTIN, Genentech); as well as pharmaceutically acceptable salts, acids or derivatives of the above members. Also included in the definition of chemotherapeutic agents are therapeutic antibodies, as exemplified by alemtuzumab (Campath), bevacizumab (Avastin, Genentech); cetuximab (ERBITUX, Imclone); panitumumab (VECTIBIX, Amgen), rituximab (RITUXAN, Genentech/Biogen Idec), pertuzumab (OMNITARG, 2C4, Genentech), trastuzumab (HERCEPTIN, Genentech), tositumomab (Bexxar, Corixia), and the antibody-drug conjugate, gemutuzumab ozogamicin (MYLOTARG, Wyeth).

(87) Human monoclonal antibodies or humanized monoclonal antibodies with therapeutic potential as chemotherapeutic agents to be combined with the anti-SLC6A6 monoclonal antibody include alemtuzumab, apolizumab, aselizumab, atlizumab, bapineuzumab, bevacizumab, bivatuzumab mertansine, cantuzumab mertansine, cedelizumab, certolizumab pegol, cidfusituzumab, cidtuzumab, daclizumab, eculizumab, efalizumab, epratuzumab, erlizumab, felvizumab, fontolizumab, gemutuzumab ozogamicin, inotuzumab ozogamicin, ipilimumab, labetuzumab, lintuzumab, matuzumab, mepolizumab, motavizumab, motovizumab, natalizumab, nimotuzumab, nolovizumab, numavizumab, ocrelizumab, omalizumab, palivizumab, pascolizumab, pecfusituzumab, pectuzumab, pertuzumab, pexelizumab, ralivizumab, ranibizumab, reslivizumab, reslizumab, resyvizumab, rovelizumab, ruplizumab, sibrotuzumab, siplizumab, sontuzumab, tacatuzumab tetraxetan, tadocizumab, talizumab, tefibazumab, tocilizumab, toralizumab, trastuzumab, tucotuzumab celmoleukin, tucusituzumab, umavizumab, urtoxazumab and visilizumab.

(88) In the antibody conjugate of the present invention, a preferred anticancer agent is 5-FU, doxorubicin or SN-38.

(89) A metabolite is a product produced through metabolism in the body of a specific compound or salt thereof. Metabolites of a compound may be identified using routine techniques known in the art, and their activity may be determined using tests such as those described herein. Such products may result from, e.g., oxidation, reduction, hydrolysis, amidation, deamidation, esterification, deesterification, enzymatic cleavage and the like, of the administered compound. Thus, the present invention includes metabolites of the compound of the present invention, including compounds produced by a method which involves contacting the compound of the present invention with a mammal for a period of time sufficient to yield metabolites thereof.

(90) For preparation of conjugates, various techniques can be used that are well known to those skilled in the art in the field to which the present invention pertains. For example, a conjugate is prepared by initial modification of reactive moieties on an antibody, such as lysine amino groups, or cysteine groups (which are generated by reduction of native disulfide bonds or by engineering of additional non-native cysteine residues onto the antibody using molecular biological techniques). Alternatively, an antibody is first modified with a heterobifunctional linker reagent, as exemplified by SPDB, SMCC and SIAB (U.S. Pat. No. 6,913,758 and U.S. Patent Publication No. 20050169933), to thereby incorporate a linker having a reactive group such as mixed pyridyldisulfide, maleimide or haloacetamide. The incorporated reactive linker group in the antibody is then conjugated with a cytotoxic agent containing a reactive moiety such as a thiol group. Another conjugation route is by reaction of a cytotoxic agent derivative containing a thiol-reactive group (e.g., haloacetamide or maleimide) with thiol groups on a cell-binding agent. Further, conjugation is also possible through N-succinylimide or maleimide which reacts with amino groups or carboxyl groups on the antibody. Another conjugation route involves reacting an antibody with an oxidant to form an aldehyde-bearing antibody, reacting the aldehyde-bearing antibody with a PEG maleimide/hydrazide bifunctional linker to form a thiol-reactive antibody, and reacting the thiol-reactive antibody with a thiolated signal-generating moiety to form an antibody-signal-generating moiety conjugate. In a specific embodiment, reacting an antibody with an oxidant to form an aldehyde-bearing antibody comprises oxidizing a glycosylated region of the antibody (with periodate, bromine or iodine) to form the aldehyde-bearing antibody.

(91) The monoclonal antibody of the present invention may be directly or indirectly linked (conjugated) with an anticancer agent, a toxin or a radioisotope. Indirect conjugation includes conjugation via a linker and conjugation via an antibody or an antibody fragment, which binds to the monoclonal antibody of the present invention. For example, an antibody conjugate formed by binding between an antibody conjugated with a labeling substance (e.g., a fluorescent label) and the monoclonal antibody of the present invention also falls within the present invention.

(92) 2. The Pharmaceutical Composition of the Present Invention

(93) In the present invention, there is provided a pharmaceutical composition comprising the monoclonal antibody of the present invention (including an antigen-binding fragment thereof). In this pharmaceutical composition, the monoclonal antibody of the present invention is conjugated with an anticancer agent, a toxin or a radioisotope, as described above. Thus, in yet another embodiment of the present invention, there is provided a pharmaceutical composition comprising the antibody conjugate of the present invention.

(94) The monoclonal antibody of the present invention recognizes SLC6A6 expressed in cancer cells and is internalized after binding to SLC6A6. For this reason, the pharmaceutical composition of the present invention comprising the monoclonal antibody of the present invention (including an antibody conjugate thereof) is useful as a pharmaceutical composition for cancer treatment, preferably as a pharmaceutical composition for colorectal cancer treatment.

(95) Moreover, the pharmaceutical composition of the present invention may also be used as a therapeutic agent for cancer. The therapeutic agent for cancer intended in the present invention comprises an SLC6A6 antibody conjugated with an anticancer agent, a toxin or a radioisotope or an antibody conjugate, or alternatively, comprises an SLC6A6 antibody optionally combined with a pharmaceutically acceptable anticancer agent or carrier, as appropriate. Alternatively, the therapeutic agent for cancer intended in the present invention may be used in combination with other modes of therapy.

(96) Moreover, the monoclonal antibody of the present invention not only recognizes SLC6A6 expressed in cancer cells, but is also taken up into the cells through the mechanism of internalization after binding to SLC6A6 on the cell membrane. Thus, the pharmaceutical composition of the present invention can be used for killing cancer cells expressing SLC6A6 and/or for labeling cancer cells with a radioisotope. In particular, in the case of comprising an antibody conjugate comprising a chemotherapeutic agent and the monoclonal antibody of the present invention, the chemotherapeutic agent conjugated with the antibody can also be taken up into cancer cells, so that the pharmaceutical composition of the present invention is useful for killing cancer cells in a cancer patient.

(97) In the present invention, cancer treatment includes killing cancer cells, reducing the size of cancer, suppressing or arresting the rate of cancer growth, or suppressing or arresting the progression of cancer, by way of example.

(98) The pharmaceutical composition of the present invention may further comprise at least one anticancer agent. As an anticancer agent to be used in combination, the same chemotherapeutic agent as that contained in the pharmaceutical composition of the present invention may be used, or alternatively, a different chemotherapeutic agent may be used. The dose and mode of administration of such an anticancer agent may be determined as appropriate by those skilled in the art.

(99) The pharmaceutical composition of the present invention may be administered to any type of cancer where SLC6A6 is expressed, and examples include malignant melanoma, malignant lymphoma, digestive organ cancer, lung cancer, esophageal cancer, gastric cancer, colorectal cancer, rectal cancer, colon cancer, urinary tract tumor, gallbladder cancer, bile duct cancer, biliary tract cancer, breast cancer, liver cancer, pancreatic cancer, testicular tumor, maxillary cancer, tongue cancer, lip cancer, oral cancer, pharyngeal cancer, laryngeal cancer, renal cancer, ovarian cancer, uterine cancer, prostate cancer, thyroid cancer, brain tumor, Kaposi's sarcoma, angioma, leukemia, polycythemia vera, neuroblastoma, retinoblastoma, myeloma, urinary bladder tumor, sarcoma, osteosarcoma, myosarcoma, skin cancer, basal cell carcinoma, skin appendage carcinoma, skin metastatic cancer, skin melanoma and so on. Preferred are colorectal cancer, gastric cancer, bladder cancer, renal cancer, uterine cancer and breast cancer, and more preferred are colorectal cancer, breast cancer and uterine cancer.

(100) The pharmaceutical composition of the present invention may be administered in any mode, including oral administration, parenteral administration (e.g., subcutaneous administration, intracutaneous administration, mucosal administration, intrarectal administration, intravaginal administration, topical administration to the affected area, dermal administration), or direct administration to the affected area, etc.

(101) The dose of the pharmaceutical composition of the present invention may generally be determined as appropriate for the age and body weight of a subject (patient) to be administered, the type and progression of disease, the route of administration, the frequency of administration, the period of administration, etc., in consideration of the mixing ratio of the active ingredient in the formulation. Such an active ingredient may be exemplified by an anticancer agent, a toxin or a radioisotope, which is to be conjugated with the monoclonal antibody of the present invention, etc.

(102) Detailed explanation will be given below for the case where the pharmaceutical composition of the present invention is used as a parenteral formulation.

(103) For use as a parenteral formulation, the pharmaceutical composition of the present invention may usually be formulated into any dosage form, such as intravenous injections (including drip infusions), intramuscular injections, intraperitoneal injections, subcutaneous injections, suppositories, etc.

(104) In the case of various types of injections, for example, they may be provided in the form of unit dose ampules or multi-dose containers or as freeze-dried powders which are dissolved again in a diluent before use. Such a parenteral formulation may comprise not only the active ingredient mentioned above, but also various known excipients and/or additives as appropriate for each dosage form as long as the effect of the above active ingredient is not impaired. In the case of various types of injections, examples of excipients and/or additives include water, glycerol, propylene glycol, and aliphatic polyalcohols such as polyethylene glycol, etc.

(105) The dose (daily dose) of such a parenteral formulation is not limited in any way. For example in the case of various types of injections, the above active ingredient (antibody) is generally used at a dose of preferably 1 to 15 mg/day, more preferably 2 to 12 mg/day, per kg body weight of a subject (patient) to be applied.

(106) For use as an oral formulation, the pharmaceutical composition of the present invention may usually be formulated into any dosage form, such as tablets, capsules, granules, powders, pills, troches, solutions for internal use, suspensions, emulsions, syrups, etc., or may be formulated into a dried product which is dissolved again before use.

(107) The pharmaceutical composition of the present invention may optionally comprise pharmaceutically acceptable additives. Specific examples of pharmaceutically acceptable additives include, but are not limited to, antioxidants, preservatives, colorants, flavors, diluents, emulsifiers, suspending agents, solvents, fillers, extenders, buffering agents, delivery vehicles, diluents, carriers, excipients and/or pharmaceutical adjuvants, etc.

(108) The present invention provides a kit comprising the monoclonal antibody of the present invention for use in treatment of cancer, e.g., colorectal cancer. The kit of the present invention has no particular limitation on its constituent materials as long as it comprises the monoclonal antibody of the present invention conjugated with an anticancer agent, a toxin or a radioisotope. In addition to the monoclonal antibody of the present invention conjugated with an anticancer agent, a toxin or a radioisotope, the kit of the present invention may further comprise water, a buffer, a container, a syringe, an instruction manual and so on. The monoclonal antibody of the present invention is provided, e.g., in an aqueous solution state or in a lyophilized state, and may be reconstituted into an appropriate state before use. Moreover, the kit of the present invention may comprise at least one additional anticancer agent. The use of the kit of the present invention allows effective treatment of cancer.

