Antibodies for the treatment of synucleinopathies and neuroinflammation
11512125 · 2022-11-29
Assignee
Inventors
Cpc classification
A61P25/14
HUMAN NECESSITIES
International classification
Abstract
Anti-alpha-synuclein antibodies and antigen-binding fragments thereof (e.g., scFvs) are provided. Also provided are methods of using the same in therapy.
Claims
1. An isolated antibody or antigen-binding fragment thereof that binds to soluble monomers, oligomers, and/or preformed fibrils of alpha-synuclein, wherein the antibody or antigen-binding fragment thereof comprises a complementary determining region (CDR) H1 comprising the amino acid sequence set forth in SEQ ID NO:1 (GGSISSHY), a CDR H2 comprising the amino acid sequence set forth in SEQ ID NO:2 (IYDSGST), a CDR H3 comprising the amino acid sequence set forth in SEQ ID NO:3 (ARGAGWYRF), a CDR L1 comprising the amino acid sequence set forth in SEQ ID NO:4 (QSVLYSSNNKNY), a CDR2 L2 comprising the amino acid sequence set forth in SEQ ID NO:5 (WAS), and a CDR3 L3 comprising the amino acid sequence set forth in SEQ ID NO:6 (QQYYSTPRT).
2. The antibody or antigen-binding fragment thereof of claim 1, wherein the antibody or antigen-binding fragment thereof comprises a heavy chain variable region (VH) a light chain variable region (VL), wherein the VH comprises the same amino acid sequence as the VH encoded by the plasmid of ATCC Deposit Designation PTA-125004, and wherein the VL comprises the same amino acid sequence as the VL encoded by the plasmid of ATCC Deposit Designation PTA-125004.
3. An antibody or antigen-binding fragment thereof that binds to soluble monomers, oligomers, and/or preformed fibrils of alpha-synuclein, wherein the antibody or antigen-binding fragment thereof comprises CDR H1, CDR H2, CDR H3, CDR L1, CDR L2, and CDR L3 comprising the CDR H1, CDR H2, CDR H3, CDR L1, CDR L2, and CDR L3 amino acid sequences encoded by the plasmid of ATCC Deposit Designation PTA-125004.
4. An antibody or antigen-binding fragment thereof that binds soluble monomers, oligomers, and/or preformed fibrils of alpha-synuclein, wherein the antibody or antigen-binding fragment thereof comprises CDR H1, CDR H2, CDR H3, CDR L1, CDR L2, and CDR L3 comprising the CDR H1, CDR H2, CDR H3, CDR L1, CDR L2, and CDR L3 amino acid sequences of PMS209, PMS210, PMS211, PMS212, or PMS213, wherein PMS209 comprises a VH comprising the mature form of the amino acid sequence set in SEQ ID NO: 21 and a VL comprising the mature form of the amino acid sequence set forth in SEQ ID NO: 22; wherein PMS210 comprises a VH comprising the mature form of the amino acid sequence set in SEQ ID NO: 25 and a VL comprising the mature form of the amino acid sequence set forth in SEQ ID NO: 26; wherein PMS211 comprises a VH comprising the mature form of the amino acid sequence set in SEQ ID NO: 29 and a VL comprising the mature form of the amino acid sequence set forth in SEQ ID NO: 30; wherein PMS212 comprises a VH comprising the mature form of the amino acid sequence set in SEQ ID NO: 33 and a VL comprising the mature form of the amino acid sequence set forth in SEQ ID NO: 34; and wherein PMS213 comprises a VH comprising the mature form of the amino acid sequence set in SEQ ID NO: 37 and a VL comprising the mature form of the amino acid sequence set forth in SEQ ID NO: 38.
5. The antibody or antigen-binding fragment thereof of claim 4, wherein the antibody or antigen binding fragment thereof comprises a VH and a VL, wherein the VH and VL comprise the mature forms of SEQ ID NOs: 21 and 22, respectively, SEQ ID NOs: 25 and 26, respectively, SEQ ID NOs: 29 and 30, respectively, SEQ ID NOs: 33 and 34, respectively, or SEQ ID NOs: 37 and 38, respectively.
6. The antigen-binding fragment of an antibody of claim 1, wherein said antibody is an antigen-binding fragment of an antibody, wherein the antigen-binding fragment is selected from the group consisting of Fab, F(ab′)2, Fv, scFv, scFv-Fc, and dsFv.
7. The antigen-binding fragment of an antibody of claim 6, wherein said fragment is an scFv.
8. The antibody or antigen-binding fragment thereof of claim 4, wherein the antibody or antigen-binding fragment thereof comprises the amino acid sequence of the mature form of SEQ ID NOs: 42 or 44.
9. The antibody or antigen-binding fragment thereof of claim 1, that inhibits expression and/or secretion of pro-inflammatory cytokines from microglia cells incubated with misfolded alpha synuclein, that inhibits uptake of misfolded alpha synuclein by macrophages, that inhibits T cell activation by misfolded alpha synuclein, that prevents aggregation of alpha-synuclein as determined by Thioflavin T (ThT), that inhibits seeding and spreading of alpha-synuclein, that penetrates neurons, that colocalizes with misfolded alpha synuclein and attenuates and/or that ameliorates a motorical or physiological phenotype in a synucleinopathy mouse model.
10. A composition comprising the antibody or antigen-binding fragment thereof of claim 1 and a carrier, wherein the composition is a diagnostic composition, a therapeutic composition, or a vaccine.
11. A vector comprising a first nucleic acid molecule encoding the heavy chain variable region or heavy chain of the antibody or antigen-binding fragment thereof of claim 1 and a second nucleic acid molecule encoding the light chain variable region or light chain of the antibody or antigen-binding fragment thereof of claim 1.
12. The vector of claim 11, wherein the vector is a viral vector.
13. A host cell comprising the vector of claim 11.
14. A pharmaceutical composition comprising the antibody or antigen-binding fragment thereof of claim 1.
15. A method of producing an alpha-synuclein antibody or antigen-binding fragment thereof, the method comprising: (a) culturing the cell of claim 13 in a cell culture under conditions which allow expression of said an alpha-synuclein antibody or antigen-binding fragment thereof; and (b) recovering the antibody or antigen-binding fragment thereof from said cell culture.
16. An alpha-synuclein antibody or antigen-binding fragment thereof obtainable by the method of claim 15.
17. A method of treating a synucleinopathic disease in a subject, the method comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof of claim 1, thereby treating the synucleinopathic disease.
18. A method of treating neuroinflammation in a subject, the method comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof of claim 1, thereby treating the neuroinflammation.
19. A method of diagnosing a synucleinopathic disease in a subject, comprising: (a) assessing the level, localization, conformation or a combination thereof of misfolded alpha-synuclein in a subject to be diagnosed with the antibody or antigen-binding fragment thereof of claim 1; (b) comparing the level, localization, conformation or combination thereof of misfolded alpha-synuclein in the subject to one or more reference standards derived from one or more control samples, wherein a difference or similarity between the level, localization, conformation or combination thereof of alpha-synuclein in the subject and the reference standard indicates whether the subject has a synucleinopathic disease.
20. A method of detecting misfolded alpha-synuclein, the method comprising: (a) contacting a biological sample with the antibody or antigen-binding fragment thereof of claim 1 under conditions which allow formation of immunocomplexes; and (b) determining the presence and/or level of said immunocomplexes.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWING(S)
(1) Some embodiments of the invention are herein described, by way of example only, with reference to the accompanying drawings. With specific reference now to the drawings in detail, it is stressed that the particulars shown are by way of example and for purposes of illustrative discussion of embodiments of the invention. In this regard, the description taken with the drawings makes apparent to those skilled in the art how embodiments of the invention may be practiced.
(2) In the drawings:
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
DESCRIPTION OF SPECIFIC EMBODIMENTS OF THE INVENTION
(34) The present invention, in some embodiments thereof, relates to antibodies and antigen-binding fragments thereof for the treatment of synucleinopathies and neuroinflammation.
(35) Before explaining at least one embodiment of the invention in detail, it is to be understood that the invention is not necessarily limited in its application to the details set forth in the following description or exemplified by the Examples. The invention is capable of other embodiments or of being practiced or carried out in various ways.
(36) Alpha-synuclein (α-syn) plays a pivotal role in the pathogenesis of Parkinson's Disease (PD) and other synucleinopathies. Two forms of α-syn are believed to promote neurotoxicity, spreading, and neuroinflammation; these are small molecular oligomers and preformed fibrils (PFF).
(37) Whilst conceiving the invention, the present inventors have searched for a biological agent that would target the small molecular oligomers and preformed fibrils of alpha-synuclein and be sufficiently small to facilitate effective entry to the brain without requiring high systemic dosages and avoiding non specific Fc portion-related immune-mediated effects.
(38) Thus, the present inventors have isolated from human phage display libraries of healthy individuals, a panel of Fabs, of which PMS208, was cloned into a single chain Fv. A plasmid encoding PMS208 was deposited with the American Type Culture Collection (ATCC), located at 10801 University Boulevard, Manassas, Va. 20110 on Mar. 14, 2018, under the terms of the Budapest Treaty and has the ATCC® Deposit Designation PTA-125004.
(39) This antibody fragment was selected based on a complex screening that included the following selection criteria: binding to native alpha-synuclein in patients' sera, binding the denatured form of the protein as well as the native form (rendering it superior for both clinic and research), preventing recruitment of the immune system to the damaged area, reduction of neuro-inflammation, prevention of seeding and spreading, prevention of immune cells activation, prevention of alpha-synuclein aggregation (as determined by Thioflavin T (ThT), as well as disintegration of preformed aggregates and efficacy in vivo in animal models.
(40) The Fab was cloned into a smaller scFv format with successful retention of its affinity. Importantly and uniquely, PMS208 binds with high affinity both α-syn oligomers and PFF. PMS208 attenuates toxicity induced by both oligomers and PFF to human and murine neuronal cells and binds avidly to α-syn in brain extracts from PD patients. Importantly, the scFv form of PMS208 down-regulates a panel of pro-inflammatory cytokines produced by microglia after exposure to oligomers and PFF, whereas Fc containing anti-α-syn antibodies up-regulate this same panel of proteins. Intranasal PMS208 administration attenuates motor dysfunction in a number of PD animal models in vivo, demonstrating that relatively low doses of PMS208 are required.
(41) The size of the scFv that still retains the high affinity is one sixth the size of an IgG, which explains its bioavailability and efficacy via the intranasal route (mainly via the olfactory nerve). This delivery mode reduces the need to achieve high systemic levels as is currently attempted with immunotherapy for neurodegenerative diseases.
(42) Thus, according to an aspect of the invention there is provided an isolated antibody comprising an antigen binding domain comprising CDR sequences which are N—C ordered:
(43) TABLE-US-00001 Heavy Chain SEQ ID PMS208 NO: SEQUENCE: CDR1 HC 1 GGSISSHY CDR2 HC 2 IYDSGST CDR3 HC 3 ARGAGWYRF Light Chain SEQ ID PMS208 NO: SEQUENCE: CDR1 LC 4 QSVLYSSNNKNY CDR2 LC 5 WAS CDR3 LC 6 QQYYSTPRT
wherein said antibody is capable of binding to soluble monomers, oligomers, and/or preformed fibrils (PFF) of alpha-synuclein in an affinity that is below 10 nM, as determined by surface plasmon resonance.