(109) Moreover, the present invention also provides a therapeutic method for cancer, which comprises administering the monoclonal antibody of the present invention to a subject. In the therapeutic method of the present invention, the monoclonal antibody of the present invention forms a conjugate with an anticancer agent, a toxin or a radioisotope. Namely, the therapeutic method of the present invention may comprise administering the antibody conjugate of the present invention to a subject. Moreover, in the therapeutic method for cancer of the present invention, an additional anticancer agent(s) may be used in combination. Further, the present invention includes the monoclonal antibody of the present invention for use in cancer treatment, wherein the monoclonal antibody of the present invention is conjugated with an anticancer agent, a toxin or a radioisotope. Moreover, the present invention also includes the conjugate of the present invention for use in cancer treatment.

EXAMPLES

(110) The present invention will be further described in more detail by way of the following examples, although the present invention is not limited only to these examples.

Example 1

(111) Obtaining of Anti-SLC6A6 Monoclonal Antibodies

(112) (1) Cells

(113) In the Example section of the present application, DLD-1, HCT116, Colo320 and WiDr were obtained from DS Pharma. Caco-2, COLO201, HCT15, HT-29, LOVO, SW480, SW620, 293T and MDA-MB231 were obtained from American Type Culture Collection (ATCC Accession No. HTB-26).

(114) Culture and subculture were conducted at 37 C. under 5% CO.sub.2 for 48 to 72 hours in RPMI 1640 medium (Sigma) containing 10% (v/v) serum (Hyclone) for MDA-MB231, SW620, DLD-1, Colo201 and Colo320, in E-MEM medium (Sigma) for WiDr, in McCoy's5A medium (Sigma) for HCT116, and in DMEM medium (Sigma) for HT-29, LoVo, SW480, 293T and the other cells, such that cell confluency did not exceed 80% in each case.

(115) (2) Cells for Immunization

(116) In the same manner as shown in Example 2 of WO2012/029990, the human SLC6A6 gene was integrated into pEF6 vector to thereby prepare an expression vector. This SLC6A6 expression vector was transformed into MDA-MB231 using FUGENE6 (Roche). Operations were conducted as described in the manufacturer's instructions attached to this kit. The cells were cultured in the medium supplemented with blasticidin S hydrochloride at 10 g/mL, and the medium was replaced every 3 to 5 days to select drug-resistant cells. For selection of SLC6A6-overexpressing cells from among the resulting resistant strains, the non-transformed cells and the transformed cells were each seeded in 96-well plates at 80% confluency and cultured at 37 C. under 5% CO.sub.2 for 16 hours.

(117) After removing the culture supernatant from each well, a 10% (v/v) neutral buffered formalin solution (WAKO) was added in 100 L volumes and reacted for 10 minutes at room temperature. After removing the formalin solution, the plates were washed three times with PBS() and then air-dried to thereby prepare cell-immobilized plates for the respective cases.

(118) Anti-c-myc antibody (santa cruz, clone 9E10) was diluted to 1 g/mL with TBS-T (25 mM Tris, 150 mM NaCl, 0.05% (v/v) Tween 20, pH 7.4) and added as a primary antibody to the immobilized plates in a volume of 100 L per well, followed by reaction at room temperature for 1 hour. Each well was washed three times with 200 L of TBS-T.

(119) For use as a secondary antibody, anti-mouse IgG polyclonal antibody-HRP label (BETHYL) was diluted 5000-fold with TBS-T. The above antibody dilution was added in a volume of 100 L per well and reacted at room temperature for 30 minutes. Each well was washed three times with 200 L of TBS-T.

(120) Orthophenylenediamine (Sigma) was diluted with 20 mM phosphate-citrate buffer (pH 5.0) to give a final concentration of 0.5 mg/mL and mixed with 1/2,000 volumes of 35% (w/w) aqueous hydrogen peroxide (WAKO). The resulting mixture was added as a substrate solution in a volume of 100 L per well and reacted at room temperature for 10 minutes. 25 L of 3 N sulfuric acid (WAKO) was added to stop the reaction. The absorbance at 492 nm was measured with a plate reader (SpectraMaxPure 384, Molecular Devices) to observe signals, thereby selecting strains showing higher signals than non-transformed MDA-MB231. Clones showing the highest expression were used as cells for immunization.

(121) (3) Transplantation of Cells

(122) Cells cultured in a 10 cm dish to reach 90% confluency were collected with trypsin (GIBCO) and washed twice with PBS() (0.01 M sodium-phosphate buffer, 0.138 M NaCl, 0.0027 M KCl, pH 7.4). The washed cells were suspended in growth factor reduced Matrigel (Becton Dickinson) to give a final density of 8.610.sup.7 cells/mL and stored on ice until use for transplantation.

(123) Chloral hydrate (Sigma) was dissolved at a concentration of 3.5% (w/v) in physiological saline to prepare a 3.5% solution of chloral hydrate in physiological saline. Nude mice at 6 to 8 weeks of age (BALB/cALcl-nu/nu line (CLEA Japan, Inc., Japan)) were anesthetized by being intraperitoneally administered with 0.2 mL of the 3.5% solution of chloral hydrate in physiological saline. Into the fourth mammary glands in each mouse, the cells suspended in the Matrigel were transplanted at 110.sup.6 cells per mammary gland via a 24 G injection needle, such that the cells did not extend off the mammary gland. Each mouse received two transplantations, one at left and another at right fourth mammary gland in the trunk.

(124) (4) Expression and Purification of SLC6A6 Partial Protein for Screening

(125) From the full-length gene for SLC6A6 introduced into pEF6 vector in Example 1(2), DNA (SEQ ID NO: 3) encoding a region covering amino acid residues 143 to 216 (SEQ ID NO: 4) in the extracellular region was subcloned into pET32 vector. The following primers were used for PCR.

(126) TABLE-US-00001 Primersequences Forward: (SEQIDNO:5) ATAGGATCCGGCCTGGGCCACATACTACCTG Reverse: (SEQIDNO:6) TATGAATTCGCTTTCAGAGAGCCTGGGTGGTC

(127) The PCR reaction was accomplished by preincubation at 94 C. for 2 minutes and subsequent 30 cycles of denaturation at 98 C. for 10 seconds, annealing at 58 C. for 30 seconds and elongation at 68 C. for 30 seconds to amplify a gene fragment. The resulting amplified fragment was integrated into pET32 vector (Novagen) by means of the restriction enzymes (EcoRI and BamHI) located on the primers.

(128) The amplified fragment was confirmed for its nucleotide sequence by DNA sequencing, indicating that the same extracellular region gene sequence as found in the database was integrated and a His tag sequence was added to the C-terminal end.

(129) BL21(DE3) (Invitrogen) was transformed with this vector and cultured in LB medium (1% (w/v) tryptone (Sigma), 0.5% (w/v) yeast extract (Sigma), 0.5% (w/v) NaCl (Sigma)) supplemented with 1% (w/v) glucose. After the medium turbidity reached 0.6 at a wavelength of 600 nm, 1 mM IPTG (WAKO) was added and culture was continued for 16 hours. The microbial cells were collected by centrifugation and then homogenized by ultrasonication to obtain a fraction containing the extracellular region of SLC6A6 as an insoluble protein.

(130) About 10 mg of the sample was dissolved in Buffer A (1 M guanidine hydrochloride (Sigma), 10 mM DTT (Sigma), 10 mM EDTA (Sigma)) and reacted at 37 C. for 1 hour. The reacted product was gently added to 1 L of Buffer B (50 mM Tris, 150 mM NaCl, 5% glycerol, 0.4 mM oxidized glutathione (Sigma), pH 8.5), followed by stirring at 4 C. for 18 hours. The dissolved sample was applied to a Ni sepharose column (GE) and eluted with Buffer C (50 mM potassium phosphate buffer, 150 mM NaCl, 200 mM imidazole, pH 8.0), followed by dialysis against imidazole-free Buffer C to obtain a partial protein of the extracellular region of SLC6A6 in a purified state.

(131) (5) Antiserum Analysis

(132) The recombinant protein obtained in (4) above (10 g/ml) was dispensed in 100 L volumes into MaxiSorp 96-well plates (Nunc) and adsorbed onto the plates at room temperature for 1 hour. After adsorption, each well was washed with TBS-T (TBS-T (25 mM Tris, 150 mM NaCl, 0.05% (v/v) Tween 20, pH 7.4) and charged with skimmed milk (GIBCO), which had been diluted to 5% with TBS-T, to conduct blocking for 30 minutes at room temperature. After each well was washed three times with 200 L of TBS-T, mouse plasma samples collected from the tail vein were each diluted 1/2000-fold with TBS-T and added to the ELISA plates in a volume of 100 L per well, followed by reaction at room temperature for 1 hour. Each well was washed three times with 200 L of TBS-T.

(133) For use as a secondary antibody, anti-mouse IgG polyclonal antibody-HRP label (BETHYL) was diluted 5000-fold with TBS-T. The above antibody dilution was added in a volume of 100 L per well and reacted at room temperature for 30 minutes. Each well was washed three times with 200 L of TBS-T.

(134) Orthophenylenediamine (Sigma) was diluted with 20 mM carbonate-citrate buffer (pH 5.0) to give a final concentration of 0.5 mg/mL and mixed with 1/2000 volumes of 35% (w/w) aqueous hydrogen peroxide (WAKO). The resulting mixture was added as a substrate solution in a volume of 100 L per well and reacted at room temperature for 10 minutes. 25 L of 3 N sulfuric acid (WAKO) was added to stop the reaction. The absorbance at 492 nm was measured with a plate reader (SpectraMaxPure 384, Molecular Devices) to analyze antibody titers, which were then used for selection of mice to be used for cell fusion.

(135) (6) Cell Fusion

(136) Mouse spleen lymphocytes were electrically fused with mouse myeloma cell line P3X63-Ag8 (ATCC Accession No. CRL-1580). For cell fusion, 110.sup.8 spleen cells were mixed with 0.2510.sup.8 cells of the myeloma cell line and suspended in EP Buffer (0.3 M mannitol, 0.1 mM CaCl.sub.2, 0.1 mM MgCl.sub.2) to give a cell density of 0.2510.sup.8 cells/mL, followed by cell fusion with an electro cell fusion generator LF201 (Nepa Gene Co., Ltd., Japan). Fusion conditions were set in accordance with the manufacturer's recommended protocols.

(137) The fused cells were suspended in HAT medium (Invitrogen) and dispensed into thirty 96-well plates in a volume of 100 L per well. During culture, 200 L, of HAT medium was added to each well. After culture for 11 to 16 days, the plates were observed under a microscope, indicating that 5 to 12 colonies were formed per well.

(138) (7) Obtaining of Monoclonal Antibodies

(139) At 3 to 7 months after transplantation, spleen cells were collected from the mice and used to prepare hybridoma cells in the same manner as shown in (6) above. For selection of antibodies recognizing SLC6A6, the same procedure as shown in (5) above was used to select clones. As a primary antibody, the culture supernatant of each hybridoma was used. For use as a secondary antibody, anti-mouse IgG1 polyclonal antibody-HRP label, anti-mouse IgG2a polyclonal antibody-HRP label and anti-mouse IgG2b polyclonal antibody-HRP label (Bethyl) were mixed together in equal amounts and diluted 100000-fold with TBST to ensure that only clones of subclass IgG were detected. In this way, hybridomas producing desired antibodies were selected.

(140) The thus obtained monoclonal antibody-producing hybridoma cells were cultured in ten 10 cm dishes to reach 90% confluency and then cultured for 10 days in a 1:1 mixture of HT medium (Invitrogen) and EX CELL Sp2/0 (Nichirei Bioscience Inc., Japan). The culture supernatants were collected and purified with a Protein G column. The Protein G column (GE Healthcare) was used in a volume of 0.5 mL relative to 100 mL of the culture supernatant. The cultured solutions were each passed at a flow rate of 1 to 3 ml/min through the Protein G column which had been equilibrated with PBS(), followed by washing with 6 mL of washing buffer (25 mM Tris-HCl (pH 7.4), 140 mM NaCl, 10 mM KCl). Then, antibody proteins were eluted with 1 mL of elution buffer (0.1 M glycine-HCl (pH 2.5) or 0.1 M glycine-HCl (pH 3.0)) and neutralized with 0.5 M Tris-HCl (pH 7.4) to be within pH 7.0 to 7.4. The antibodies were concentrated with Amicon Ultra 30 (Millipore) and the buffer was replaced with PBS(). The antibody clones obtained from the resulting seven hybridoma clones and the anti-SLC6A6 antibodies 4B9b and 5H12d disclosed in WO2012/029990 are summarized in Table 1 below for their subclass and their results of ELISA measured in the same manner as shown in (5) above.

(141) TABLE-US-00002 TABLE 1 Antibody No. Subclass ELISA reactivity 204 IgG2a ++++ 205 IgG2b +++ 303 IgG2a +++ 419 IgG2a +++ 402 IgG2a + 422 IgG1 + 430 IgG2a + 4B9h IgM ++ 5H12d IgM ++

(142) The hybridoma 4B9b producing the antibody 4B9b was internationally deposited under Accession No. FERM BP-11413 by Bio Matrix Research Inc. (105 Higashifukai, Nagareyama-shi, Chiba 270-0101, Japan) on Jul. 21, 2010 with the International Patent Organism Depositary, the National Institute of Advanced Industrial Science and Technology in Japan (Central 6, 1-1-1 Higashi, Tsukuba-shi, Ibaraki 305-8566, Japan) under the Budapest Treaty. Likewise, the hybridoma 5H12d producing the antibody 5H12d was internationally deposited under Accession No. FERM BP-11414 by Bio Matrix Research Inc. (105 Higashifukai, Nagareyama-shi, Chiba 270-0101, Japan) on Jul. 21, 2010 with the International Patent Organism Depositary, the National Institute of Advanced Industrial Science and Technology in Japan (Central 6, 1-1-1 Higashi, Tsukuba-shi, Ibaraki 305-8566, Japan) under the Budapest Treaty (the above date in each hybridoma represents its initial deposit date). For expression of mouse IgG-converted antibody 4B9b, an H chain expression vector and an L chain expression vector were obtained as described in PCT/JP2013/56884 and used for this purpose. For expression of human IgG-converted mouse-human chimeric 4B9b antibody, an H chain expression vector and an L chain expression vector were obtained as described in PCT/JP2013/56884 and used for this purpose.

(143) (8) Immunocytological Staining

(144) The seven types of antibody clones 204, 205, 303, 419, 402, 422 and 430 obtained in (7) above were analyzed for their reactivity to colorectal cancer cells (HT-29 and LoVo). Moreover, as controls for comparison purposes, the anti-SLC6A6 antibodies 4B9b and 5H12d disclosed in WO2012/029990 were also analyzed in the same manner. Hereinafter, antibodies produced by hybridoma cells are also represented by their respective clone numbers.

(145) HT-29 and LoVo cells were cultured to reach 80% confluency and then seeded onto cover slips coated with Cellmatrix Type I-A (Nitta Gelatin Inc., Japan). After culture for 2 days, the cells were fixed with 10% neutral buffered formalin (WAKO). After being treated with 0.3% (v/v) aqueous hydrogen peroxide for 20 minutes, the cover slips were washed three times with TBST and treated with TBST containing 5% (w/v) skimmed milk, followed by addition of the antibodies purified in (7) above at a concentration of 10 g/mL and reaction at 4 C. for 16 hours. After washing three times with TBST, anti-mouse IgG polyclonal antibody-Alexa Fluor 488 label or anti-mouse IgM polyclonal antibody-Alexa Fluor 488 label was reacted as a secondary antibody at room temperature for 30 minutes. After washing three times with TBST, the cover slips were sealed with Mounting Medium (Vector Shield).

(146) FIG. 1 shows the results analyzed for the fluorescence intensity of each antibody under the same conditions. Signals were observed in all the clones (204, 205, 303, 419, 402, 422 and 430), and signals were clearly observed particularly in the clones 204, 205, 303, 419 and 402. When compared to antibodies of subclass IgM such as 4B9b and 5H12d, the clone 205, 303 and 419 antibodies were found to result in significantly higher signals and therefore have higher affinity. In this example, clones having higher titers than conventional SLC6A6 antibodies were able to be obtained.

Example 2

(147) (1) FACS Analysis

(148) 293T cells (which are human fetal renal cells) were cultured to reach 90% confluency. After being washed twice with PBS(), the cells were detached with a scraper and collected into 1.5 mL tubes. The 204, 205 and 419 antibodies were each added to the tubes at a final concentration of 10 g/mL, followed by reaction for 60 minutes. As a control for comparison purposes, 4B9b was added at the same concentration, followed by reaction. After the cells were washed twice with PBS() supplemented with 2% FBS (PBS+2% FBS), Alexa Fluor 488-labeled goat-anti-mouse IgG (Invitrogen) was added as a 1/1000 dilution in PBS+2% FBS, followed by reaction for 30 minutes. After being washed twice with PBS+2% FBS, the cells were analyzed by FACS Verse (BD). The results obtained are shown in FIG. 2.

(149) As can be seen from FIG. 2, the 204, 205 and 419 antibodies were found to more strongly react with 293T cells than 4B9b. Since 293T cells express SLC6A6, it is indicated that the SLC6A6 antibodies of the present invention recognize SLC6A6 in its native structure. Moreover, it is also indicated that the SLC6A6 antibodies of the present invention are able to bind to native SLC6A6 with higher affinity than the conventional SLC6A6 antibody.

Example 3

(150) FACS Analysis

(151) The monoclonal antibodies obtained in Example 1(7), i.e., the antibody clone 204, 205, 303, 419, 402, 422 and 430 antibodies were analyzed for their reactivity to HCT116 cells (which are human colorectal cancer cells) in the same manner as shown in Example 2. The results obtained are shown in FIG. 3.

(152) As can be seen from FIG. 3, the antibody clone 204, 205, 303, 419, 402, 422 and 430 antibodies were found to accurately react with human colorectal cancer cells HCT116.

(153) The antibody clone 205, 419, 402 and 430 antibodies were analyzed for their reactivity to SW480 and HT-29 cells (which are human colorectal cancer cells) in the same manner as shown in Example 2. The results obtained are shown in FIG. 4.

(154) As can be seen from FIG. 4, the antibody clone 205, 419, 402 and 430 antibodies were also found to accurately react with these two types of cell lines.

(155) In a case where a monoclonal antibody is used as ADC, which is a conjugate with an anticancer agent, a toxin, a radioisotope or the like, an antibody more strongly recognizing the native structure of a protein is preferred for this purpose. This is because cells are alive in cancer tissues and therefore SLC6A6 expressed by cancer cells also retains its native structure. Namely, FACS analysis in Example 3 will be more suitable than the procedure shown in Example 1(5) or 1(8) for the purpose of selecting an antibody clone suitable for use as ADC.

Example 4

(156) (1) Immunohistological Staining

(157) 51 cases of colorectal cancer tissue and 8 cases of normal colorectal mucosa were immunohistologically stained with the mouse antibody (clone 205). Paraffin-embedded slices of human colorectal cancer tissues (US Biomax) were deparaffinized with xylene and rehydrated with ethanol. After being treated with 0.3% (v/v) aqueous hydrogen peroxide for 20 minutes, the resulting tissue slices were washed three times with TBST and treated with 1 mg/mL Proteinase K at 37 C. for 15 minutes to activate antigens. Using a Histofine SAB-PO universal kit (Nichirei Corporation, Japan), staining was conducted in accordance with the protocols attached thereto. For primary antibody reaction, 10 g/mL of the 205 antibody was added and reacted at 37 C. for 1 hour. For color development, ImmPACT DAB Substrate (Vector) was added to cause color development for 5 minutes. After washing with distilled water, nuclei were stained with Hematoxylin (WAKO), and the slices were washed with running water, treated sequentially with ethanol and xylene, and then sealed.

(158) FIG. 5 shows the results (typical examples) of staining performed on colorectal cancer tissues (Colorectal cancer) and normal tissues (Normal tissue). The stained images were expressed as follows: +++ for strongly positive images; ++ for positive images; + for weakly positive images distinguishable from normal tissue; and for non-stained images or normal tissue. It should be noted that undetermined cases were expressed as +/. In the colorectal cancer tissues, when combining the weakly positive, positive and strongly positive cases all together, about 84% (43 cases) were stained with the SLC6A6 antibody of the present invention. In Table 2, the samples used in Example 4 are summarized for their origin and results.

(159) TABLE-US-00003 TABLE 2 No. Age Sex Organ Diagnosis pTNM Stage Months* SLC6A6 1 67 M Descending colon mucinous adenocarcinoma T3N2bM0 III C ++ 2 60 M Rectum adenocarcinoma, moderately differentiated T3N0M0 II A +/ 3 59 M Sigmoid colon adenocarcinoma, well differenciated T3N0M0 II A ++ 4 58 F Rectum adenocarcinoma, moderately differentiated T3N2bM0 III C + 5 64 M Rectum adenocarcinoma, moderately differentiated T3N2aM0 III B + 6 31 M Rectum mucinous adenocarcinoma T3N2bM0 III C + 7 47 F Rectum adenocarcinoma, well differenciated T3N1M0 III B fall off 8 46 F Rectum adenocarcinoma, well differenciated T3N0M0 II A +/ 9 64 M Sigmoid colon adenocarcinoma, well differenciated T3N1aM0 III B 10 64 F Rectum adenocarcinoma, moderately differentiated T2N0M0 I + 11 30 M Rectum adenocarcinoma T3N1bM0 III B ++ 12 51 M Ascending colon adenocarcinoma, moderately differentiated T3N0M0 II A + 13 67 M Cecum adenocarcinoma, well differenciated T3N0M0 II A ++ 14 38 M Rectum adenocarcinoma, well differenciated T3N0M1a IV A ++ 15 71 F Descending colon mucinous adenocarcinoma T3N0M0 II A ++ 16 52 M Rectum adenocarcinoma, well differenciated T4aN0M0 II B ++ 17 63 M Transverse colon adenocarcinoma, moderately differentiated T3N1bM0 III B + 18 62 M Descending colon adenocarcinoma, moderately differentiated T3N0M0 II A + 19 60 M Sigmoid colon adenocarcinoma, moderately differentiated T3N0M0 II A ++ 20 72 M Transverse colon adenocarcinoma, moderately differentiated T3N2bM0 III C ++ 21 67 M Sigmoid colon adenocarcinoma, moderately differentiated T3N1bM0 III B + 22 71 M Sigmoid colon adenocarcinoma, moderately differentiated T4aN2aM0 III C + 23 72 M Rectum adenocarcinoma, well differenciated T2N0M0 I + 24 68 M Ascending colon mucinous carcinoma T4aN1bM0 III B ++ 25 54 M Ascending colon adenocarcinoma, poorly differentiated T3N2bM0 III C ++ 26 57 M Sigmoid colon adenocarcinoma, moderately differentiated T3N0M0 II A 27 56 F Sigmoid colon adenocarcinoma, moderately differentiated T3N2aM0 III B ++ 28 58 M Rectum adenocarcinoma, moderately differentiated T3N0M0 II A + 29 uk F Descending colon adenocarcinoma, well differenciated T3N1bM1a IV A + 30 41 F Sigmoid colon adenocarcinoma, well differenciated T3N2aM1b IV B ++ 31 52 M Rectum adenocarcinoma, moderately differentiated T3N1aM1a IV A + 32 46 F Ascending colon adenocarcinoma, poorly differentiated T3N2bM0 III C +/ 33 44 M Rectum adenocarcinoma, moderately differentiated T3N2aM1a IV A +/ 34 47 F Sigmoid colon adenocarcinoma, moderately differentiated T3N1bM1b IV B + 35 60 M Sigmoid colon adenocarcinoma, moderately differentiated T3N0M1a IV A + 36 53 M Ascending colon adenocarcinoma, poorly differentiated T3N1bM1a IV A + 37 39 F Sigmoid colon adenocarcinoma, moderately differentiated T3N1bM1a IV A +/ 38 36 F Ascending colon adenocarcinoma, moderately differentiated T3N2bM1b IV B + 39 69 M Cecum adenocarcinoma, moderately differentiated T2N1bM1a IV A +++ 40 50 M Transverse adenocarcinoma, moderately differentiated T3N2aM1b IV B +++ 41 55 M Lung metastatic carcinoma from #31 45 +++ 42 46 F Lymph Node metastatic carcinoma from #32 0 +/ 43 45 M Lung metastatic carcinoma from #33 17 + 44 47 F Ovary metastatic carcinoma from #34 0 + 45 62 M Lung metastatic carcinoma from #35 36 + 46 53 M Liver metastatic carcinoma from #36 0 + 47 41 F Ovary metastatic carcinoma from #37 17 + 48 35 F Uterus metastatic carcinoma from #38 0 ++ 49 69 M Liver metastatic carcinoma from #39 0 +++ 50 50 M Omentum metastatic carcinoma from #40 0 +++ 51 44 M Rectum normal colon (adjacent to cancer, match of #33) . 52 47 F Sigmoid colon normal colon (adjacent to cancer, match of #34) 53 54 M Sigmoid colon normal colon (adjacent to cancer, match of #9) 54 57 M Descending colon normal colon (adjacent to cancer, match of #1) +/ 55 60 M Rectum normal colon (adjacent to cancer, match of 2) +/ 56 59 M Sigmoid colon normal colon (adjacent to cancer, match of #3) +/ 57 58 F Rectum normal colon (adjacent to cancer, match of #4) +/ 58 64 M Rectum normal colon (adjacent to cancer, match of #5) +/ 59 68 M Ascending colon normal colon (adjacent to cancer, match of #24) +/