(44) According to another aspect of the invention there is provided an isolated antibody comprising an antigen binding domain comprising CDR sequences which are N—C ordered:
(45) TABLE-US-00002 Heavy Chain SEQ ID PMS208 NO: SEQUENCE: CDR1 HC 50 SHYWS CDR2 HC 51 YIYDSGSTNYNPSLKS CDR3 HC 52 GAGWYRF Light Chain SEQ ID PMS208 NO: SEQUENCE: CDR1 LC 53 KSSQSVLYSSNNKNYLA CDR2 LC 54 WASTRES CDR3 LC 55 QQYYSTPRT
wherein said antibody is capable of binding to soluble monomers, oligomers, and/or preformed fibrils (PFF) of alpha-synuclein in an affinity that is below 10 nM, as determined by surface plasmon resonance.
(46) The CDR sequences can be encoded by the following polynucleotide sequences.
(47) TABLE-US-00003 Heavy Chain SEQ PMS208 ID NO: SEQUENCE: CDR1 HC 7 GGCGGCTCTATCAGCAGCCACTAC CDR2 HC 8 ATCTACGACAGCGGCAGCACC CDR3 HC 9 GCTAGAGGCGCCGGA TGGTACAGATTT Light Chain SEQ PMS208 ID NO: SEQUENCE: CDR1 LC 10 CAGAGCGTGCTGTACTCC AGCAACAACAAGAACTAC CDR2 LC 11 TGGGCCAGC CDR3 LC 12 CAGCAGTACTACAGCACC CCTCGGACC
(48) The terms “alpha-synuclein,” “α-synuclein,” “a-synuclein,” “aSyn,” “αSyn,” “a-Syn,” and “α-Syn” are used interchangeably herein. Aliases for alpha-synuclein include, e.g., SNCA, NACP, PARK1, PARK4, PD1, synuclein alpha. These terms include human alpha-synuclein as well as non-human alpha-synuclein. These terms also include soluble monomers, oligomers, and/or preformed fibrils of alpha-synuclein.
(49) As used herein “human alpha-synuclein” refers to the protein product of the SNCA gene with the UniProt identification P37840:
(50) TABLE-US-00004 (SEQ ID NO: 13) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKT KEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSI AAATGFVKKDQLGKNEEGAPQE GILEDMPVDP DNEAYEMPSE EGYQDYEPEA.
(51) Also contemplated herein are non-human forms of the “alpha-synuclein” e.g., mouse alpha-synuclein to which an antibody or antigen-binding fragment thereof according to some embodiments of the invention (e.g., PMS208) can bind rendering it a pan-species antibody antigen-binding fragment that is very useful in research and pre-clinical studies.
(52) The molecular weight of human alpha-synuclein monomers is 14 kDa. Two or more alpha-synuclein monomers can aggregate and form soluble alpha-synuclein protofibrils/oligomers with a wide range of molecular weights. A dominating oligomer typically has a molecular weight of 28 kDa. Higher weight forms, e.g., 2000 kDa, are typically referred to as a preformed protofibril (PFF). The major difference between oligomers and PFF is in the morphology, which is visible under an electron microscope (oligomers are round and small, while PFFs are fibril shaped), and the weight can be determined by size exclusion chromatography and SDS-PAGE analysis (non-reduced or native).
(53) According to a specific embodiment, the oligomer is of the molecular weight of 14-84 kDa, as determined by electron microscopy and/or size exclusion chromatography.
(54) Purified α-syn monomers are available commercially such as from Alexotech, Sweden.
(55) Preparation of higher orders of alpha-synuclein can be done by aldehyde induction for the preparation of oligomers. PFF can be induced by incubating monomers at 37° C. for 7 days at 1000 rpm.
(56) Specifically, purified α-syn monomer (in PBS, pH 7.4) are mixed together with HNE (4-Hydroxynonenal) 20 mg/ml (in DMSO) in a low binding tube (e.g., Protein LoBind Tube 1.5, Eppendorf tubes, Cat no.: 022431081) for a final concentration of 140 μM α-syn and 4200 μM HNE. Samples are incubated at 37° C. for 18 hours (h) and analyzed in SDS-PAGE, silver stain (manufacture protocol). Alpha-Syn adopts an extended conformation oligomeric form (spherical—monomers to hexamers), with dimers being the major species (SDS resistant). Of note, oligomers and PFF can overlap in the size but not in the structure (round vs. fibril)
(57) Each form can be produced by a different reaction (HNE or incubation in 37° C. for 7 days at 1000 rpm), which was verified with electron microscope and SDS-PAGE analysis.
(58) According to a specific embodiment, the antibody or antigen-binding fragment thereof binds the PFF in a higher affinity than to α-synuclein oligomers or even monomers. e.g., 0.67 nM PFF compared to 3.46 nM (˜5 fold) oligomers as determined by SPA.
(59) As used herein, “higher affinity” refers to an affinity which is at least 2-fold (e.g., 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9 and even 10 and above fold) higher (lower K.sub.D).
(60) As used herein “binding” or “binds” refers to an antibody-antigen mode of binding, which is generally, in the case of clinically relevant antibodies or antigen-binding fragments thereof, and in this case in the range of K.sub.D below 10 nM e.g., about 0.5-0.7 nM, e.g., 0.67 nM at the conditions described in the Examples section, as determined by Surface Plasmon Resonance assay (SPR), when binding to PFF, or 2-5 nM, e.g., 3.46 nM, when binding to the oligomers.
(61) The affinity of the antibody or antigen-binding fragment to its antigen is determined by Surface Plasmon Resonance (SPR) using a captured or immobilized antigen. For instance, in one embodiment the antigen is immobilized when the antibody or antigen-binding fragment (e.g., scFv) (table) is tested and in another embodiment the antibody or antigen-binding fragment (e.g., scFv-Fc) is immobilized and the antigen is in the solution.
(62) As used herein the term “K.sub.D” refers to the equilibrium dissociation constant between the antigen binding domain or the antibody or antigen-binding fragment thereof and its respective antigen.
(63) The term “antibody” means an immunoglobulin molecule that recognizes and specifically binds to a target, such as a protein, polypeptide, peptide, carbohydrate, polynucleotide, lipid, or combinations of the foregoing through at least one antigen recognition site within the variable region of the immunoglobulin molecule. As used herein, the term “antibody” encompasses intact polyclonal antibodies, intact monoclonal antibodies, chimeric antibodies, humanized antibodies, human antibodies, fusion proteins comprising an antibody, and any other modified immunoglobulin molecule so long as the antibodies exhibit the desired biological activity. An antibody can be of any the five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, or subclasses (isotypes) thereof (e.g. IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2), based on the identity of their heavy-chain constant domains referred to as alpha, delta, epsilon, gamma, and mu, respectively. The different classes of immunoglobulins have different and well known subunit structures and three-dimensional configurations. Antibodies can be naked or conjugated to other molecules such as toxins, radioisotopes, etc.
(64) The term “antibody fragment” refers to a portion of an intact antibody. An “antigen-binding fragment,” “antigen-binding domain,” or “antigen-binding region,” refers to a portion of an intact antibody that binds to an antigen. An antigen-binding fragment can contain an antigen recognition site of an intact antibody (e.g., complementarity determining regions (CDRs) sufficient to bind antigen). Examples of antigen-binding fragments of antibodies include, but are not limited to Fab, Fab′, F(ab′)2, and Fv fragments, linear antibodies, and single chain antibodies. An antigen-binding fragment of an antibody can be derived from any animal species, such as rodents (e.g., mouse, rat, or hamster) and humans or can be artificially produced.
(65) The terms “alpha-synuclein antibody” and “antibody that binds to alpha-synuclein” refer to an antibody that is capable of binding alpha-synuclein (in soluble monomer, oligomer, and/or preformed fibril forms) with sufficient affinity such that the antibody is useful as a diagnostic and/or therapeutic agent in targeting alpha-synuclein. The extent of binding of an alpha-synuclein antibody to an unrelated, non-alpha-synuclein protein can be less than about 10% of the binding of the antibody to alpha-synuclein as measured, e.g., by a radioimmunoassay (RIA).
(66) In some embodiments, the isotype of an antibody or antigen-binding fragment thereof is selected from IgG1, IgG2, IgG3, and IgG4, more particularly, IgG1 or IgG4. According to a specific embodiment, the isotype is IgG1.
(67) As used herein, the terms “variable region” or “variable domain” are used interchangeably and are common in the art. The variable region typically refers to a portion of an antibody, generally, a portion of a light or heavy chain, typically about the amino-terminal 110 to 120 amino acids or 110 to 125 amino acids in the mature heavy chain and about 90 to 115 amino acids in the mature light chain, which differ in sequence among antibodies and are used in the binding and specificity of a particular antibody for its particular antigen. The variability in sequence is concentrated in those regions called complementarity determining regions (CDRs) while the more highly conserved regions in the variable domain are called framework regions (FR). Without wishing to be bound by any particular mechanism or theory, it is believed that CDRs of the light and heavy chains are primarily responsible for the interaction and specificity of the antibody with antigen. In certain aspects, the variable region is a human variable region.
(68) The terms “VH” and “VH domain” are used interchangeably to refer to the heavy chain variable region of an antibody or antigen-binding fragment thereof.
(69) The terms “VL” and “VL domain” are used interchangeably to refer to the light chain variable region of an antibody or antigen-binding fragment thereof.
(70) As provided herein, the polypeptides of an antibody or antigen-binding fragment thereof (e.g., a VH, VL, heavy chain, light chain, and/or scFv) can be expressed with a leader sequence or signal sequence, which is cleaved during intracellular processing to produce a “mature” polypeptide. The “mature” forms of the polypeptides do not contain the leader or signal sequences. For example, the “mature form” of the polypeptide of SEQ ID NO:21 comprises amino acids 23-274 of SEQ ID NO:21.
(71) As used herein, the terms “complementarity-determining region” or “CDR” are used interchangeably to refer to the antigen binding regions found within the variable region of the heavy and light chain polypeptides. Generally, antibodies or antigen-binding fragments thereof comprise three CDRs in each of the VH (CDR HI or HI; CDR H2 or H2; and CDR H3 or H3) and three in each of the VL (CDR LI or LI; CDR L2 or L2; and CDR L3 or L3).
(72) The identity of the amino acid residues in a particular antibody or antigen-binding fragment thereof that make up a variable region or a CDR can be determined using methods well known in the art and include methods such as sequence variability as defined by Kabat et al. (See, e.g., Kabat et al., 1992, Sequences of Proteins of Immunological Interest, 5th ed., Public Health Service, NIH, Wash. D.C.), location of the structural loop regions as defined by Chothia et al. (see, e.g., Chothia et aL, Nature 342:877-883, 1989), a compromise between Kabat and Chothia using Oxford Molecular's AbM antibody modeling software (now Accelrys®, see, Martin et al, 1989, Proc. Natl Acad Sci USA. 86:9268; and world wide web site www.bioinf-org.uk/abs), available complex crystal structures as defined by the contact definition (see MacCallum et al., J. Mol. Biol. 262:732-745, 1996) and the “conformational definition” (see, e.g., Makabe et al., Journal of Biological Chemistry, 283:1156-1166, 2008; IMGT unique numbering for V-DOMAIN and V-LIKE-DOMAIN; lefranc numbering, Lefranc M.-P. et al., 1997).
(73) As used herein, the “variable regions” and “CDRs” may refer to variable regions and CDRs defined by any approach known in the art, including combinations of approaches.
(74) According to a specific embodiment, the antibody fragment is selected from the group consisting of single chain, F.sub.ab, F.sub.ab′ and F.sub.(ab′)2 fragments, Fv, dsFv, scFvs, diabodies, minibodies, nanobodies, F.sub.ab expression library or single domain molecules such as VH and VL that are capable of binding the antigen as described hereinabove.
(75) According to a specific embodiment, the antibody fragment is an intrabody. The intrabody can comprise an scFv and an intracellular trafficking signal.
(76) Functional antibody fragments comprising whole or essentially whole variable regions of both light and heavy chains some of which are defined as follows:
(77) (i) Fv, defined as a genetically engineered fragment consisting of the variable region of the light chain (VL) and the variable region of the heavy chain (VH) expressed as two chains;
(78) (ii) single chain Fv (“scFv”), a genetically engineered single chain molecule including the variable region of the light chain and the variable region of the heavy chain, linked by a suitable polypeptide linker as a genetically fused single chain molecule.
(79) (iii) disulfide-stabilized Fv (“dsFv”), a genetically engineered antibody including the variable region of the light chain and the variable region of the heavy chain, linked by a genetically engineered disulfide bond.
(80) (iv) Fab, a fragment of an antibody molecule containing a monovalent antigen-binding portion of an antibody molecule which can be obtained by treating whole antibody with the enzyme papain to yield the intact light chain and the Fd fragment of the heavy chain which consists of the variable and CH1 domains thereof;
(81) (v) Fab′, a fragment of an antibody molecule containing a monovalent antigen-binding portion of an antibody molecule which can be obtained by treating whole antibody with the enzyme pepsin, followed by reduction (two Fab′ fragments are obtained per antibody molecule);
(82) (vi) F(ab′)2, a fragment of an antibody molecule containing a monovalent antigen-binding portion of an antibody molecule which can be obtained by treating whole antibody with the enzyme pepsin (i.e., a dimer of Fab′ fragments held together by two disulfide bonds); and
(83) (vii) Single domain antibodies or nanobodies are composed of a single VH or VL domains which exhibit sufficient affinity to the antigen.
(84) According to a specific embodiment, the antibody fragment is devoid of an Fc, which as shown in the Examples section attenuates (scFv) microglia cellular uptake of PFF (
(85) According to a specific embodiment, the antibody fragment is a single chain Fv (scFv).
(86) According to a specific embodiment, the scFv comprises the amino acid sequence of the mature form of SEQ ID NO:42 or 44.
(87) According to a specific embodiment, the scFv comprises the scFv amino acid sequence encoded by the plasmid of ATCC Deposit Designation PTA-125004.
(88) According to a specific embodiment, an antibody or antigen-binding fragment thereof (e.g., an scFv) comprises six CDRs comprising the same amino acid sequences as the six CDRs encoded by the plasmid of ATCC Deposit Designation PTA-125004.
(89) According to a specific embodiment, an antibody or antigen-binding fragment thereof (e.g., an scFv) comprises a VH comprising the same amino acid sequence as the VH encoded by the plasmid of ATCC Deposit Designation PTA-125004. According to a specific embodiment, an antibody or antigen-binding fragment thereof (e.g., an scFv) comprises a VL comprising the same amino acid sequence as the VL encoded by the plasmid of ATCC Deposit Designation PTA-125004. According to a specific embodiment, an antibody or antigen-binding fragment thereof (e.g., an scFv) comprises a VH comprising the same amino acid sequence as the VH encoded by the plasmid of ATCC Deposit Designation PTA-125004 and a VL comprising the same amino acid sequence as the VL encoded by the plasmid of ATCC Deposit Designation PTA-125004.
(90) According to a specific embodiment, the antibody fragment is a Fab.
(91) Methods of producing polyclonal and monoclonal antibodies as well as fragments thereof are well known in the art (See for example, Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory, New York, 1988, incorporated herein by reference).
(92) Antibody fragments according to some embodiments of the invention can be prepared by proteolytic hydrolysis of the antibody or by expression in E. coli or mammalian cells (e.g. Chinese hamster ovary cell culture or other protein expression systems) of DNA encoding the fragment. Antibody fragments can be obtained by pepsin or papain digestion of whole antibodies by conventional methods. For example, antibody fragments can be produced by enzymatic cleavage of antibodies with pepsin to provide a 5S fragment denoted F(ab′)2. This fragment can be further cleaved using a thiol reducing agent, and optionally a blocking group for the sulfhydryl groups resulting from cleavage of disulfide linkages, to produce 3.5S Fab′ monovalent fragments. Alternatively, an enzymatic cleavage using pepsin produces two monovalent Fab′ fragments and an Fc fragment directly. These methods are described, for example, by Goldenberg, U.S. Pat. Nos. 4,036,945 and 4,331,647, and references contained therein, which patents are hereby incorporated by reference in their entirety. See also Porter, R. R., Biochem. J. 73: 119-126 (1959). Other methods of cleaving antibodies, such as separation of heavy chains to form monovalent light-heavy chain fragments, further cleavage of fragments, or other enzymatic, chemical, or genetic techniques may also be used, so long as the fragments bind to the antigen that is recognized by the intact antibody.
(93) Fv fragments comprise an association of VH and VL chains. This association may be noncovalent, as described in Inbar et al., Proc. Nat'l Acad. Sci. USA 69:2659-62 (19720). Alternatively, the variable chains can be linked by an intermolecular disulfide bond or cross-linked by chemicals such as glutaraldehyde. Preferably, the Fv fragments comprise VH and VL chains connected by a peptide linker. These single-chain antigen binding proteins (sFv) are prepared by constructing a structural gene comprising DNA sequences encoding the VH and VL domains connected by an oligonucleotide. The structural gene is inserted into an expression vector, which is subsequently introduced into a host cell such as E. coli. The recombinant host cells synthesize a single polypeptide chain with a linker peptide bridging the two V domains. Methods for producing sFvs are described, for example, by Whitlow and Filpula, Methods 2: 97-105 (1991); Bird et al., Science 242:423-426 (1988); Pack et al., Bio/Technology 11:1271-77 (1993); and U.S. Pat. No. 4,946,778, each of which is hereby incorporated by reference in its entirety.
(94) According to a specific embodiment, the antibody fragment is isolated from a library, e.g., a human library and hence no need for further humanization for therapeutic uses as further described herein below.
(95) According to a specific embodiment, the antibody is a fully human antibody.
(96) Humanized forms of non-human (e.g., murine) antibodies are chimeric molecules of immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab′, F(ab′).sub.2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues form a complementary determining region (CDR) of the recipient are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992)).
(97) Methods for humanizing non-human antibodies are well known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting rodent CDRs or other CDR sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
(98) Human antibodies can also be produced using various techniques known in the art, including phage display libraries (Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); and Marks et al., J. Mol. Biol., 222:581 (1991); see also the Examples section). The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985) and Boerner et al., J. Immunol., 147(1):86-95 (1991)). Similarly, human antibodies can be made by introduction of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications: Marks et al., Bio/Technology 10: 779-783 (1992); Lonberg et al., Nature 368: 856-859 (1994); Morrison, Nature 368 812-13 (1994); Fishwild et al., Nature Biotechnology 14, 845-51 (1996); Neuberger, Nature Biotechnology 14: 826 (1996); and Lonberg and Huszar, Intern. Rev. Immunol. 13, 65-93 (1995).
(99) According to a specific embodiment, the antibody or an antigen-binding fragment thereof is an isolated antibody or antigen-binding fragment, i.e., not part of a library, or isolated from the physiological environment e.g., the human body.
(100) An antibody or antigen-binding fragment according to some embodiments of the invention is produced by recombinant DNA technology.
(101) Thus, according to an aspect of the invention there is also provided an isolated polynucleotide comprising a nucleic acid sequence encoding the antibodies or antigen-binding fragments thereof as described herein (e.g., PMS208).
(102) According to a specific embodiment, the nucleic acid sequences encoding the CDRs are as set forth in SEQ ID NOs:7-12. Such CDRs can be cloned into suitable antibody or antigen-binding fragment configurations, while the encoded proteins (i.e., antibodies or antigen-binding fragments thereof) maintain their functions as described herein.
(103) According to a specific embodiment, the nucleic acid sequences encoding the antibody or antigen-binding fragment thereof e.g., PMS208 (SEQ ID NOs:1-6) are as set forth in SEQ ID NOs:7-12.
(104) According to a specific embodiment, the nucleic acid sequences encoding the CDRs encode CDRs with the same amino acid sequences as the CDRs encoded by the plasmid of ATCC Deposit Designation PTA-125004.
(105) According to a specific embodiment, the nucleic acid sequences encoding the CDRs comprise the CDR-encoding nucleic acid sequences of the plasmid of ATCC Deposit Designation PTA-125004.
(106) According to a specific embodiment, a nucleic acid sequence encoding a VH encodes a VH with the same amino acid sequence as the VH encoded by the plasmid of ATCC Deposit Designation PTA-125004. According to a specific embodiment, a nucleic acid sequence encoding a VL encodes a VL with the same amino acid sequence as the VL encoded by the plasmid of ATCC Deposit Designation PTA-125004. According to a specific embodiment, a nucleic acid sequence encoding a VH and a VL encodes a VH with the same amino acid sequence as the VH encoded by the plasmid of ATCC Deposit Designation PTA-125004 and a VL with the same amino acid sequence as the VL encoded by the plasmid of ATCC Deposit Designation PTA-125004.
(107) According to a specific embodiment, a nucleic acid sequence encoding a VH comprises the VH-encoding nucleic acid sequence of the plasmid of ATCC Deposit Designation PTA-125004. According to a specific embodiment, a nucleic acid sequence encoding a VL comprises the VL-encoding nucleic acid sequence of the plasmid of ATCC Deposit Designation PTA-125004. According to a specific embodiment, a nucleic acid sequence encoding a VH and VL comprises the VH-encoding nucleic acid sequence of the plasmid of ATCC Deposit Designation PTA-125004 and the VL-encoding nucleic acid sequence of the plasmid of ATCC Deposit Designation PTA-125004.
(108) According to a specific embodiment, a nucleic acid encoding an scFv comprises the scFv-encoding nucleic acid sequence of the plasmid of ATCC Deposit Designation PTA-125004.
(109) Also provided is an expression vector, comprising the polynucleotide operably linked to a cis-acting regulatory element.
(110) The nucleic acid construct (also referred to herein as an “expression vector”) of some embodiments of the invention includes additional sequences which render this vector suitable for replication and integration in prokaryotes, eukaryotes, or preferably both (e.g., shuttle vectors). In addition, typical cloning vectors may also contain a transcription and translation initiation sequence, transcription and translation terminator, and a polyadenylation signal. By way of example, such constructs will typically include a 5′ LTR, a tRNA binding site, a packaging signal, an origin of second-strand DNA synthesis, and a 3′ LTR or a portion thereof.
(111) The nucleic acid construct of some embodiments of the invention typically includes a signal sequence for secretion or presentation of antibody or antigen-binding fragment thereof from a host cell in which it is placed. Preferably the signal sequence for this purpose is a mammalian signal sequence. The signal sequence can be cleaved to form a mature protein.
(112) In some aspects, a vector provided herein can contain a promoter (e.g., eukaryotic promoter), an enhancer, and/or a polyadenylation site.
(113) The vector may or may not include a eukaryotic replicon. If a eukaryotic replicon is present, then the vector is amplifiable in eukaryotic cells using the appropriate selectable marker. If the vector does not comprise a eukaryotic replicon, no episomal amplification is possible. Instead, the recombinant DNA integrates into the genome of the engineered cell, where the promoter directs expression of the desired nucleic acid.
(114) According to an aspect of the invention there is provided a method of producing an alpha-synuclein antibody or antigen-binding fragment thereof, the method comprising:
(115) (a) culturing a host cell comprising a nucleic acid construct or a polynucleotide as described herein in a cell culture under conditions which allow expression of an alpha-synuclein antibody or antigen-binding fragment thereof, and
(116) (b) recovering the antibody or antigen-binding fragment thereof from said cell culture.