Example 5

(160) Immunohistological Staining

(161) In the same manner as shown in Example 4 above, cancer tissues of breast and uterine cancers (Cancer) and their respective normal tissues (Normal) were immunohistologically stained with the mouse antibody (clone 205). The results obtained are shown in FIG. 6. In both breast cancer and uterine cancer, cancer lesions were also accurately stained with the SLC6A6 antibody of the present invention. All of the 3 cases were found to be positive (100%) in breast cancer, while 2 of the 3 cases were found to be strongly positive (66%) in uterine cancer.

Example 6

(162) Competitive Inhibition Test

(163) Among the monoclonal antibodies obtained above, the antibody clone 402 was analyzed for binding to an extracellular domain of SLC6A6. The antibody clone 402 (10 g/mL) and the partial protein of the extracellular region of SLC6A6 prepared in Example 1(4) (15 g/mL) were mixed and reacted at 37 C. for 1 hour. A sample free from the recombinant protein was prepared as a control in the same manner. Each sample was reacted at 4 C. for 1 hour with HCT116 cells cultured on glass, and then reacted with a secondary antibody in the same manner as shown in Example 1(8) for detection. The results obtained are shown in FIG. 7. In FIG. 7, Phase represents images observed in visible light under a phase contrast microscope.

(164) FIG. 7 shows that the fluorescence generated upon binding of the antibody clone 402 to HCT116 disappears when the partial protein of the extracellular region of SLC6A6 is added. This indicated that the antibody clone 402 had the ability to react with the extracellular region of SLC6A6. Namely, the antibody clone 402 was demonstrated to specifically react with the extracellular region of SLC6A6.

Example 7

(165) Preparation of Chimeric Antibodies

(166) (1) Cloning of Genes

(167) The hybridoma cells obtained in Example 1 were cultured and their total RNA was extracted with a Qiagen RNeasy Mini kit. From the extracted total RNA (2 g), cDNA was synthesized by reverse transcription (RT) reaction at 50 C. for 1 hour with SuperScript III reverse transcriptase (Invitrogen), followed by heating at 85 C. for 5 minutes to stop the reaction. The resulting cDNA was used as a template for PCR reaction with the following primers and with KOD PLUS (TOYOBO) to amplify a desired gene.

(168) To amplify an H chain variable region fragment of the antibody, the primers of SEQ ID NO: 7, SEQ ID NO: 8 and SEQ ID NO: 9 were used in PCR reaction (30 cycles of denaturation at 94 C. for 2 minutes, subsequent annealing at 56 C. for 15 seconds and elongation at 68 C. for 45 seconds) to thereby obtain the desired fragment.

(169) TABLE-US-00004 Long: (SEQIDNO:7) 5-CTAATACGACTCACTATAGGGCAAGCAGTGGTATCAACGCAGAGT-3 Short: (SEQIDNO:8) 5-CTAATACGACTCACTATAGGGC-3 mIgG2a_CH1_reverse: (SEQIDNO:9) 5-CCAGGGGCCAGTGGATAGACCGATGGGGCTGTTG-3

(170) To amplify an L chain leader sequence and an L chain variable region fragment of the antibody, the primers of SEQ ID NO: 7, SEQ ID NO: 8 and SEQ ID NO: 10 were used in PCR reaction (30 cycles of denaturation at 94 C. for 2 minutes, subsequent annealing at 56 C. for 15 seconds and elongation at 68 C. for 45 seconds) to thereby obtain the desired fragment.

(171) TABLE-US-00005 mIgkappa_R3: (SEQIDNO:10) 5-GCACCTCCAGATGTTAACTGCTCACT-3

(172) The purified PCR amplification fragments were each mixed with 10 mM dNTP Mix (Invitrogen Corporation) and 2 GoTaq Maxter Mix (Promega) and reacted at 70 C. for 15 minutes, followed by ice cooling at 4 C. for 2 minutes to ensure dA addition to the 3-terminal end. Then, using a pGEM-T-Easy Vector System (Promega), the H chain fragment and the L chain fragment were cloned by the so-called TA cloning method.

(173) (i) Construction of H Chain Expression Vector

(174) First, to amplify the H chain constant region of human IgG1, oligo DNA shown in SEQ ID NO: 11 was chemically synthesized, followed by PCR reaction (30 cycles of denaturation at 94 C. for 2 minutes, subsequent annealing at 58 C. for 15 seconds and elongation at 68 C. for 60 seconds) with the primers of SEQ ID NO: 12 and SEQ ID NO: 13 to thereby obtain an H chain constant region fragment of human IgG1.

(175) TABLE-US-00006 hHchain: (SEQIDNO:11) 5-GCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCA AGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTA CTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGGCGCCCTGACCAGC GGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCC TCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTA CATCTGCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAA GTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACCGTGCCCAG CACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACC CAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTG GTGGACGTGAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGG ACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCAGTA CAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGAC TGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCC CAGCCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGA ACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAAC CAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCG CCGTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCAC GCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCTACAGCAAGCTC ACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCG TGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCT GTCTCCGGGTAAATGA-3 hCg1_F(EcoRI-NheI): (SEQIDNO:12) 5-TTTGAATTCGCTAGCACCAAGGGCCCATC-3 hCgI_R(NotI): (SEQIDNO:13) 5-TTTGCGGCCGCTCATTTACCCGGAGACAGGGAGAG-3

(176) Secondly, a MluI recognition sequence in pEF6-myc/HisA vector (Invitrogen) was disrupted, and the oligonucleotides of SEQ ID NO: 14 and SEQ ID NO: 15 were annealed and then introduced by using restriction enzymes (KpnI/BamHI) (this vector is designated as pEF6-Leader).

(177) TABLE-US-00007 Hchain_signal_top(KpnI-BamHI): (SEQIDNO:14) 5-CATGGGTTGGAGCCTCATCTTGCTCTTCCTTGTCGCTGTTGCTACG CGTG-3 Hchain_signal_bottom(KpnI-BamH): (SEQIDNO:15) 5-GGATCCACGCGTAGCAACAGCGACAAGGAAGAGCAAGATGAGGCTC CAACCCATGGTAC-3

(178) Then, the amplified human IgG H chain constant region was introduced into pEF6-Leader by using restriction enzymes (EcoRI/NotI) (this vector is designated as pEF6-hHchain-cloning).

(179) Then, to introduce the H chain variable region fragment of the 205 antibody into pEF6-hHchain-cloning, the H chain variable region fragment cloned by the TA cloning method was used as a template for PCR reaction (30 cycles of denaturation at 94 C. for 2 minutes, subsequent annealing at 56 C. for 15 seconds and elongation at 68 C. for 45 seconds) with the primers of SEQ ID NO: 16 and SEQ ID NO: 17 to thereby obtain the H chain variable region fragment.

(180) TABLE-US-00008 Forward: (SEQIDNO:16) 5-TTTACGCGTGTCCTGTCCCAGGTCCAGCTGCAGCAGTC-3 Reverse: (SEQIDNO:17) 5-TTTGCTAGCTGCAGAGACAGTGACCAGAGTCCCT-3

(181) Subsequently, the amplified H chain variable region fragment was introduced into pEF6-hHchain-cloning by using restriction enzymes (MluI/NheI) (the vector obtained is hereinafter designated as the 205 chimeric H chain expression vector).

(182) (ii) Construction of L Chain Expression Vector

(183) First, to amplify the human kappa chain constant region, oligo DNA shown in SEQ ID NO: 18 was chemically synthesized, followed by PCR reaction (30 cycles of denaturation at 94 C. for 2 minutes, subsequent annealing at 58 C. for 15 seconds and elongation at 68 C. for 30 seconds) with the primers of SEQ ID NO: 19 and SEQ ID NO: 20 to thereby obtain a human kappa chain constant region fragment.

(184) TABLE-US-00009 hLchain: (SEQIDNO:18) 5-CACCAAGCTGGAAATCAAACGTACGGTGGCTGCACCATCTGTCTTC ATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTG TGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAA GGTGGATAACGCCCTCCAATCGGGTAACTCCCAGGAGAGTGTCACAGAG CAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTGA GCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCA TCAGGGCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGT TAG-3 hCk_F(EcoRI-BsiWI): (SEQIDNO:19) 5-TTTGAATTCCGTACGGTGGCTGCACCATC-3 hCk_R(NotI): (SEQIDNO:20) 5-TTTGCGGCCGCCTAACACTCTCCCCTGTTG-3

(185) Secondly, the amplified human kappa chain constant region was introduced into pEF1-myc/HisA vector (Invitrogen) by using restriction enzymes (EcoRI/NotI) (this vector is designated as pEF1-hLchain-cloning).

(186) Then, to introduce the L chain signal sequence and variable region of the 205 antibody into pEF1-hLchain-cloning, the L chain signal sequence and variable region fragment cloned by the TA cloning method was used as a template for PCR reaction (30 cycles of denaturation at 94 C. for 2 minutes, subsequent annealing at 58 C. for 15 seconds and elongation at 68 C. for 30 seconds) with the primers of SEQ ID NO: 21 and SEQ ID NO: 22 to thereby obtain the L chain signal sequence and variable region fragment of the 205 antibody.

(187) TABLE-US-00010 Forward2: (SEQIDNO:21) 5-TTTGGATCCACCATGAACATGCTCACTCAGC-3 Reverse2: (SEQIDNO:22) 5-TTTCGTACGTTTGATTTCCAGCTTGGTG-3

(188) Then, the amplified L chain signal sequence and variable region fragment was introduced into pEF1-hLchain-cloning by using restriction enzymes (BamHI/BsiWI) (this vector is designated as the 205 chimeric L chain expression vector).

(189) The H chain of the thus prepared human-mouse chimeric 205 antibody has the DNA sequence shown in SEQ ID NO: 23 and the amino acid sequence shown in SEQ ID NO: 24. Likewise, the L chain has the DNA sequence shown in SEQ ID NO: 25 and the amino acid sequence shown in SEQ ID NO: 26.