(117) Also provided is an anti-alpha-synuclein antibody or antigen-binding fragment thereof obtainable by the method, optionally wherein the antibody or antigen-binding fragment thereof has biological activities of some embodiments described herein.
(118) Also provided are cells which comprise the polynucleotides/expression vectors as described herein.
(119) Suitable host cells for cloning or expression of antibody-encoding vectors include prokaryotic or eukaryotic cells described herein. For example, antibodies or antigen-binding fragments thereof may be produced in bacteria, in particular when glycosylation and Fc effector function are not needed. See also Charlton, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 245-254, describing expression of antibody fragments in E. coli. After expression, the antibody or antigen-binding fragment thereof may be isolated from the bacterial cell paste in a soluble fraction and can be further purified.
(120) In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody or antigen-binding fragment-encoding vectors, including fungi and yeast strains whose glycosylation pathways have been “humanized,” resulting in the production of an antibody or antigen-binding fragment thereof with a partially or fully human glycosylation pattern. See Gerngross, Nat. Biotech. 22:1409-1414 (2004), and Li et al., Nat. Biotech. 24:210-215 (2006).
(121) Suitable host cells for the expression of glycosylated antibody or antigen-binding fragment thereof are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains have been identified which may be used in conjunction with insect cells, particularly for transfection of Spodoptera frugiperda cells.
(122) Plant cell cultures can also be utilized as hosts. See, e.g., U.S. Pat. Nos. 5,959,177, 6,040,498, 6,420,548, 7,125,978, and 6,417,429 (describing PLANTIBODIES™ technology for producing antibodies or antigen-binding fragments thereof in transgenic plants).
(123) Vertebrate cells may also be used as hosts. For example, mammalian cell lines that are adapted to grow in suspension may be useful. Other examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7); human embryonic kidney line (293 or 293 cells as described, e.g., in Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK); mouse sertoli cells (TM4 cells as described, e.g., in Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CV1); African green monkey kidney cells (VERO-76); human cervical carcinoma cells (HELA); canine kidney cells (MDCK); buffalo rat liver cells (BRL 3A); human lung cells (W138); human liver cells (Hep G2); mouse mammary tumor (MMT 060562); TRI cells, as described, e.g., in Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982); MRC 5 cells; and FS4 cells. Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR.sup.− CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); and myeloma cell lines such as Y0, NS0, and Sp2/0. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J.), pp. 255-268 (2003).
(124) The antibody or antigen-binding fragment thereof (e.g., scFv) can be isolated from the host cell or conditioned medium using methods which are well known in the art.
(125) In accordance with the methods and techniques described, the antibodies or antigen-binding fragments thereof (e.g., scFvs) described herein may be screened, selected or evaluated for their biological activity and optionally therapeutic potential in cell culture models and/or transgenic animal models for alpha-synuclein pathology.
(126) According to a specific embodiment, the antibody or antigen-binding fragment thereof (e.g., scFv) is capable of inhibiting expression and secretion of pro-inflammatory cytokines from microglia cells incubated with PFF.
(127) As used herein a “pro-inflammatory cytokine” refers to a type of signaling molecule (a cytokine) that is excreted from immune cells like helper T cells (Th) and macrophages, and certain other cell types that promote inflammation. They include interleukin-1 (IL-1), IL-5, IL-12, and IL-18, tumor necrosis factor (TNF), interferon gamma (IFN-gamma), and granulocyte-macrophage colony stimulating factor and play an important role in mediating the innate immune response. Inflammatory cytokines are predominately produced by and involved in the upregulation of inflammatory reactions. Dysregulation of pro-inflammatory and anti-inflammatory cytokines has also been linked to depression and other neurological diseases. A balance between proinflammatory and anti-inflammatory cytokines is necessary to maintain health.
(128) Pro-inflammatory cytokines and neuroinflammation are important not only in inflammatory responses but also in neurogenesis and neuroprotection. Sustained stress and the subsequent release of pro-inflammatory cytokines lead to chronic neuroinflammation, which contributes to a variety of medical conditions including but not limited to schizophrenia, depression and other medical conditions that are described herein below (under “Neuroinflammation”). Hippocampal glucocorticoid receptors (GRs) and the associated hypothalamus-pituitary-adrenal (HPA) axis have close interactions with pro-inflammatory cytokines and neuroinflammation. Elevated pro-inflammatory cytokine levels and GR functional resistance create a vicious cycle. In brief, chronic neuroinflammation inhibits GR function, which in turn exacerbates pro-inflammatory cytokine activity and aggravates chronic neuroinflammation. On the other hand, neuroinflammation causes an imbalance between oxidative stress and the anti-oxidant system, which is also associated with a variety of medical conditions.
(129) Alzheimer's disease (AD) is a progressive neurodegenerative disorder of the brain, which is characterized by the formation of extracellular amyloid plaques (or senile plaques) and intracellular neurofibrillary tangles. However, increasing evidences demonstrated that neuroinflammatory changes, including chronic microgliosis are key pathological components of AD. Microglia, the resident immune cells of the brain, constantly survey the microenvironment under physiological conditions. In AD, deposition of β-amyliod (Aβ) peptide initiates a spectrum of cerebral neuroinflammation mediated by activating microglia. Activated microglia may play a potentially detrimental role by eliciting the expression of pro-inflammatory cytokines such as interleukin (IL)-1β, IL-6, and tumor necrosis factor-α (TNF-α; TNFα) influencing the surrounding brain tissue. Emerging studies have demonstrated that up-regulation of pro-inflammatory cytokines play multiple roles in both neurodegeneration and neuroprotection.
(130) The Examples section which follows describes an embodiment for analyzing the effect of an antibody or antigen-binding fragment thereof (e.g., scFv) on secretion of pro-inflammatory cytokines from microglia cells incubated with PFF, e.g., and Interferon-7 (IFNγ) or interleukin-5 (IL-5) responses are measured by colour enzyme-linked immunospot (ELISPOT) assay, enabling quantification of responsive T cells.
(131) Briefly, pro-inflammatory cytokines can be measured in vitro (Example 7 and Example 10) at the RNA or protein level and optionally or alternatively evaluated functionally in vivo in a relevant animal model (see e.g., Example 9).
(132) As used herein “inhibiting” refers to at least 10%, 20%, 30%, 40%, 50%, 60, 70%, 80%, 90% or complete inhibition in a biological function (e.g., in pro-inflammatory cytokines expression (e.g., mRNA) or secretion), as compared to a cell (e.g., microglia cell or a blood cell (e.g., PBMC)) untreated with the antibody or antigen-binding fragment thereof (e.g., scFv). Generally, analysis or protein expression can be done at the RNA or protein level. Examples include, but are not limited to, RT-PCR, chromatography, electrophoretic methods, and immunodetection assays such as ELISA, Western blot analysis, and immunohistochemistry.
(133) According to a specific embodiment, inhibition of neuroinflammation is manifested by attenuating secretion of TNFα, IL6, IFN-gamma by microglia and PBMC and/or by reducing uptake of PFF to microglia and PBMC.
(134) According to a specific embodiment, inhibition of neuroinflammation is manifested by tuning down the autoimmune response of T cells to oligomers/PFF as evidenced by IL-5 and IFNg by e.g., Elispot.
(135) According to a specific embodiment, the antibody or antigen-binding fragment thereof (e.g., scFv) is capable of inhibiting uptake of PFF by macrophages or PBMC.
(136) This can be analyzed as described in the Materials and Methods section of the Examples section which follows under “Uptake of alpha-synuclein fibrils and oligomers in cells” using FACS for detecting uptake indicated as relative geomean fluorescence intensity (gMFI).
(137) According to a specific embodiment, the antibody or antigen-binding fragment thereof (e.g., scFv) is capable of inhibiting alpha-synuclein oligo/PFF-specific helper T cell activation by PFF. As shown in the Examples section which follows, IFNγ was used as a representative cytokine to detect CD4+T helper 1 (Th1) class II T cells, and IL-5 as a representative cytokine secreted by CD4+T helper 2 (Th2) class II T cells.
(138) According to a specific embodiment the antibody or antigen-binding fragment thereof (e.g., scFv) is capable of inhibiting seeding and spreading of alpha-synuclein.
(139) The aggregation of α-synuclein presumably starts with a conformational shift of the monomeric protein, followed by the step-wise formation of larger multimeric protein species comprising toxic soluble oligomers and preformed fibrils (PFF). These forms are potential drivers of seeding of (aggregated forms which are taken up by neuronal cells and catalyze the conversion of alpha-synuclein soluble protein molecules into their aggregated forms) and subsequent propagation culminating in widespread Lewy body pathology.
(140) A seeding and spreading assay is described under the Materials and Methods section of the Examples section which follows under the header “Spreading and seeding determination of human PFF in vitro.”
(141) According to a specific embodiment, the antibody or antigen-binding fragment thereof (e.g., scFv) is capable of preventing aggregation of alpha-synuclein as determined by Thioflavin T (ThT).
(142) The ability to prevent aggregation of monomeric protein or oligomers to high order aggregates (PFF) renders the antibody or antigen-binding fragment thereof (e.g., scFv) specifically applicable for both prevention and/or treatment at early and late stages of the disease (i.e., synucleinopathy) when different forms are evident.
(143) According to a specific embodiment of the invention, the antibody or antigen-binding fragment thereof (e.g., scFv) is capable of ameliorating a motorical or physiological phenotype in a synucleinopathy mouse model. Relevant disease models include, but are not limited to, the mouse synuclein PFF induced Parkinson's disease, Adeno Associated Virus (AAV) transduced rats expressing human synuclein induced Parkinson's disease and Rotenone induced Parkinson's disease.
(144) The clinical parameters include, but are not limited to, motoric functions: e.g., neuromuscular strength, forelimb asymmetry assessment, motor coordination and balance; behavioral functions e.g., exploratory behavior e.g., rearing; physiological parameters: e.g., body weight; and cognitive parameters: e.g., novel object recognition.
(145) According to a specific embodiment, the antibody or antigen-binding fragment thereof (e.g., scFv) is conjugated to an agent selected from the group consisting of a therapeutic agent, a prodrug, a peptide, a protein, an enzyme, a virus, a lipid, a biological response modifier, a pharmaceutical agent, and PEG, e.g., by the covalent attachment of any type of molecule to the antibody or antigen-binding fragment thereof (e.g., scFv) such that covalent attachment does not prevent the antibody or antigen-binding fragment thereof (e.g., scFv) from specifically binding to its cognate epitope. For example, but not by way of limitation, antibodies and antigen-binding fragments thereof (e.g., scFv) can be modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications can be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative can contain one or more non-classical amino acids. Methods of conjugation are further described herein below.
(146) The ability of the antibodies or antigen-binding fragments thereof (e.g., scFvs) of some embodiments of the invention to bind the pathological forms of the alpha-synuclein (i.e., oligomers and PFF) with higher affinity than to the monomeric form, renders it particularly useful for detection of these forms and diagnosis of synucleinopathies.
(147) Thus, according to an aspect of the invention there is provided a method of detecting alpha-synuclein, the method comprising:
(148) (a) contacting a biological sample with the antibody or antigen-binding fragment thereof (e.g., scFv) as described herein under conditions which allow formation of immunocomplexes; and
(149) (b) determining presence and/or level of said immunocomplexes.