(190) Moreover, human-mouse chimeric antibodies were also prepared for the other antibodies. The H chain of the human-mouse chimeric 402 antibody has the DNA sequence shown in SEQ ID NO: 27 and the amino acid sequence shown in SEQ ID NO: 28. Likewise, the L chain has the DNA sequence shown in SEQ ID NO: 29 and the amino acid sequence shown in SEQ ID NO: 30. Further, the H chain of the human-mouse chimeric 419 antibody has the DNA sequence shown in SEQ ID NO: 31 and the amino acid sequence shown in SEQ ID NO: 32. Likewise, the L chain has the DNA sequence shown in SEQ ID NO: 33 and the amino acid sequence shown in SEQ ID NO: 34. Furthermore, the H chain of the human-mouse chimeric 303 antibody has the DNA sequence shown in SEQ ID NO: 35 and the amino acid sequence shown in SEQ ID NO: 36. Likewise, the L chain has the DNA sequence shown in SEQ ID NO: 37 and the amino acid sequence shown in SEQ ID NO: 38. Furthermore, the H chain of the human-mouse chimeric 422 antibody has the DNA sequence shown in SEQ ID NO: 39 and the amino acid sequence shown in SEQ ID NO: 40. Likewise, the L chain has the DNA sequence shown in SEQ ID NO: 41 and the amino acid sequence shown in SEQ ID NO: 42. Furthermore, the H chain of the human-mouse chimeric 430 antibody has the DNA sequence shown in SEQ ID NO: 43 and the amino acid sequence shown in SEQ ID NO: 44. Likewise, the L chain has the DNA sequence shown in SEQ ID NO: 45 and the amino acid sequence shown in SEQ ID NO: 46.

(191) TABLE-US-00011 SEQIDNO:23: ATGGGTTGGAGCCTCATCTTGCTCTTCCTTGTCGCTGTTGCTACGCGTGTCCTGTCCCAGGTCAAAC TGCAGCAGTCTGGACCTGAGCTGGTAAAGCCTGGGGCTTCAGTGAAGATGTCCTGCAAGGCTTCTGG ATACACATTCACTAGCTATGTTATGCACTGGGTGAAGCAGAAGCCTGGGCAGGGCCTTGAGTGGATT GGATATATTAATCCTTACAATGATGGTACTAAGTACAATGAGAAGTTCAAAGGCAAGGCCACACTGA CTTCAGACAAATCCTCCAGCACAGCCTACATGGAGCTCAGCAGCCTGACCTCTGAGGACTCTGCGGT CTATTACTGTGCAAGGAGGAAGGCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGGTCACTGTCTCT GCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGGGCA CAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTCAGG CGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTCAGC AGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACAAGC CCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCCACC GTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGACACC CTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTGAGG TCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGAGCA GTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGCAAG GAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAGCCA AAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCA GGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGCAAT GGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCCTCT ACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCA TGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA SEQIDNO:24: MGWSLILLFLVAVATRVLSQVKLQQSGPELVKPGASVKMSCKASGYTFTSYVMHWVKQKPGQGLEWI GYINPYNDGTKYNEKFKGKATLTSDKSSSTAYMELSSLTSEDSAVYYCARRKAWFAYWGQGTLVTVS AASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS SVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* SEQIDNO:25: ATGAACATGCTCACTCAGCTCCTGGGATTACTGCTGCTCTGGTTTGCAGGTGGTAAATGTGACATTC AGATGACCCAGTCTCCTGCCTCCCAGTCTGCATCTCTGGGAGAAAGTGTCACCATCACATGCCTGGC AAGTCAGACCATTGGTACATGGTTAGCATGGTATCAGCAGAAACCAGGGAAATCTCCTCAGCTCCTG ATTTATGCTGCAACCAGCTTGGCAGATGGGGTCCCATCAAGGTTCAGTGGTAGTGGATCTGGCACAA AATTTTCTTTCAAGATCAGCAGCCTACAGGCTGAAGATTTTGTAAGTTATTACTGTCAACAACTTTA CAGTACTCCTCTGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAACGTACGGTGGCTGCACCATCT GTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGA ATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTC CCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTG AGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGC CCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG SEQIDNO:26: MNMLTQLLGLLLLWFAGGKCDIQMTQSPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLL IYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLYSTPLTFGGGTKLEIKRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* SEQIDNO:27: ATGGGTTGGAGCCTCATCTTGCTCTTCCTTGTCGCTGTTGCTACGCGTGTCCTGTCCCAGGTCAAAC TGCAGCAGTCTGGACCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAAAGTATCCTGCACGGCTTCTGG TTATGCATTCACTCAATACAACTTGTACTGGGTGAAGCTCAGACATGGAAAGTGCCCTAAATGGATC GGATCTATTGATCCTTACATTGGTGGTACCACCTACAACCAGCAATTCAAGGACAAGGTCACATTGA CTGTTGACAAGTCTTCCAGCACGGCCTACTTGCATCTCAACAGCCTGACATCTGAAGACTCTGCAAT CTATTACTGTGCAAGATGGTGGGACGGATATTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTC TCCTCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGG GCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTC AGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTC AGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACA AGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCC ACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGAC ACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTG AGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGA GCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGC AAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAG CCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAA CCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGC AATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCC TCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGAT GCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA SEQIDNO:28: MGWSLILLFLVAVATRVLSQVKLQQSGPELVKPGASVKVSCTASGYAFTQYNLYWVKLRHGKCPKWI GSIDPYIGGTTYNQQFKDKVTLTVDKSSSTAYLHLNSLTSEDSAIYYCARWWDGYFDVWGAGTTVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* SEQIDNO:29: ATGGATTTTCAGGTGCAGATTTTCAGCTTCCTGCTAATCAGTGCCTCAGTCATTTTGTCCAGAGGAC AGATTGTTCTCACCCAGTCTCCAGCAATCATGTCTGCTTCTCTAGGGGAACGGGTCACCTTGACCTG CACTGCCAGCTCAAGTGTAATTTCCAGATACTTGCACTGGTACCAGGTGAAGCCAGGATCCTCCCCC AAACTCTGGATTTATAGCACATCCAACCTGGCTTCTGGAGTCCCAACTCGCTTCAGTGGCAGTGGGT CTGGGACCTCTTACTCTCTCACAATCAGTAACATGGAGGCTGAAGATGCTGCCACTTATTACTGCCA CCAGTATCATCGTTCCCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGACACGTACGGTGGCT GCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGT GCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATC GGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACC CTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCC TGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG SEQIDNO:30: MDFQVQIFSFLLISASVILSRGQIVLTQSPAIMSASLGERVTLTCTASSSVISRYLHWYQVKPGSSP KLWIYSTSNLASGVPTRFSGSGSGTSYSLTISNMEAEDAATYYCHQYHRSPLTFGAGTKLELTRTVA APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* SEQIDNO:31: ATGGGTTGGAGCCTCATCTTGCTCTTCCTTGTCGCTGTTGCTACGCGTGTCCTGTCCCAGATCCAGC TGCAGCAGTCTGGACCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAAAGTCTCCTGCAAGGCTTTTGG TTATGCATTCACTAGACACAATATGTACTGGGTGAAGCAGAGGCATGGAAAGTGCCTTGAGTGGATT GGATATATTGATCCTTTCAATGGTGGTACTAGCTACAACCAGAAGTTCAAGGGCAAGGCCACATTGA CTGTTGACAAGTCCTCCAGCACAGCCTACATGCATCTCAACAGCCTGACATCTGAGGACTCTGCAGT CTATTACTGTGCAAGAGTTTATGGTAACTACGCCTGGTTTGCTTACTGGGGCCAAGGGACTCTGGTC ACTGTCTCTGCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCT CTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTG GAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTAC TCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGA ATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACAC ATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCC AAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAG ACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCG GGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTG AATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCT CCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGAC CAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGG GAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCT TCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTC CGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA SEQIDNO:32: MGWSLILLFLVAVATRVLSQIQLQQSGPELVKPGASVKVSCKAFGYAFTRHNMYWVKQRHGKCLEWI GYIDPFNGGTSYNQKFKGKATLTVDKSSSTAYMHLNSLTSEDSAVYYCARVYGNYAWFAYWGQGTLV TVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKP KDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEW ESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* SEQIDNO:33: ATGGGCATCAAAATGGAGTCACAGATTCAGGTCTTTGTATTCGTGTTTCTCTGGTTGTCTGGTGTTG ACGGAGACATTGTGATGACCCAGTCTCACAAATTCATGTCCACATCAGTAGGAGACAGGGTCAGCAT CACCTGCAAGGCCAGTCAGGATGTGAGTACTGCTGTAGCCTGGTATCAACAGATACCAGGACAATCT CCTAAACTACTGATTTACTCGTCATCCTACCGGTACACTGGAGTCCCTGATCGCTTCACTGGCAGTG GATCTGGGACGGATTTCACTTTCACCATCAGCAGTGTGCAGGCTGAAGACCTGGCAGTTTATTACTG TCAGCAACATTATAATACTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAACGTACGGTG GCTGCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTG TGTGCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCA ATCGGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGC ACCCTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGG GCCTGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG SEQIDNO:34: MGIKMESQIQVFVFVFLWLSGVDGDIVMTQSHKFMSTSVGDRVSITCKASQDVSTAVAWYQQIPGQS PKLLIYSSSYRYTGVPDRFTGSGSGTDFTFTISSVQAEDLAVYYCQQHYNTPWTFGGGTKLEIKRTV AAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSS TLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* SEQIDNO:35: ATGGGTTGGAGCCTCATCTTGCTCTTCCTTGTCGCTGTTGCTACGCGTGTCCTGTCCCAGGTCCAAC TGCAGCAGCCTGGGGCTGAGTTTGTGAAGCCTGGGACTTCAGTGAAGCTGTCCTGCAAGGCTTCTGG CTACAACTTCACCAGGTACTGGATAAACTGGGTGAAGCTGAGGCCTGGACAAGGCCTTGAGTGGATT GGAAATATTTATCCTGCTACTAATGGTATTAACTACAATGAGAAGTTCAAGAGCAAGGCCACACTGA CTGTGGACACATTCTCCAGCACAGCCTACATGCAACTCAGCAGTCTGGCATCTGAGGACTCTGGTCT CTATTACTGTGCAAGATGTAAAACGATGTTGTCACGATGTGCCTGGTTTCCTTACTGGGGCCAAGGG ACTCTGGTCACTGTCTCCGCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCA AGAGCACCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGAC GGTGTCGTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCA GGACTCTACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCT GCAACGTGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAA AACTCACACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCC CCAAAACCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGA GCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGAC AAAGCCGCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAG GACTGGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGA AAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGA TGAGCTGACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCC GTGGAGTGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCG ACGGCTCCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTT CTCATGCTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCG GGTAAATGA SEQIDNO:36: MGWSLILLFLVAVATRVLSQVQLQQPGAEFVKPGTSVKLSCKASGYNFTRYWINWVKLRPGQGLEWI GNIYPATNGINYNEKFKSKATLTVDTFSSTAYMQLSSLASEDSGLYYCARCKTMLSRCAWFPYWGQG TLVTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS GLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFP PKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSP GK* SEQIDNO:37: ATGATGTCCTCTGCTCAGTTCCTTGGTCTCCTGTTGCTCTGTTTTCAAGGTTCCAGATGTGATATCC AAATGACTCAGACTACATCCTCCCTGTCTGCCTCTCTGGGAGACAGAGTCACCATCAATTGCAGGGC AAGTCAGGACATTAGTAATTATTTAAACTGGTATCAGCAGAAACCAGATGGAACTGTTAAACTCCTG ATCTACGACACATCAAGATTACACTCAAGAGTCCCATCAAGGTTCAGTGGCAGTGGGTCTGGAACAG ATTATTCTCTCACCATTAGCAACCTGGAGCAAGAAGATATTGCCACTTACTTTTGCCAACAGGGTAA TATGCTTCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAACGTACGGTGGCTGCACCATCT GTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGA ATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTC CCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTG AGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGC CCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG SEQIDNO:38: MMSSAQFLGLLLLCFQGSRCDIQMTQTTSSLSASLGDRVTINCRASQDISNYLNWYQQKPDGTVKLL IYDTSRLHSRVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNMLPWTFGGGTKLEIKRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* SEQIDNO:39: ATGGGTTGGAGCCTCATCTTGCTCTTCCTTGTCGCTGTTGCTACGCGTGTCCTGTCCGAGGTCCAGC TGCAACAGTCTGGACCTGAGGTGGTGAAGCCTGGACCTTCACTGAGGATGTCCTGCAAGGCCTCTGG TTACTTTTTCACTGGCAATTCTATGAATTGGGTGAAGAAGACCCATGGACGGAGCCTTGAGTGGATT GGACTTATTGATCTTTCCAATGGTGAAACTCGCTTCAATCAGAAGTTCAAGGGCAAGGCCACTTTAA CTGTGGACAAGTCATCCGGCACAGCCTACATGGAACTCCTCAATCTGACATCTGAGGACTCTGCAGT CTATTACTGTGCAAGCAGGTCTGCCATGATTATGCCCTGTTTTTCTCATTGGGGCCAGGGGACTCTG GTCACTGTCTCTGCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCA CCTCTGGGGGCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTC GTGGAACTCAGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTC TACTCCCTCAGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACG TGAATCACAAGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCA CACATGCCCACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAA CCCAAGGACACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACG AAGACCCTGAGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCC GCGGGAGGAGCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGG CTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCA TCTCCAAAGCCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCT GACCAAGAACCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAG TGGGAGAGCAATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCT CCTTCTTCCTCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATG CTCCGTGATGCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAA TGA SEQIDNO:40: MGWSLILLFLVAVATRVLSEVQLQQSGPEVVKPGPSLRMSCKASGYFFTGNSMNWVKKTHGRSLEWI GLIDLSNGETRFNQKFKGKATLTVDKSSGTAYMELLNLTSEDSAVYYCASRSAMIMPCFSHWGQGTL VTVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPK PKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDW LNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* SEQIDNO:41: ATGGAGACACATTCTCAGGTCTTTGTATACATGTTGCTGTGGTTGTCTGGTATTGAAGGAGACATTG TGATGACCCAGTCTCACAACTTCATGTCCACATCAATTGGAGACAGGGTCAACATCACCTGCAAGGC CAGTCAGGATGTGGCTACTGCTGTTGCCTGGTTTCAACAGAAACCAGGTCAATCTCCTAAACTCCTA ATTTACTGGACGTCCACCCGGCACACTGGAGTCCCTGATCGCTTCACAGGCAGTGGATATGGGACAG ATTTCACTCTCACCATTAGCCATGTGCAGTCTGAAGACTTGGCCGATTATTTCTGTCAACAATATGA CACCTATCCGTACACGTTCGGAGGGGGGACCAAGTTGGAGATAAAACGTACGGTGGCTGCACCATCT GTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGTGCCTGCTGA ATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATCGGGTAACTC CCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACCCTGACGCTG AGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCCTGAGCTCGC CCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG SEQIDNO:42: METHSQVFVYMLLWLSGIEGDIVMTQSHNFMSTSIGDRVNITCKASQDVATAVAWFQQKPGQSPKLL IYWTSTRHTGVPDRFTGSGYGTDFTLTISHVQSEDLADYFCQQYDTYPYTFGGGTKLEIKRTVAAPS VFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* SEQIDNO:43: ATGGGTTGGAGCCTCATCTTGCTCTTCCTTGTCGCTGTTGCTACGCGTGTCCTGTCCGAGATCCAAC TGCAGCAGTCTGGACCTGAGGTGGTGAAGCCTGGGACTTCAGTGAGAGTATCCTGCACGGCTTCTGG TTATGCATTCACTCAGTACAACTTGTACTGGGTGAAACTCAGACATGGAAAGTGCCCTAAATGGATC GGATCTATTGATCCTTACATTGGTGGTGCCAACTACAATCAGCAATTCAAGGACAAGGTCACATTGA CTGTTGACAAGTCTTCCAGCACGGCCTACTTACATCTCAACAGCCTGACATCTGAAGACTCTGCAAT CTATTACTGTGCAAGATGGTGGGACGGATATTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTC TCCTCAGCTAGCACCAAGGGCCCATCGGTCTTCCCCCTGGCACCCTCCTCCAAGAGCACCTCTGGGG GCACAGCGGCCCTGGGCTGCCTGGTCAAGGACTACTTCCCCGAACCGGTGACGGTGTCGTGGAACTC AGGCGCCCTGACCAGCGGCGTGCACACCTTCCCGGCTGTCCTACAGTCCTCAGGACTCTACTCCCTC AGCAGCGTGGTGACCGTGCCCTCCAGCAGCTTGGGCACCCAGACCTACATCTGCAACGTGAATCACA AGCCCAGCAACACCAAGGTGGACAAGAAAGTTGAGCCCAAATCTTGTGACAAAACTCACACATGCCC ACCGTGCCCAGCACCTGAACTCCTGGGGGGACCGTCAGTCTTCCTCTTCCCCCCAAAACCCAAGGAC ACCCTCATGATCTCCCGGACCCCTGAGGTCACATGCGTGGTGGTGGACGTGAGCCACGAAGACCCTG AGGTCAAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGAGGA GCAGTACAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACTGGCTGAATGGC AAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCAGCCCCCATCGAGAAAACCATCTCCAAAG CCAAAGGGCAGCCCCGAGAACCACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAA CCAGGTCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCCAGCGACATCGCCGTGGAGTGGGAGAGC AATGGGCAGCCGGAGAACAACTACAAGACCACGCCTCCCGTGCTGGACTCCGACGGCTCCTTCTTCC TCTACAGCAAGCTCACCGTGGACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGAT GCATGAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGGTAAATGA SEQIDNO:44: MGWSLILLFLVAVATRVLSEIQLQQSGPEVVKPGTSVRVSCTASGYAFTQYNLYWVKLRHGKCPKWI GSIDPYIGGANYNQQFKDKVTLTVDKSSSTAYLHLNSLTSEDSAIYYCARWWDGYFDVWGAGTTVTV SSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSL SSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKD TLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* SEQIDNO:45: ATGGATTTTCAGGTGCAGATTTTCAGCTTCCTGCTAATCAGTGCCTCAGTCATTTTGTCCAGAGGAC AAATTGTTCTCACCCAGTCTCCAGCAATCATGTCTGCTTCTCTAGGGGAACGGGTCACCATGACCTG CACTGCCAGTTCAAGTGTAAGTTTCAGATACTTGCACTGGTACCAGGTGAAGCCAGGATCCTCCCCC AAACTCTGGATTTATAGCACATCCAACCTGGCTTCTGGAGTCCCAAGTCGCATCAGTGGCAGTGGGT CTGGGACCTCTTACTTTCTCACAATCAGTAACATGGAGGCTGAAGATGCTGCCACTTATTACTGCCA CCAGTATCATCGCTCCCCGCTCACGTTCGGTGCTGGGACCAAGCTGGAGCTGACACGTACGGTGGCT GCACCATCTGTCTTCATCTTCCCGCCATCTGATGAGCAGTTGAAATCTGGAACTGCCTCTGTTGTGT GCCTGCTGAATAACTTCTATCCCAGAGAGGCCAAAGTACAGTGGAAGGTGGATAACGCCCTCCAATC GGGTAACTCCCAGGAGAGTGTCACAGAGCAGGACAGCAAGGACAGCACCTACAGCCTCAGCAGCACC CTGACGCTGAGCAAAGCAGACTACGAGAAACACAAAGTCTACGCCTGCGAAGTCACCCATCAGGGCC TGAGCTCGCCCGTCACAAAGAGCTTCAACAGGGGAGAGTGTTAG SEQIDNO:46: MDFQVQIFSFLLISASVILSRGQIVLTQSPAIMSASLGERVTMTCTASSSVSFRYLHWYQVKPGSSP KLWIYSTSNLASGVPSRISGSGSGTSYFLTISNMEAEDAATYYCHQYHRSPLTFGAGTKLELTRTVA APSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC*