(150) For the purpose of detection of alpha-synuclein oligomers/PFF or diagnosis of synucleinopathies, the antibody or antigen-binding fragment thereof (e.g., scFv) can be bound to a detectable moiety or another antibody or antigen-binding fragment thereof or a secondary antibody or antigen-binding fragment thereof can be used dependent on the immunoassay that is being implemented e.g., ELISA, sandwich ELISA, immunohistochemistry e.g., on sections and more as the skilled artisan sees fit.
(151) The term “detecting”, as used herein, refers to the act of detecting, perceiving, uncovering, exposing, visualizing or identifying an aggregation state of alpha-synuclein. The precise method of detecting is dependent on the detectable moiety (also referred to herein as identifiable moiety) to which the antibody or antigen-binding fragment thereof (e.g., scFv) is attached.
(152) The above-mentioned detection method can be harnessed to the diagnosis of synucleinopathies.
(153) As used herein the term “diagnosing” refers to classifying a disease, determining a severity of a disease (grade or stage), monitoring progression, forecasting an outcome of the disease and/or prospects of recovery.
(154) The subject may be a healthy subject (e.g., human) undergoing a routine well-being check up. Alternatively, the subject may be at risk of the disease. Alternatively, the method can be used to monitor treatment efficacy.
(155) As mentioned, the method of the present invention is effected under conditions sufficient to form an immunocomplex (e.g. a complex between the antibodies or antigen-binding fragments (e.g., scFvs) of the present invention and the alpha-synuclein oligomers/PFF); such conditions (e.g., appropriate concentrations, buffers, temperatures, reaction times) as well as methods to optimize such conditions are known to those skilled in the art, and examples are disclosed herein.
(156) Accordingly there is provided a method of diagnosing a synucleinopathic disease in a subject, comprising:
(157) (a) assessing the level, localization, conformation or a combination thereof of alpha-synuclein in a subject to be diagnosed with the antibody or antigen-binding fragment thereof (e.g., scFv) as described herein, optionally attached to a detectable moiety;
(158) (b) comparing the level, localization, conformation or combination thereof of alpha-synuclein in the subject to one or more reference standards derived from one or more control samples,
(159) wherein a difference or similarity between the level, localization, conformation or combination thereof of α-synuclein in the subject and the reference standard indicates whether the subject has a synucleinopathic disease.
(160) The detection/diagnosis can be effected in-vitro on a biological sample.
(161) Alternatively, detection/diagnosis can be effected in-vivo.
(162) Examples of biological samples that can be used in accordance with the present teachings include, but are not limited to, blood, serum, plasma, CSF, brain tissue from biopsies/urine and sputum).
(163) The selection of the detection method will much depend on the detectable moiety.
(164) Thus, determining a presence or level of the immunocomplex of the present invention is dependent on the detectable moiety to which the antibody or antigen-binding fragment thereof (e.g., scFv) is attached.
(165) Examples of detectable moieties that can be used in the present invention include but are not limited to radioactive isotopes, phosphorescent chemicals, chemiluminescent chemicals, fluorescent chemicals, enzymes, fluorescent polypeptides and epitope tags. The detectable moiety can be a member of a binding pair, which is identifiable via its interaction with an additional member of the binding pair, and a label which is directly visualized. In one example, the member of the binding pair is an antigen which is identified by a corresponding labeled antibody. In one example, the label is a fluorescent protein or an enzyme producing a colorimetric reaction.
(166) Further examples of detectable moieties, include those detectable by Positron Emission Tomagraphy (PET) and Magnetic Resonance Imaging (MRI), all of which are well known to those of skill in the art.
(167) When the detectable moiety is a polypeptide, the immunolabel (i.e. the antibody or antigen-binding fragment thereof (e.g., scFv) conjugated to the detectable moiety) can be produced by recombinant means or may be chemically synthesized by, for example, the stepwise addition of one or more amino acid residues in defined order using solid phase peptide synthetic techniques. Examples of polypeptide detectable moieties that can be linked to the antibodies of the present invention using recombinant DNA technology (in which the polynucleotide encoding the antibody is translationally fused to the detectable moiety) include fluorescent polypeptides, phosphorescent polypeptides, enzymes and epitope tags.
(168) Alternatively, chemical attachment of a detectable moiety to the antibodies or antigen-binding fragments thereof (e.g., scFvs) provided herein can be effected using any suitable chemical linkage, direct or indirect, as via a peptide bond (when the detectable moiety is a polypeptide), or via covalent bonding to an intervening linker element, such as a linker peptide or other chemical moiety, such as an organic polymer. Such chimeric peptides can be linked via bonding at the carboxy (C) or amino (N) termini of the peptides, or via bonding to internal chemical groups such as straight, branched or cyclic side chains, internal carbon or nitrogen atoms, and the like. Such modified peptides can be easily identified and prepared by one of ordinary skill in the art, using well known methods of peptide synthesis and/or covalent linkage of peptides. Description of fluorescent labeling of antibodies is provided in details in U.S. Pat. Nos. 3,940,475, 4,289,747, and 4,376,110.
(169) Thus, the conjugates described herein can be prepared by known methods of linking antibodies with lipids, carbohydrates, protein, toxins, drugs or other atoms and molecules. In some embodiments, the conjugate is formed by site-specific conjugation using a suitable linkage or bond. Site-specific conjugation is more likely to preserve the binding activity of the antibody or antigen-binding fragment thereof (e.g., scFv). The substance can be conjugate or attached at the hinge region of a reduced antigen binding construct via thioether bond formation. In some embodiments, tyrosine conjugation can be employed. Other linkages or bonds used to form the conjugate can include, but are not limited to, a covalent bond, a non-covalent bond, a disulfide linkage, a hydrazone linkage, an ester linkage, an amido linkage, and amino linkage, an imino linkage, a thiosemicarbazone linkage, a semicarbazone linkage, an oxime linkage and a carbon-carbon linkage. In some embodiments, no cysteine or other linking aspect, need be included in antibody (Bioconjugate Techniques (Third Edition) Author(s): Greg T. Hermanson ISBN: 978-0-12-382239-0).
(170) Exemplary methods for conjugating moieties are described in WO2017/027325 and U.S. Pat. No. 9,078,931, each of which is hereby incorporated by reference in its entirety.
(171) The level, localization, and/or conformation of alpha-synuclein can be assessed by any suitable method known in the art comprising, e.g., analyzing alpha-synuclein by one or more techniques chosen from Western blot, immunoprecipitation, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), fluorescent activated cell sorting (FACS), two-dimensional gel electrophoresis, mass spectroscopy (MS), matrix-assisted laser desorption/ionization-time of flight-MS (MALDI-TOF), surface-enhanced laser desorption ionization-time of flight (SELDI-TOF), high performance liquid chromatography (HPLC), fast protein liquid chromatography (FPLC), multidimensional liquid chromatography (LC) followed by tandem mass spectrometry (MS/MS), and laser densitometry. In vivo imaging of alpha-synuclein can comprise positron emission tomography (PET), single photon emission tomography (SPECT), near infrared (NIR) optical imaging, or magnetic resonance imaging (MRI).
(172) Also provided is a composition comprising a biological sample of a subject diagnosed with a synucleinopathy (or being suspected as having the disease) and the antibody or antigen-binding fragment thereof (e.g., scFv) as described herein.
(173) The present methods can be used to classify the disease determining responsiveness to treatment, selecting treatment and determining disease outcome.
(174) According to some embodiments of the invention, the method further comprises informing the subject of the predicted diagnosis, treatment and/or the predicted prognosis of the subject.
(175) As mentioned the antibodies or antigen-binding fragments thereof (e.g., scFv) provided herein can also be used in therapeutics. One or more polynucleotides encoding the antibodies or antigen-binding fragments thereof can also be used in therapeutics.
(176) Thus, according to an aspect of the invention there is provided a method of treating or preventing a synucleinopathic disease in a subject, the method comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof (e.g., scFv), the composition, the polynucleotide, the vector or the cell comprising the antibody or antigen-binding fragment thereof (e.g., scFv) (optionally devoid of an Fc), thereby treating or preventing the synucleinopathic disease.
(177) According to an aspect there is provided a method of treating or preventing neuroinflammation in a subject, the method comprising administering to the subject a therapeutically effective amount of the antibody or antigen-binding fragment thereof (e.g., scFv), the composition, the polynucleotide, the vector or the cell comprising the antibody or antigen-binding fragment thereof (e.g., scFv) (not necessarily devoid of an Fc), thereby treating or preventing the neuroinflammation.
(178) According to a specific embodiment the antibody or antigen-binding fragment thereof (e.g., scFv) is administered to the subject. According to a specific embodiment one or more polynucleotides encoding the antibody or antigen-binding fragment thereof (e.g., scFv) are administered to the subject. The one or more polynucleotides can be contained in one or more vectors. The vectors can be, for example, viral vectors such as adenoviral vectors or lentiviral vectors.
(179) Synucleinopathic diseases or synucleinopathies are a diverse group of neurodegenerative disorders that share a common pathologic lesion composed of aggregates of insoluble alpha-synuclein protein in selectively vulnerable populations of neurons and glia. Thus, the hallmark is accumulation and/or deposition of alpha-synuclein in the brain and the central nervous system. These disorders include, but are not limited to, Parkinson's disease (PD), Parkinson's Disease Dementia (PDD), dementia with Lewy bodies (DLB), juvenile-onset generalized neuroaxonal dystrophy (Hallervorden-Spatz disease), pure autonomic failure (PAF), multiple system atrophy (MSA) and neurodegeneration with brain iron accumulation type-1 (NBIA-I).
(180) They are characterized by a chronic and progressive decline in motor, cognitive, behavioral, and autonomic functions, depending on the distribution of the lesions.
(181) Parkinson's disease is an age-dependent neurodegenerative disease with unknown etiology. It is believed that sporadic Parkinson's disease results from a combination of genetic vulnerability and environmental insults. It is further believed that Parkinson's disease (PD), while triggered by disparate mechanisms follows a shared pathophysiologic pathway. One shared node is the involvement of alpha-synuclein. Linkage of this protein with Parkinson's disease pathogenesis has been established by the identification of both point mutations and triplication of the gene in familial cases, the localization of alpha-synuclein to Lewy bodies, one of the hallmark pathological features of Parkinson's disease, and the correlation of alpha-synuclein expression and disease pathology in neurotoxic models of Parkinson's disease. Further evidence indicates that particular forms of alpha-synuclein (e.g., misfolded and alpha-synuclein bonded dopamine) are involved in sporadic disease.
(182) As used herein, the term “neuroinflammatory disease or disorder” refers to a medical condition that is manifested by inflammation of the nervous tissue. It may be initiated in response to a variety of cues, including infection, traumatic brain injury, toxic metabolites, or autoimmunity. Examples of neuroinflammatory diseases or disorders include, but not limited to, Parkinson's Disease, Amyotrophic Lateral Sclerosis (ALS), Multiple Sclerosis (MS), Alzheimer's Disease (AD), Traumatic Brain Injury (TBI), irritable bowel syndrome, schizophrenia, bipolar disorder, depression, anxiety (generalized anxiety disorder, obsessive-compulsive disorder and post-traumatic stress disorder, dementia, autism spectrum disorder (autism, asperger's disorder, pervasive developmental disorder, childhood disintegrative disorder), ataxia telangiectasia, Coackayne syndrome, corticobasal degeneration, Creutzfeldt-Jakob disease, spinocerebellare ataxia type 3, neuroborreliosis, primary lateral sclerosis, progressive supranuclear palsy, Schilder's disease, subacute combined degeneration of spinal cord secondary to pernicious anemia, drug-induced demyelination, radiation induced demyelination, spinal muscular atrophy, tabes dorsales, spinal cord injury, chronic inflammatory demyelinating neuropathy, a congenital metabolic disorder, polymyositis, temporal arteritis, vasculitis, autism, and interstitial cystitis, Hurler's Syndrome, Scheie's Syndrome, Hunter's Syndrome, San Fillipo's Syndrome, Maroteaux-Lany Syndrome, Sly Syndrome, Fucosidosis, Alpha-mannosidosis, Beta-mannosidosis, Schindler's Disease, Pompeii's Disease, Woman's Disease, and Infantile Neuronal Ceroid Lipofuscinosis.
(183) As used herein “subject in need thereof” includes mammals, preferably human beings at any age which suffer from the pathology, i.e., synucleinopathy or neuroinflammation. According to a specific embodiment, this term encompasses individuals who are at risk to develop the pathology.
(184) As mentioned, it may be desirable to use the non-Fc containing fragment and smallest (with lowest molecular weight) as possible antibody fragments for therapeutic purposes.
(185) The antibody or antigen-binding fragment thereof (e.g., scFv), the composition, the polynucleotide, the vector, or the cell comprising the antibody or antigen-binding fragment thereof (e.g., scFv) of some aspects provided herein can be administered to an organism per se, or in a pharmaceutical composition where it is mixed with suitable carriers or excipients.
(186) As used herein a “pharmaceutical composition” refers to a preparation of one or more of the active ingredients described herein with other chemical components such as physiologically suitable carriers and excipients. The purpose of a pharmaceutical composition is to facilitate administration of a compound to an organism.
(187) Herein the term “active ingredient” refers to the antibody or antigen-binding fragment thereof (e.g., scFv), the composition, the polynucleotide, the vector, or the cell comprising the antibody or antigen-binding fragment thereof (e.g., scFv) of some aspects provided herein accountable for the biological effect.
(188) Hereinafter, the phrases “physiologically acceptable carrier” and “pharmaceutically acceptable carrier” which may be interchangeably used refer to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered compound. An adjuvant is included under these phrases.
(189) Techniques for formulation and administration of drugs may be found in “Remington's Pharmaceutical Sciences,” Mack Publishing Co., Easton, Pa., latest edition, which is incorporated herein by reference.
(190) Suitable routes of administration may, for example, include oral, rectal, transmucosal, especially transnasal, intestinal or parenteral delivery, including intramuscular, subcutaneous and intramedullary injections as well as intrathecal, direct intraventricular, intracardiac, e.g., into the right or left ventricular cavity, into the common coronary artery, intravenous, intraperitoneal, intranasal, or intraocular injections.
(191) According to some embodiments of the invention, the administration route is intranasal.
(192) Conventional approaches for drug delivery to the central nervous system (CNS) include: neurosurgical strategies (e.g., intracerebral injection or intracerebroventricular infusion); molecular manipulation of the agent (e.g., production of a chimeric fusion protein that comprises a transport peptide that has an affinity for an endothelial cell surface molecule in combination with an agent that is itself incapable of crossing the BBB) in an attempt to exploit one of the endogenous transport pathways of the BBB; pharmacological strategies designed to increase the lipid solubility of an agent (e.g., conjugation of water-soluble agents to lipid or cholesterol carriers); and the transitory disruption of the integrity of the BBB by hyperosmotic disruption (resulting from the infusion of a mannitol solution into the carotid artery or the use of a biologically active agent such as an angiotensin peptide). However, each of these strategies has limitations, such as the inherent risks associated with an invasive surgical procedure, a size limitation imposed by a limitation inherent in the endogenous transport systems, potentially undesirable biological side effects associated with the systemic administration of a chimeric molecule comprised of a carrier motif that could be active outside of the CNS, and the possible risk of brain damage within regions of the brain where the BBB is disrupted, which renders it a suboptimal delivery method.
(193) Alternately, one may administer the pharmaceutical composition in a local rather than systemic manner, for example, via injection of the pharmaceutical composition directly into a tissue region of a patient.
(194) The term “tissue” refers to part of an organism consisting of cells designed to perform a function or functions. Examples include, but are not limited to, brain tissue, retina, skin tissue, hepatic tissue, pancreatic tissue, bone, cartilage, connective tissue, blood tissue, muscle tissue, cardiac tissue brain tissue, vascular tissue, renal tissue, pulmonary tissue, gonadal tissue, hematopoietic tissue.
(195) Pharmaceutical compositions suitable for use in context of some embodiments of the invention include compositions wherein the active ingredients are contained in an amount effective to achieve the intended purpose. More specifically, a therapeutically effective amount means an amount of active ingredients (antibody or antigen-binding fragment thereof (e.g., scFv), the composition, the polynucleotide, the vector, or the cell comprising the antibody or antigen-binding fragment thereof (e.g., scFv) of some aspects provided herein) effective to prevent, alleviate or ameliorate symptoms of a disorder (e.g., synucleinopathy) or prolong the survival of the subject being treated.
(196) Furthermore, a pharmaceutical composition can be formulated as a vaccine, for example, if the pharmaceutical composition of the invention comprises an anti-alpha-synuclein antibody or antigen-binding fragment thereof (e.g., scFv), as described herein, for passive immunization. As mentioned in the background section, oligomeric species of alpha-synuclein have been reported extracellularly in plasma and CSF (El-Agnaf et al., FASEB J. 20 (2006), 419-425) and passive immunization studies in mouse models of Parkinson's disease show that extracellular mouse monoclonal antibodies against alpha-synuclein can reduce accumulation of intracellular alpha-synuclein aggregates (Masliah et al., Neuron, 46 (2005), 857-868). Accordingly it is prudent to expect that the human anti-alpha-synuclein antibodies or antigen-binding fragment thereof (e.g., scFv) provided herein are particularly useful as a vaccine for the prevention or amelioration of the medical conditions described herein e.g., synucleinopathic diseases such as PD, DLB and MSA.
(197) Compositions of some aspects provided herein may, if desired, be presented in a pack or dispenser device, such as an FDA approved kit, which may contain one or more unit dosage forms containing the active ingredient. The pack may, for example, comprise metal or plastic foil, such as a blister pack. The pack or dispenser device may be accompanied by instructions for administration. The pack or dispenser may also be accommodated by a notice associated with the container in a form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals, which notice is reflective of approval by the agency of the form of the compositions or human or veterinary administration. Such notice, for example, may be of labeling approved by the U.S. Food and Drug Administration for prescription drugs or of an approved product insert. Compositions comprising a preparation of the invention formulated in a compatible pharmaceutical carrier may also be prepared, placed in an appropriate container, and labeled for treatment of an indicated condition.
(198) Hence, certain aspects provided herein relate to the use of the alpha-synuclein antibody or antigen-binding fragment thereof, the polynucleotide, the vector, or the cell provided herein for the preparation of a pharmaceutical or diagnostic composition for prophylactic and therapeutic treatment of a synucleinopathic disease or neuroinflammation, monitoring the progression of a synucleinopathic disease or neuroinflammation or a response to a synucleinopathic disease treatment or neuroinflammation treatment in a subject or for determining a subject's risk for developing a synucleinopathic disease or neuroinflammation.
(199) As used herein the term “about” refers to ±10%.
(200) The terms “comprises”, “comprising”, “includes”, “including”, “having” and their conjugates mean “including but not limited to”.
(201) The term “consisting of” means “including and limited to”.
(202) The term “consisting essentially of” means that the composition, method or structure may include additional ingredients, steps and/or parts, but only if the additional ingredients, steps and/or parts do not materially alter the basic and novel characteristics of the claimed composition, method or structure.
(203) As used herein, the singular form “a”, “an” and “the” include plural references unless the context clearly dictates otherwise. For example, the term “a compound” or “at least one compound” may include a plurality of compounds, including mixtures thereof.
(204) Throughout this application, various aspects of this invention may be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
(205) Whenever a numerical range is indicated herein, it is meant to include any cited numeral (fractional or integral) within the indicated range. The phrases “ranging/ranges between” a first indicate number and a second indicate number and “ranging/ranges from” a first indicate number “to” a second indicate number are used herein interchangeably and are meant to include the first and second indicated numbers and all the fractional and integral numerals there between.
(206) As used herein the term “method” refers to manners, means, techniques and procedures for accomplishing a given task including, but not limited to, those manners, means, techniques and procedures either known to, or readily developed from known manners, means, techniques and procedures by practitioners of the chemical, pharmacological, biological, biochemical and medical arts.
(207) As used herein, the term “treating” includes abrogating, substantially inhibiting, slowing or reversing the progression of a condition, substantially ameliorating clinical or aesthetical symptoms of a condition or substantially preventing the appearance of clinical or aesthetical symptoms of a condition.
(208) It is appreciated that certain features of the invention, which are, for clarity, described in the context of separate embodiments, may also be provided in combination in a single embodiment. Conversely, various features of the invention, which are, for brevity, described in the context of a single embodiment, may also be provided separately or in any suitable subcombination or as suitable in any other described embodiment of the invention. Certain features described in the context of various embodiments are not to be considered essential features of those embodiments, unless the embodiment is inoperative without those elements.
(209) Various embodiments and aspects of the present invention as delineated hereinabove and as claimed in the claims section below find experimental support in the following examples.
EXAMPLES
(210) Reference is now made to the following examples, which together with the above descriptions, illustrate the invention in a non limiting fashion.
(211) Generally, the nomenclature used herein and the laboratory procedures utilized in the present invention include molecular, biochemical, microbiological and recombinant DNA techniques. Such techniques are thoroughly explained in the literature. See, for example, “Molecular Cloning: A laboratory Manual” Sambrook et al., (1989); “Current Protocols in Molecular Biology” Volumes I-III Ausubel, R. M., ed. (1994); Ausubel et al., “Current Protocols in Molecular Biology”, John Wiley and Sons, Baltimore, Md. (1989); Perbal, “A Practical Guide to Molecular Cloning”, John Wiley & Sons, New York (1988); Watson et al., “Recombinant DNA”, Scientific American Books, New York; Birren et al. (eds) “Genome Analysis: A Laboratory Manual Series”, Vols. 1-4, Cold Spring Harbor Laboratory Press, New York (1998); methodologies as set forth in U.S. Pat. Nos. 4,666,828; 4,683,202; 4,801,531; 5,192,659 and 5,272,057; “Cell Biology: A Laboratory Handbook”, Volumes I-III Cellis, J. E., ed. (1994); “Current Protocols in Immunology” Volumes I-III Coligan J. E., ed. (1994); Stites et al. (eds), “Basic and Clinical Immunology” (8th Edition), Appleton & Lange, Norwalk, Conn. (1994); Mishell and Shiigi (eds), “Selected Methods in Cellular Immunology”, W. H. Freeman and Co., New York (1980); available immunoassays are extensively described in the patent and scientific literature, see, for example, U.S. Pat. Nos. 3,791,932; 3,839,153; 3,850,752; 3,850,578; 3,853,987; 3,867,517; 3,879,262; 3,901,654; 3,935,074; 3,984,533; 3,996,345; 4,034,074; 4,098,876; 4,879,219; 5,011,771 and 5,281,521; “Oligonucleotide Synthesis” Gait, M. J., ed. (1984); “Nucleic Acid Hybridization” Hames, B. D., and Higgins S. J., eds. (1985); “Transcription and Translation” Hames, B. D., and Higgins S. J., Eds. (1984); “Animal Cell Culture” Freshney, R. I., ed. (1986); “Immobilized Cells and Enzymes” IRL Press, (1986); “A Practical Guide to Molecular Cloning” Perbal, B., (1984) and “Methods in Enzymology” Vol. 1-317, Academic Press; “PCR Protocols: A Guide To Methods And Applications”, Academic Press, San Diego, Calif. (1990); Marshak et al., “Strategies for Protein Purification and Characterization—A Laboratory Course Manual” CSHL Press (1996); all of which are incorporated by reference as if fully set forth herein. Other general references are provided throughout this document. The procedures therein are believed to be well known in the art and are provided for the convenience of the reader. All the information contained therein is incorporated herein by reference.