(192) Tables 3 and 4 below show information about the amino acid sequences of the variable region and CDR1 to CDR3 of the respective human-mouse chimeric antibodies obtained above. Numerals given to the variable region and CDR1 to CDR3 represent corresponding amino acid numbers in the amino acid sequence shown in each SEQ ID NO.

(193) TABLE-US-00012 TABLE 3 Analysis of H chain variable region Clone SEQ ID NO Variable region CDR1 CDR2 CDR3 205 24 21-135 50-54 69-86 118-125 402 28 21-136 50-54 69-86 118-126 419 32 21-138 50-54 69-86 118-128 303 36 21-141 50-54 69-86 118-131 422 40 21-139 50-54 69-86 118-129 430 44 21-136 50-54 69-86 118-126

(194) TABLE-US-00013 TABLE 4 Analysis of L chain variable region Clone SEQ ID NO Variable region CDR1 CDR2 CDR3 205 26 21-127 44-54 70-76 109-116 402 30 23-130 46-57 73-79 112-119 419 34 25-131 48-58 74-80 113-120 303 38 21-127 44-54 70-76 109-116 422 42 21-127 44-54 70-76 109-116 430 46 23-130 46-57 73-79 112-119

(195) Furthermore, a human-mouse chimeric antibody whose H chain and L chain constant regions were humanized was also prepared for the antibody clone 4B9b disclosed in PCT/JP2011/070418.

(196) (2) Expression of Human IgG-Converted Antibodies

(197) In 6-well plates, CHO cells were cultured to reach 90% confluency, and the H chain and L chain expression vectors prepared in (1) were transformed into the CHO cells using Fugene6 (Roche) to cause transient protein expression. Transformation conditions were set in accordance with the manufacturer's recommended protocols. After 24 hours, the medium was replaced with F12 medium (GIBCO) and culture was continued for 4 days. The culture supernatants were collected and centrifuged to remove the cells, followed by collecting the supernatant. Antibody purification was conducted in the same manner as shown in Example 1(7).

(198) Alternatively, the humanized IgG antibodies were expressed in the following manner. For antibody protein expression, an Expii293F Expression system (Life technologies) was used. Using a 125 mL Erlenmeyer flask equipped with a vent cap (Corning), 30 mL of a cell suspension prepared at a density of 210.sup.6 cells/mL was cultured by gyratory culture (125 rpm) at 37 C. under 8% CO.sub.2 for 24 hours.

(199) Then, 81 L of ExpiFectamine 293 reagent was mixed with 1.419 mL of Optimem (GIBCO) and allowed to stand for 5 minutes. To this mixture, plasmids into which genes encoding antibody H and L chains, respectively, had been cloned were each added in an amount of 15 g and allowed to stand at room temperature for 20 minutes.

(200) The 293F cells prepared above were suspended again at a density of 2.910.sup.6 cells/ml in 25.5 mL of the medium and the plasmid solution (3 mL) was added thereto to initiate culture. At 20 hours after the initiation of culture, ExpiFectaine 293 transfection enhancer 1 (150 L) and enhancer 2 (1.5 mL) were added. The cells were cultured for 3 days to collect the culture supernatant.

(201) (3) Purification of Human IgG-Converted Antibodies

(202) For antibody purification, a Protein G sepharose carrier was used in the same manner as shown in Example 1(7), or alternatively, a hydroxyapatite carrier was used for purification.

(203) When using hydroxyapatite for purification, 250 mg of cheramic hydroxyapatite Type II, 20 m (Bio-Rad) was used relative to 12 ml of the culture supernatant cultured in the same manner as shown in Example 7(2). The hydroxyapatite carrier was equilibrated with 10 mM phosphate buffer (10 mM Na.sub.2HPO.sub.4, 10 mM NaH.sub.2PO.sub.4 (pH 6.7)), while 36 mL of 10 mM phosphate buffer was added to 12 mL of the culture supernatant containing antibody proteins. To this diluted culture supernatant, the equilibrated hydroxyapatite carrier was added and stirred for 18 hours at 4 C. The carrier was filled into an Econo-Pac column (Bio-Rad) and washed with 10 volumes of 10 mM phosphate buffer, followed by separation with solutions containing sodium chloride at concentrations of 50, 300, 500, 700, 800, 1000 and 1300 mM, respectively, in 10 mM phosphate buffer. 95% or more of the proteins eluted between 500 mM and 700 mM sodium chloride were found to be antibody proteins.