Materials and Methods
(212) Preparation of Alpha-Synuclein PFFs
(213) Purified α-syn monomer (1 mg Alexotech, Sweden) was thawed in a 1.5-ml microcentrifuge tube in a 37° C. water bath until complete thawing. The tube was centrifuged at 100,000×g at 4° C. for 60 min to pellet any aggregated material. Supernatant was removed and diluted with PBS in a new, low binding sterile 1.5-ml micro centrifuge tube (Protein LoBind Tube 1.5, Eppendorf tubes, Cat no.: 022431081) for the use of generating PFFs in to a final volume of 200 μl and a final concentration of 5 mg/ml. Tube was placed in a closed thermomixer (QSR technologies, U.S.A) at 37° C. incubation for 7d at 1000 rpm (solution should appear turbid). The solution was divided into aliquots (10-20 μl) into sterile microcentrifuge tubes and stored at −80° C. Before use, PFF was centrifuged at 100,000×g, 4° C. for 60 min. The supernatant was removed and PFF was sonicated in new sterile PBS (20% power 1 sec on 1 sec off in 60 sec total on (30 sec net on time)).
(214) Preparation of Aldehyde Induced Alpha-Synuclein Oligomers
(215) Purified α-syn monomer (2 mg/ml Alexotech, Sweden) (in PBS, pH 7.4) was mixed together with HNE (4-Hydroxynonenal) 20 mg/ml (in DMSO) in a low binding tube (Protein LoBind Tube 1.5, Eppendorf tubes, Cat no.: 022431081) for a final concentration of 140 μM α-syn and 4200 μM HNE, respectively. Samples were incubated at 37° C. for 18 h and analyzed in SDS-PAGE, silver stain (manufacture protocol). A 14 KDa form is the oligomer (aSyn adopts extended conformation oligomeric form (spherical—monomers to hexamers), with dimers being the major species (SDS resistant) and PFF Fibril forms (dimers and above). Of note, there can be an overlap in the size but not in the structure (fibril vs. round oligomers).
(216) Cell Viability Assays
(217) The toxicity of a-syn fibrils was assessed by the MTT cell viability assay on differentiated human neuroblastoma SH-SY5Y cells. For the MTT assay, cells were plated at a density of 10,000 cells per well on 96-well plates in 100 of culture medium per well. Following 24 h, the medium was exchanged with 100 of fresh medium containing 10 μM of retinoic acid (RA) for neuronal differentiation. After 96 additional hours, 0.0625 M of alpha-syn fibrils, 0.0156 μM a-syn oligomers or human PD brain extracts (1:1000 in PBS) were incubated with PMS208 or sham scFv (80R a proprietary unspecific protein engineered clone) for additional 4 h at room temperature and added to the differentiated neuronal cells for 24 h at 37° C. Control samples were prepared with the addition of identical volumes of buffer. After 24 h of incubation, the cells were incubated for another 4 h with 100 of serum-free Dulbecco's modified Eagle's medium without phenol red, containing 0.5 mg/ml MTT. Then, 100 of cell lysis solution (20% SDS, 50% N,N-dimethylformamide) were added to each well, and the samples were incubated over night at 37° C. to allow complete lysis. The absorbance of the formazan was measured at 570 nm in a Tecan infinite 200 pro microplate reader (Tecan, Mannedorf, Switzerland).
(218) Uptake of Alpha-Synuclein Fibrils and Oligomers in Cells
(219) Human PBMC's, BV-2 (mouse microglia, ICLC ATL03001) and peritoneal mouse macrophages were split into 12 well culture plates (Greiner CELLSTAR multiwell culture plates) on the day before the experiment. 0.3 M synuclein fibrils or oligomers conjugated with Alexa 488, pre-incubated with either 0.1, 0.5, 1.5, 3, 4 and 5 g/ml PMS208 or PMS208-Fc for 30 min at room temperature, were added to cells with culture media (RPMI 1640, 10% FBS, 2 mM L-Glutamine, 1% Pen/Strep). The conditioned medium was also pre-incubated with PMS208 (without pff/oligomers) for 30 min as control. Cells were then incubated at 37° C. for 24 h and harvested. Flow cytometry (FL1—blue laser (488 nm) was used to measure fibrils/oligomers (conjugated to ALEXA fluor 488) uptake indicated as relative geomean fluorescence intensity (gMFI). Cytochalasin D (Cyto D) is an antibiotic which is used to inhibit cellular uptake (control).
(220) Aggregation Studies of α-Syn Proteins Using Thioflavin T (ThT) Fluorescence
(221) α-Syn in 10 mM phosphate buffer, pH 7.4, was filtered to ensure removal of preformed aggregates and then incubated at 37° C. with shaking at 1000 rpm (Thermomixer, QSR technologies, U.S.A) for 6 days in the presence of 2 different PMS208 concentrations. Aliquots of the reactions were removed at each time point and added to a 10 M Thioflavin T (ThT) (Sigma, T3516) solution (prepared from a stock dissolved in 10 mM phosphate buffer, pH 7.4) in a low-binding black 96-well plate (Corning). Fluorescent measurements were performed using a Tecan infinite 200 pro microplate fluorescent reader (Tecan, Mannedorf, Switzerland) recording fluorescence measurements from 440 to 485 nm. All measurements were performed in triplicate.
(222) Spreading and Seeding Determination of Human PFF In Vitro
(223) Aliquot of 5 mg/ml PFF were thawed at room temperature immediately before use. PFFs were added to sterile PBS to a final concentration of 0.1 mg/ml (minimal volume for use is 200 ul) and then sonicated with 60 pulses at 10% power (total of 30s, 0.5 sec on, 0.5 sec off). Sonicated PFFs or equivalent volume of PBS as a control were diluted with prewarmed neuronal medium in a 1:20 dilution (with and without PMS208 treatment (15 ug/ml)) and added to neurons (primary neurons derived from wild-type, nontransgenic p0 mouse pups, (M J Beaudoin et al; Nature protocols)) 7 days after plating for additional 7-10 days. About 50% of the medium was changed once a week (the fresh medium does not need to contain more fibrils as the seeding takes place only once at the beginning of the experiment). Next, primary neuron culture cells were rinsed twice with PBS and each well was completely aspirated before adding ice cold RIPA lysis buffer with protease and phosphotase inhibitors. Neuronal cells were taken out from wells using a cell scraper and placed in a low binding 1.5 ml tubes on ice. Next, cells were sonicated (1 sec on, 1 sec off, time 5 sec—20%) and incubated on ice for 30 minutes. Samples were centrifuged at 17,000×g at 4° C. for 60 min, and supernatants were removed to a new low-binding 1.5 ml tubes, retained on ice or in a−20° C. freezer while additional (same volume) ice-cold RIPA lysis buffer with protease and phosphatase inhibitors was added to the pellet. The pellet tube was sonicated (1 sec on, 1 sec off, time 5 sec-20%) and centrifuged at 17,000×g at room temperature for additional 80 minutes, supernatant was discarded, and 2% (wt/vol) of SDS/RIPA added to the pellet with protease and phosphatase inhibitors. Cells were sonicated (1 sec on, 1 sec off, time 16 sec-20%), and a BCA/protein assay was performed on TX-100 supernatant and SDS extract. Samples were diluted with 2% (wt/vol) SDS extract into Laemmli buffer 2×+beta mercaptoethanol and heated at 95° C. for 5 minutes before loading on a 10% (wt/vol) gel. Proteins were transferred from a gel to a nitrocellulose membrane according to the manufacturer's instructions at 100 V for 75 minutes or overnight at 40 V. Membrane was blocked for 1 hour with TBST/5% (wt/vol) milk, stained with diluted primary antibodies (mouse anti-human aSyn (clone Syn204, BioLegend) 1:1000, rabbit anti-rodent synuclein (D37A6, CellSignal) 1:1000, anti-GAPDH (clone 6C5, Millipore) 1:2000 followed by secondary antibodies peroxidase-AffiniPure goat anti-mouse IgG (Jackson) 1:10000, mouse anti-rabbit IgG (Jackson)) 1:10000 TBS/1% (wt/vol) BSA, incubated for additional 1 hour (both primary and secondary separately) while shaking and rinsed×3 times (5 minutes each rinse) before enhanced chemiluminescence development.
(224) Pull-Down Assay (Immunoprecipitation) of Serum Derived Alpha-Synuclein by PMS208
(225) Human sera and human CSF obtained from PD patients were immunoprecipitated with different amounts of PMS208-Fc (5, 10 and 50 μg) bound to Dynabeads protein A (Dynabeads® Protein A for IP 1 ml, Life technologies, Grand Island, N.Y., USA) following manufacturer's instructions, then separated by SDS-PAGE (Bis-Tris 4-12% acrylamide) and transferred to protran nitrocellulose membranes. Membranes were analyzed by immunoblot for alpha-synuclein using mouse anti-human aSyn (clone Syn204, BioLegend-BLG838201; 1:1000) and mouse anti-aSyn phospho (Ser129) (clone P-syn/81A, BioLegend-BLG825701; 1:500) following peroxidase-AffiniPure goat anti-mouse IgG (Jackson; 1:10,000) before enhanced chemiluminescence development. 100 ng of recombinant human aSyn PFF and PBS were immunoprecipitated with 50 μg of PMS208-Fc bound to Dynabeads as positive and negative control respectively.
(226) Animals
(227) WT mice (C57BL/6JRccHsd background) and Rats (Sprague-Dawley) were purchased from Envigo RMS (Israel), Ltd. All housing, breeding, and procedures were performed according to the National Institute of Health (NIH) Guide for the Care and Use of Experimental Animals and approved by the Kaplan Medical Center Institutional Animal Care and Use Committee.
(228) Subjects and Tissue Sampling
(229) This study was performed at Kaplan Medical Centre in Rehovot, Israel under appropriate Institutional Review Board approval. Blood samples were obtained from the Israel National Blood Services (MDA) except for CSF and brain specimens included in the study which were collected at the Cambridge Brain Bank supported by the NIHR Cambridge Biomedical Research Centre.
(230) Evaluation of the Effect of PMS208, Compared with PBS as Controls, on Mouse Alpha-Synuclein PFF Induced Parkinson's Disease (Stereotaxic Injections):
(231) 50 Male (5 groups of n=10) C57BL/6JRccHsd mice (2-4 months of age) were anesthetized by Isoflurane, and stereotaxically injected with recombinant aSyn fibrils (7 g of PFF per brain) in PBS. Control C57BL/6JRccHsd animals received sterile PBS. A single needle insertion (coordinates: +0.2 mm relative to bregma, 2.0 mm from midline) into the right forebrain was used to target the inoculum to the dorsal neostriatum located at a depth of 2.6 mm below the dura. Material was injected via a 10 μl Hamilton syringe at a rate of 0.5 μl per min (3.5 μl total volume) with the needle in place (33G) for >10 min at each target. Animals were inoculated at the right hemisphere unless otherwise indicated. After recovery from surgery, animals were treated by intranasal (IN) administration with 3 concentrations of PMS208 (16 ug/kg, 80 ug/kg and 320 ug/kg) twice a week, behavior tests (Grip test, Rota rod, Cylinder and NOR) were conducted at various predetermined time points before they were sacrificed at 9 weeks post injections by overdose with ketamine/xylazine and then transcardial perfusion with PBS (and additional perfusion with 4% formalin for histological studies). For histological studies the brain was removed and underwent overnight postfixation with neutral buffered formalin (Thermo Fisher Scientific), before being processed and embedded in O. C. T compound (Ref 4583, Tissue-Tek)—used for binding tissue to the specimen block and to surround and cover the tissue specimen. For biochemical studies, tissues were immediately frozen after removal and stored at −80° C. until used.