(204) It should be noted that the 205 antibody was taken as an example and its human-mouse chimeric antibody purified as above was measured for binding activity in the same manner as shown in Example 1(7). In this case, the antibody concentration was set to 10 g/mL. As a secondary antibody, anti-mouse IgG polyclonal antibody-HRP label was used for the 205 antibody and anti-human IgG polyclonal antibody-HRP label was used for its chimeric antibody. As a result, even when the 205 antibody was converted into a human-mouse chimeric antibody, its binding ability to SLC6A6 in HCT15 and HT-29 cells (which are human colorectal cancer cells) was confirmed to be maintained.

Example 8

(205) (1) Transient Expression of SLC6A6 Gene

(206) The expression vector shown in Example 1(2) prepared by integrating the SLC6A6 gene into pEF6 vector was transformed into HCT15, HT-29 and SW480 using FUGENE6 (Roche). Operations were conducted as described in the manufacturer's instructions attached to this kit.

(207) (2) SLC6A6 Overexpression-Induced Changes in Side Population Cells

(208) Stem cells have been isolated using various surface markers, but they have different surface markers depending on their source tissue and are present at low proportion. For these reasons, analysis of stem cells is very difficult. As techniques for their separation and identification, side population (SP) cells have now received attention. Stem cells are high in drug efflux ability and have the property of releasing various substances into the extracellular environment. A technique based on this property of stem cells has been widely used where Hoechst 33342 efflux is used as an indicator for analysis. In this technique, a cell fraction showing weak color development in the staining pattern of Hoechst 33342 is referred to as SP cells. The presence of such SP cells has also been shown for cancer cells, and SP cells have been reported to have significantly higher tumorigenicity than non-SP cells and have now been known as a fraction enriched with cancer stem cells (Cancer Research 2005, 65, p. 6207-6219).

(209) After being transformed in the same manner as shown in Example 8(1) above, the cells were detached on the second day with DISSOCIATION BUFFER (Invitrogen). The cells were stained at 37 C. for 1 hour with a solution prepared to contain 10 g/mL Hoechst 33342 in PBS(), followed by analysis using FACS Canto II and a Violet laser (excitation wavelength: 407 nm). Moreover, to identify an SP fraction, an additional experiment was conducted in which verapamil serving an inhibitor of drug efflux transporters was added at a concentration of 30 g/mL. The results obtained are shown in FIG. 8.

(210) FIG. 8 shows the results indicating that the ratio of SP cells is increased upon transient expression of SLC6A6 (SLC6A6) when compared to the control vector (Mock). Namely, it was indicated that SLC6A6 was directly involved in the increase of the SP fraction enriched with a population of stem cells.

Example 9

(211) (1) SLC6A6 Expression in SP Fraction

(212) SLC6A6 expression was analyzed for the SP fraction and non-SP fraction (i.e., major population (MP) fraction) of SW480 cells, which are human colorectal cancer cells. In the same manner as shown in Example 8(2), the cells were stained with Hoechst 33342 and then stained at 4 C. for 1 hour with 1 g/mL of the 430 antibody purified with Protein G and eluted with an eluent of pH 3.0, and further stained with anti-mouse IgG polyclonal antibody-Alexa Fluor 488 label as a secondary antibody, followed by analysis using FACS Canto II. The results obtained are shown in FIG. 9.

(213) FIG. 9 shows that when SP and MP cells are stained for SLC6A6, the SP cells are more strongly stained with the antibody than the MP cells. Namely, it was indicated that SLC6A6 was expressed at a higher level in the SP cells than in the MP cells. It should be noted that in the absence of the antibody, both SP and MP cells showed no signal shift, thus indicating that the 430 antibody specifically reacted with SLC6A6. Further, in the presence of verapamil, no SP cells were observed, and hence the fraction separated as SP cells was confirmed to be SP cells.

Example 10

(214) Ratio of SP Cells Upon Addition of Taurine

(215) As shown in Example 9 above, SLC6A6 expression is directly involved in the formation of SP cells, which are a population enriched with cancer stem cells. On the other hand, SLC6A6 is reported to be a transporter responsible for transport of taurine (FEBS Letter 1993, 318, p. 139-144). In light of this finding, analysis was conducted to determine whether the ratio of SP cells in a population of cells engineered to overexpress SLC6A6 was changed upon treatment with taurine.

(216) For this analysis, Colo320 cells (which are human colorectal cancer cells) were engineered to overexpress SLC6A6 and cultured for 2 days in a medium supplemented with taurine at a concentration of 0.05 mM, 0.1 mM, 0.5 mM, 1 mM or 5 mM, and then analyzed for SP cells in the same manner as shown in Example 1(3). The results obtained are shown in FIG. 10.

(217) FIG. 10 shows that the number of SP cells is increased in a manner dependent on the added concentration of taurine in both Colo320-Mock (i.e., Colo320 cells transformed with the vector alone) and Colo320-SLC6A6-OEx stably expressing SLC6A6. The action of taurine was significant particularly in Colo320-SLC6A6-OEx, and the ratio thereof was increased about 2.5-fold in the presence of 5 mM taurine when compared to the absence of taurine (0 mM) (i.e., increased from 17.0% to 26.7%). Namely, it was indicated that taurine uptake was increased upon enhancement of SLC6A6 expression, or that SP cells increased in number with increase in the concentration of taurine. Since SP cells are a fraction enriched with cancer stem cells, SLC6A6 was shown to have the potential to be involved in the conversion of cancer cells into stem cells.

Example 11

(218) Analysis of Internalization

(219) (1) HT-29 or SW480 cells were cultured to reach 90% confluency and seeded in Glass Base Dishes. After being cultured for 24 hours, the cells were washed with ice-cold PBS and reacted for 1 hour at 4 C. with the 419, 402 or 430 antibody (10 g/ml) purified at pH 3.0 after expression. The cells were washed with PBS and then cultured at 4 C. or 37 C. for 20 minutes, and then fixed with 10% neutral buffered formalin for 10 minutes. The reacted cells were reacted at room temperature for 30 minutes with 500-fold diluted anti-mouse IgG polyclonal antibody-Alexa Fluor 488 label and then analyzed under a confocal laser scanning microscope (Zeiss). The results obtained are shown in FIG. 11A.

(220) FIG. 11A shows that the cells are stained on their cell membrane when reacted at 4 C., i.e., under conditions where the cells stop their activity and hence their intracellular transport mechanisms do not function, so that internalization does not occur. This result indicates that the antibody is located on the cell membrane. On the other hand, this figure shows that the cell membrane was not stained at 37 C. where internalization was caused. This result indicates that the antibody bound to the cell surface is transferred into the cells through internalization. Since the antibody taken up into the cells is localized in endosomes and lysosomes, strong dot-like signals were observed within the cells.

(221) (2) Analysis was conducted to determine whether the antibody clone 402 human-mouse chimeric antibody prepared in Example 7 above was taken up into cells through internalization after binding onto their cell surface.

(222) HCT116 cells (which are human colorectal cancer cells) or SK-BR3 cells (which are human breast cancer cells) were added at a density of 110.sup.4 cells/well onto glass bottom dishes (MATSUNAMI) and cultured at 37 C. under 5% CO.sub.2 for 16 hours. After removal of the medium, fresh medium cooled on ice was added and the cells were allowed to stand on ice for 20 minutes. After removal of the medium, the 402 human-mouse chimeric antibody purified with Protein G and eluted with an eluent of pH 3.0 was added as a primary antibody after being prepared at a concentration of 20 g/mL in the medium, followed by reaction on ice for 30 minutes. After being washed twice with the medium, the cells were reacted on ice for 30 minutes with anti-human IgG polyclonal antibody-Alexa Fluor 488 label as a secondary antibody. After being washed twice with the medium, the cells were cultured at 37 C. under 5% CO.sub.2 for 0, 15, 30, 60 or 120 minutes and washed twice with PBS(), followed by analysis under a fluorescence microscope (BZ8100, Keyence Corporation, Japan). The results obtained are shown in FIG. 11B.

(223) FIG. 11B shows that the antibody is taken up over time into the cells in HCT116 or SK-BR3. At 0 minutes, i.e., immediately after staining, most of the antibody molecules were bound onto the cell membrane. However, the antibody molecules started to be taken up into the cells after 15 minutes, and most of the antibody molecules were taken up into the cells until 60 minutes. Namely, it was confirmed that the 402 human-mouse chimeric antibody was taken up into the cells after binding to SLC6A6 on the cell surface.

Example 12

(224) Analysis of Internalization Mechanism

(225) Internalization is mediated by cellular endocytosis. Endocytosis is classified into the following major types, i.e., clathrin-dependent endocytosis, caveolae-dependent endocytosis, phagocytosis and pinocytosis, depending on the type and size of substances to be taken up, differences in cellular molecules to be involved, etc.

(226) Membrane proteins such as receptors are often taken up through clathrin-dependent endocytosis, and endocytosis inhibitors are used for their analysis.

(227) Concanavalin A (ConA) serving as an inhibitor of clathrin-dependent endocytosis was used to analyze whether the internalization observed in Example 11 for the 402 human-mouse chimeric antibody was inhibited.

(228) (1) Analysis with Secondary Antibody

(229) To HCT116 cells cultured on glass bottom dishes in the same manner as shown in Example 11(2) above, a medium supplemented with ConA at a concentration of 0.5 mg/mL was added and cultured at 37 C. under 5% CO.sub.2 for 60 minutes. After being washed twice with the medium, the cells were stained with a primary antibody and a secondary antibody in the same manner as shown in Example 13(2), followed by analysis under a fluorescence microscope after 0, 15, 30, 60 or 120 minutes.

(230) FIG. 12 shows that upon pre-treatment with ConA, internalization of the 402 human-mouse chimeric antibody is inhibited during the period observed. The left panel shows time-dependent changes in the absence of ConA, while the right panel shows the results obtained in the presence of ConA. It was indicated that upon pre-treatment with ConA, the antibody remained on the cell surface even during the culture period where the antibody should have been transported into the cells. This confirmed that the 402 human-mouse chimeric antibody bound to SLC6A6 on the cell membrane was taken up into the cells through clathrin-dependent endocytosis.

(231) (2) Analysis with Fluorescently Labeled Antibody

(232) The 402 human-mouse chimeric antibody was labeled using an Alexa Fluor 488 Labeling Kit (Molecular Probe). Two cases were prepared where HCT116 cells were treated with ConA and not treated with ConA, respectively. After being allowed to stand on ice for 20 minutes, the HCT116 cells of each case were reacted on ice for 30 minutes with the Alexa Fluor 488-labeled 402 human-mouse chimeric antibody diluted to 30 g/mL with the medium, and then washed twice with PBS(), followed by analysis under a fluorescence microscope (FIG. 13A).

(233) Analysis was performed on an isotype control (whole human IgG was used as a negative control), cetuximab (Cetuximab), the 402 human-mouse chimeric antibody (Chimeric 402), the 430 human-mouse chimeric antibody (Chimeric 430) and the 4B9b human-mouse chimeric antibody (Chimeric 4B9b), each being labeled with Alexa Fluor 488. These antibodies were analyzed for their internalization by flow cytometry using cells treated in two ways.

(234) For the first way, the following operations were performed. Cells detached from culture dishes were suspended in staining buffer [PBS()-3% fetal bovine serum]. To this cell suspension, protease inhibitors were added (final concentration: 10 g/mL leupeptin, 5 M pepstatin) to prevent antibody molecules from being degraded in lysosomes after being taken up into the cells. Each Alexa Fluor 488-labeled antibody was added to the cell suspension at a final concentration of 30 g/mL and then rotated with a rotator at room temperature for 1 hour. After being further rotated with a rotator at 37 C. for 3 hours, the cells were washed three times with the staining buffer and then measured for fluorescence signals by flow cytometry (FIG. 13B; isotype control, chimeric antibody).

(235) The second way is to confirm that the fluorescence in the cells obtained in the first way arises from the dye conjugated to the antibody taken up into the cells. The cells obtained in the first way were reacted at 4 C. for 1 hour with an antibody binding to Alexa Fluor 488 and thereby quenching its fluorescence (anti-Alexa Fluor 488, rabbit IgG antibody fraction: anti-Alexa Fluor 488 antibody) at a final concentration of 50 g/mL to observe changes in fluorescence intensity (FIG. 13B; surface quench). In this case, fluorescence from the antibody remaining on the cell surface is quench with the anti-Alexa Fluor 488 antibody, whereas fluorescence from the antibody transferred into the cells is not quenched with the anti-Alexa Fluor 488 antibody.

(236) Thus, the difference in the amount of fluorescence from the cells obtained in two ways can be used to determine what proportion of the antibody bound to the cell membrane was taken up into the cells.

(237) FIG. 13A shows that the directly labeled 402 human-mouse chimeric antibody (c402) is taken up into the cells even on ice. When the cells were reacted on ice for 30 minutes without being treated with ConA, fluorescence from Alexa Fluor 488 was mostly observed within the cells. On the other hand, in the case of the cells treated with ConA, fluorescence from Alexa Fluor 488 remained on the cell membrane surface. This confirmed that internalization of the 402 human-mouse chimeric antibody proceeded even on ice (about 1 C.).

(238) In FIG. 13B, internalization was analyzed by being measured by flow cytometry. Signals from the isotype control were reduced to the same level as in the non-stained cells upon addition of the anti-Alexa Fluor 488 antibody (surface quench). This indicates that the fluorescence observed on the cell surface is quenched with the anti-Alexa 488 antibody. Moreover, in the case of cetuximab (Erbitux) which is an anti-EGFR antibody and has been intently studied for its uptake into cancer cells through internalization in a drug-conjugated state, the fluorescence partially disappeared upon reaction with the anti-Alexa Fluor 488 antibody (surface quench). On the other hand, in the 402, 430 and 4B9b mouse-human chimeric antibodies, the fluorescence did not disappear even upon addition of the anti-Alexa Fluor 488 antibody. These results mean that the anti-SLC6A6 monoclonal antibodies of the present invention are internalized into the cells, but are not simply bound to SLC6A6 on the cell surface, and that a larger number of antibody molecules are taken up into the cells than in the case of cetuximab. Further, the 402 and 430 human-mouse chimeric antibodies were more efficiently taken up into the cells than the 4B9b human-mouse chimeric antibody.

(239) In light of these results in this example, the antibody conjugate of the present invention can be expected to exert more potent cytotoxic activity when the antibody is conjugated with a cytotoxic substance (e.g., a toxin or a radioactive substance) instead of a dye. Thus, the antibody conjugate of the present invention and a composition comprising the same are assumed to be more effective as pharmaceutical preparations (e.g., pharmaceutical preparations for cancer treatment).

(240) Moreover, anti-ERBB2 antibody (trastuzumab), which has been extensively analyzed as an internalizing antibody, is not reported to be taken up into cells when reacted on ice. In light of this fact, internalization of the 402 human-mouse chimeric antibody is considered to proceed very efficiently. Namely, it is considered that cancer cells can be killed with the antibody-drug conjugate even at low concentration due to its very high uptake efficiency.

Example 13

(241) (1) Effect of Antibody-Drug Conjugate

(242) Analysis was conducted to determine whether the proliferation of cancer cells was able to be suppressed by means of the antibody's property of being taken up into cells. HT-29 or SW480 cells were reacted for 1 hour at 4 C. with 10 g/mL of the 419 antibody purified at pH 3.0, and then washed with PBS. To this, saporin-labeled anti-mouse IgG polyclonal antibody (ADVANCED TARGETING SYSTEMS) or unlabeled anti-mouse IgG polyclonal antibody was added at a concentration of 10 M and reacted for 30 minutes at 4 C., followed by washing with PBS. Saporin has ribosome-inactivating activity and suppresses cell proliferation only when taken up into cells. After these cells were cultured at 37 C. for 3 days, their proliferation was measured using WST-8 (Roche). The results obtained are shown in FIG. 14A.

(243) In FIG. 14A, black represents cell proliferation in the absence of the saporin-labeled secondary antibody, while gray represents cell proliferation upon addition of the saporin-labeled antibody at a concentration of 10 nM. FIG. 14A shows that cell proliferation is suppressed in both HT-29 and SW480 cases upon addition of the saporin-labeled secondary antibody. Namely, it was indicated that as a result of reaction between the anti-mouse antibody labeled with saporin (which is a ribosome inhibitory toxin) and the mouse monoclonal antibody, these antibodies were taken up into cells to thereby suppress the proliferation of cancer cells.

(244) (2) Effect of the Use of Saporin-Labeled Secondary Antibody

(245) Analysis was conducted to determine whether the proliferation of cancer cells was able to be suppressed by means of the antibody's property of being taken up into cells. HCT116 cells (which are human colorectal cancer cells) were seeded in 96-well plates at a density of 2.510.sup.3 cells/well and cultured at 37 C. under 5% CO.sub.2 for 16 hours. To these HCT116 cells, a mixed solution was added which had been prepared to contain each mouse antibody at a final concentration of 0.1 or 0.3 M and saporin-labeled anti-mouse IgG polyclonal antibody (ADVANCED TARGETING SYSTEMS) at a final concentration of 9 nM. Saporin has ribosome-inactivating activity and suppresses cell proliferation only when taken up into cells. After these cells were cultured at 37 C. under 5% CO.sub.2 for 3 days, their proliferation was measured using a Cell Counting Kit-8 (Dojindo Laboratories, Japan). The results obtained are shown in FIG. 14.

(246) FIG. 14 shows that only when the mouse 402 or 430 antibody was added to HCT116 cells, their proliferation is suppressed in a manner dependent on the antibody concentration. Namely, it was indicated that as a result of reaction between the anti-mouse antibody labeled with saporin (which is a ribosome inhibitory toxin) and the mouse 402 or 430 antibody, these antibodies were taken up into cells to thereby suppress the proliferation of cancer cells. In light of this result, when used as a conjugate with a drug, the 402 or 430 antibody is shown to have high cytotoxic activity and can be expected to have a high antitumor effect when formulated into pharmaceutical preparations.

(247) SEQ ID NO: 1: nucleotide sequence encoding human SLC6A6

(248) SEQ ID NO: 2: amino acid sequence of human SLC6A6

(249) SEQ ID NO: 3: nucleotide sequence encoding an amino acid sequence covering amino acid residues 143 to 216 of human SLC6A6

(250) SEQ ID NO: 4: amino acid sequence covering amino acid residues 143 to 216 of human SLC6A6

(251) SEQ ID NO: 5: primer sequence, Forward

(252) SEQ ID NO: 6: primer sequence, Reverse

(253) SEQ ID NO: 7: primer sequence, Long

(254) SEQ ID NO: 8: primer sequence, Short

(255) SEQ ID NO: 9: primer sequence, mIgG2a_CH1_reverse

(256) SEQ ID NO: 10: primer sequence, mIgkappa_R3

(257) SEQ ID NO: 11: oligo DNA sequence, hHchain

(258) SEQ ID NO: 12: primer sequence, hCg1_F

(259) SEQ ID NO: 13: primer sequence, hCgI_R

(260) SEQ ID NO: 14: primer sequence, Hchain_signal_top

(261) SEQ ID NO: 15: primer sequence, Hchain_signal_bottom

(262) SEQ ID NO: 16: primer sequence, Forward

(263) SEQ ID NO: 17: primer sequence, Reverse

(264) SEQ ID NO: 18: oligo DNA sequence, hLchain

(265) SEQ ID NO: 19: primer sequence, hCk_F

(266) SEQ ID NO: 20: primer sequence, hCk_R

(267) SEQ ID NO: 21: primer sequence, Forward2

(268) SEQ ID NO: 22: primer sequence, Reverse2

(269) SEQ ID NO: 23: nucleotide sequence encoding the heavy chain of human-mouse chimeric 205 antibody

(270) SEQ ID NO: 24: amino acid sequence of the heavy chain of human-mouse chimeric 205 antibody

(271) SEQ ID NO: 25: nucleotide sequence encoding the light chain of human-mouse chimeric 205 antibody

(272) SEQ ID NO: 26: amino acid sequence of the light chain of human-mouse chimeric 205 antibody

(273) SEQ ID NO: 27: nucleotide sequence encoding the heavy chain of human-mouse chimeric 402 antibody

(274) SEQ ID NO: 28: amino acid sequence of the heavy chain of human-mouse chimeric 402 antibody

(275) SEQ ID NO: 29: nucleotide sequence encoding the light chain of human-mouse chimeric 402 antibody

(276) SEQ ID NO: 30: amino acid sequence of the light chain of human-mouse chimeric 402 antibody

(277) SEQ ID NO: 31: nucleotide sequence encoding the heavy chain of human-mouse chimeric 419 antibody

(278) SEQ ID NO: 32: amino acid sequence of the heavy chain of human-mouse chimeric 419 antibody

(279) SEQ ID NO: 33: nucleotide sequence encoding the light chain of human-mouse chimeric 419 antibody

(280) SEQ ID NO: 34: amino acid sequence of the light chain of human-mouse chimeric 419 antibody

(281) SEQ ID NO: 35: nucleotide sequence encoding the heavy chain of human-mouse chimeric 303 antibody

(282) SEQ ID NO: 36: amino acid sequence of the heavy chain of human-mouse chimeric 303 antibody

(283) SEQ ID NO: 37: nucleotide sequence encoding the light chain of human-mouse chimeric 303 antibody

(284) SEQ ID NO: 38: amino acid sequence, of the light chain of human-mouse chimeric 303 antibody

(285) SEQ ID NO: 39: nucleotide sequence encoding the heavy chain of human-mouse chimeric 422 antibody

(286) SEQ ID NO: 40: amino acid sequence of the heavy chain of human-mouse chimeric 422 antibody

(287) SEQ ID NO: 41: nucleotide sequence encoding the light chain of human-mouse chimeric 422 antibody

(288) SEQ ID NO: 42: amino acid sequence of the light chain of human-mouse chimeric 422 antibody

(289) SEQ ID NO: 43: nucleotide sequence encoding the heavy chain of human-mouse chimeric 430 antibody

(290) SEQ ID NO: 44: amino acid sequence of the heavy chain of human-mouse chimeric 430 antibody

(291) SEQ ID NO: 45: nucleotide sequence encoding the light chain of human-mouse chimeric 430 antibody

(292) SEQ ID NO: 46: amino acid sequence of the light chain of human-mouse chimeric 430 antibody

INDUSTRIAL APPLICABILITY

(293) The present invention provides a monoclonal antibody specifically binding to the extracellular region of SLC6A6. Moreover, the present invention provides an antibody conjugate comprising an anti-SLC6A6 monoclonal antibody or an antigen-binding fragment thereof and at least one anticancer agent, toxin or radioisotope linked thereto, as well as a pharmaceutical composition comprising such an antibody conjugate. Since the monoclonal antibody of the present invention specifically binds to cancer cells expressing SLC6A6 and is thereby internalized in these cells, the antibody conjugate and the pharmaceutical composition according to the present invention are useful for cancer treatment, particularly as a pharmaceutical composition for colorectal cancer treatment. The antibody may be humanized or chimeric, and it is therefore possible to reduce side effects upon application to humans.

(294) Sequence Listing Free Text

(295) SEQ ID NOs: 5 to 46: synthetic DNAs