(232) Evaluation of the Effect of PMS208, Compared to PBS as a Control, on Adeno Associated Virus (AAV) Transduce Rats Expressing Human Synuclein Induced Parkinson's Disease (Stereotaxic Injections of AAV):
(233) 38 female (5 groups) Sprague-Dawley rats (225-250 g) were anesthetized with an intraperitoneal injection of ketamine hydrochloride (100 mg/kg) and xylazine (10 mg/kg), and stereotaxically injected with AAV-aSyn into the right hemisphere. Injections were made into the SN at the following coordinates: anteroposterior (AP), −5.3; mediolateral (ML), +1.7; dorsoventral (DV), −7.2. Control animals received sterile PBS. Material was injected via a 10 μl Hamilton syringe at a rate of 0.3 μl per min with the needle in place (33G) for >10 min at each target. Animals were inoculated at the right hemisphere unless otherwise indicated. After recovery from surgery, animals were treated by intranasal (i.n.) administration with 3 concentrations of PMS208 (5 ug/kg, 50 ug/kg, and 250 ug/kg) 2 times/week, behavior tests (Two limb wire hang, Cylinder and Open Field) were conducted at various predetermined time points before they were sacrificed at 7 weeks post injections by overdose with ketamine/xylazine and then transcardial perfusion with PBS (and additional perfusion with 4% formalin for histological studies). For histological studies the brain was removed and underwent overnight postfixation with neutral buffered formalin (Thermo Fisher Scientific), before being processed and embedded in O.CT. For biochemical studies, tissues were immediately frozen after removal and stored at −80° C. until used. CSF and blood serum was collected from all animals. The AAV2 vector was used to overexpress human wild-type α-syn, in which the expression of the transgene is driven by the human CMV promoter. A total of 8×10.sup.8 IFU were injected per animal (6 μL per animal).
(234) Evaluation of the Effect of PMS208, Compared with PBS as Controls, on Rotenone Induced Parkinson's Disease Model:
(235) 24 adult male (3 groups) Sprague-Dawley rats (175-200 g) were anesthetized with an intraperitoneal (i.p.) injection of ketamine hydrochloride (100 mg/kg) and xylazine (10 mg/kg), and injected daily i.p. for 12 days with 1.5 mg/kg/d Rotenone (dissolved in DMSO/Olive oil), 2 mg/kg/d from day 5 and 2.5 mg/kg/d from day 9 prepared fresh twice a week. Animals were treated by intranasal (i.n.) administration with 10 μg (˜40 g/kg) of PMS208 (5 μg in each nozzle) and PBS as sham at the first and every 3 days after (4 total). Behavior tests (Cylinder and Postural instability) were conducted at various predetermined time points before they were sacrificed at day 12. Transcardial perfusion with PBS and 4% formalin was done in all animals. For histological studies the brain was removed and underwent overnight postfixation with neutral buffered formalin (Thermo Fisher Scientific), before being processed and embedded in O. C. T. For biochemical studies, tissues were immediately frozen after removal and stored at −80° C. until used. CSF was collected from all animals.
(236) Rotenone Treatment
(237) The rotenone solution was first prepared as a 50× stock in 100% dimethylsulfoxide (DMSO) and diluted in olive oil, to obtain a final concentration of 1.5, 2, or 2.5 mg/mL rotenone in olive oil, 2% DMSO. Vortexing the solution creates a stable emulsion of the DMSO containing rotenone and olive oil. The solution was made fresh 2-3 times/week and stored in an amber septa vial protected from light and inverted several times before each injection to eliminate the possibility of settling. The solution was administered at 1 mL/kg, and control animals received the vehicle only. Experimental groups were comprised of at least 4-10 animals. Rotenone was administered by increased doses (day 0, day 2, and day 6) once a day for 12 consecutive days.
(238) Immunohistochemistry
(239) Brains were extracted and post-fixed in 4% PFA for 24 h and sunk in 30% sucrose. Brains were frozen on a microtome platform and cut to generate 16 and 40 m thick sections. A series of free-floating coronal sections was stained for either tyrosine hydroxylase (TH) or phosphorylated α-syn (pSyn). Tissue was incubated in 0.3% H.sub.2O.sub.2 for 45 min, rinsed, and blocked in 10% normal goat serum (1 h) and then incubated in primary mouse anti-pSyn (Ser129) (1:500, biolegend), mouse-anti-TH (1:200) antibodies overnight at 4° C. Then, sections were incubated in biotinylated secondary antisera against either mouse (1:400, Millipore, Temecula, Calif.) or rabbit IgG (1:400, Millipore, Temecula, Calif.) followed by the Vector ABC detection kit (Vector Labs, Burlingame, Calif.). Antibody labeling was visualized by exposure to 0.5 mg/ml 3,3′ diaminobenzidine (DAB), 2.5 mg/ml nickel ammonium sulfate and 0.03% H.sub.2O.sub.2 in Tris buffer followed by incubation with the NovaRed kit (Vector Labs, Burlingame, Calif.). Sections were mounted on subbed slides, dehydrated to xylene, and coverslipped with xylene base mounting buffer.
(240) Isolation and Culture of Human Peripheral Blood Mononuclear Cells (PBMC's):
(241) Whole blood was diluted 1:1 ratio with PBS (Ca/Mg free), gently laid in ficoll (ratio 1:2), and centrifuged for 30 min, 1500 rpm (with slow acceleration and de-acceleration (0)). Buffy coat was collected into a new tube, washed with PBS, and centrifuged for 15 min in 1200 rpm. Additional wash with PBS was supplemented, and blood was centrifuged for 15 min in 1200 rpm before cells were resuspended in 10 ml PBS for counting.
(242) ELISA Assay for Neuroinflammation
(243) IL-6 and TNF-alpha (TNFα) protein levels in cells were detected using DuoSet Elisa assay (R&D System) following manufacturer protocol.
(244) ELISPOT Assays
(245) The assay is done by culturing PBMCs for 14 days (dilution of 1:1 with medium supplemented with IL-2 each couple of days) with PFF/oligomers in order to stimulate helper and cytotoxic T cells and then to test whether a-Syn pff/oligomers were recognized by those cells.
(246) Specifically, culturing of PBMCs for in vitro expansion was performed by incubating in RPMI (Biological Industries, Israel) supplemented with 5% human AB serum (Biological Industries, Israel), GlutaMAX (Gibco), and penicillin and streptomycin (Biological Industries, Israel) at 2×10.sup.6 per ml in the presence of alpha-synuclein PFF/oligomers at 10 g/ml. Every three days, 10 U/mlIL-2 in medium was added to the cultures. After 14 days, cultures were stimulated with 25 μg/ml fibrilized α-syn or 25 g/ml oligomerized α-syn and the response was measured by IFNγ and IL-5 ELISPOT. ELISPOT antibodies, mouse anti-human IFNγ (clone 1-D1K), mouse anti-human IL-5 (clone TRFK5), mouse anti-human IFNγ-HRP (clone 7-B6-1), and mouse anti-human IL-5 biotinylated (clone 5A10) were all from Mabtech.
(247) Real Time PCR for Cell Activation
(248) 10-week old mice were injected with human α-syn PFF or oligomers into the striatum (with and without PMS208 treatment) to examine in vivo neuroinflammation. 72 hours post-intrastriatal injections, animals were sacrificed, and brains were dissected and homogenized. RNA from whole brain and suspension cells was isolated using SV total RNA isolation system kit (Promega) or EZ-RNA Total RNA Isolation Kit (Biological Industries, Israel) respectively following the manufacturer's protocol. Complementary DNA (cDNA) synthesis was carried out with qScript cDNA Synthesis Kit (Quanta bio) using 2 μg of total RNA as template. In order to examine neuroinflammation relative quantitation of gene expression was conducted by real time PCR carried out using TaqMan® Gene Expression Assay (Applied Biosystems). Fluorescent (FAM)-labeled IL-6, TNFα, INFγ, IL-12, Caspase 3, Arg1, Chi313, and Mrcl were normalized to a internal control, GAPDH. All comparisons refer to sham. Analysis was done using the Comparative Ct Method (ΔΔCT).
(249) Behavioral Assessment
(250) Cylinder Test
(251) Cylinder test is a motor assessment of forelimb asymmetry. Rats were individually put into a glass cylinder (20 cm diameter, 34 cm height) and were video recorded for 5 minutes and until they touched the cylinder wall with their forelimbs 20 times. The recordings were analyzed by an investigator who was not aware of the identity of the rats. The data are presented as the following formula: (Left touch)/(Right touch+Left touch+Both touch).
(252) Wire Hang Test
(253) Neuromuscular strength was tested with a wire hang test. The mouse was placed on a wire mesh, waved gently so that the mouse gripped the wire, and then inverted. Latency to fall was recorded with a 15 minutes cut-off time.
(254) Two Limb Wire Hang Test
(255) Neuromuscular strength was tested with a two limb wire hang test. The rat was placed on a wire string, waved gently so that the rat gripped the wire. Latency to fall was recorded with a 10 minutes cut-off time.
(256) Rotarod Behavioral Analysis
(257) The Ugo Basile 47650—Mouse NG rotarod treadmill (Ugo Basile) was used to assess fine motor coordination and balance. Rotarod performance is measured on a rotating rod as the mice must walk forward to avoid falling off a continuously rotating cylinder (Carter et al. 1999; Jones and Roberts 1968). Pre-training consisted of 4 consecutive trials at low rotational speed of 20 rpm. Two trials were measured on a rod that accelerates from 0-50 rpm, and the average time on the rod for each mouse was used for data analysis. Time on the rod was used to assess fine motor coordination and balance.
(258) Rearing Behavior
(259) When placed in a clear cylinder, rats will engage in exploratory behavior, including rearing. During rearing behavior, the forelimbs will contact the wall of the cylinder.
(260) For this test, the rat was placed in a clear plexiglass cylinder (height=30 cm, diameter=20 cm) for 3 minutes. The test was conducted under low red-light conditions and video-recorded, and during video playback, the number of rears was quantified. To be classified as a rear, the animal had to raise forelimbs above shoulder level and make contact with the cylinder wall with either one or both forelimbs. Removal of both forelimbs from the cylinder wall and contact with the table surface was required before another rear was scored. This test has been successfully used previously to assess behavioral deficits in the rats receiving subcutaneous or intravenous rotenone.
Novel Object Recognition (NOR)
(261) 24 hours before testing, all animals were habituated to the testing apparatus for 10 minutes (50 cm box, 40 cm high). The day after, animals were introduced to the objects: first, two identical objects were placed in the box, and mice were allowed to explore objects for 5 minutes. The same procedure continued until 5 mice were done. The entire phase for 5 mice lasted 30 minutes. Immediately after, these 5 mice were tested in the same order as before. Animals were introduced to two different objects, one familiar object and one novel object that the mice never encountered. Mice were allowed to explore objects for 5 minutes and then removed from the box. At all phases, after each mouse was removed from the box, the box was sterilized with alcohol. Sample and novel objects and their locations were counterbalanced across animals. Each trial was videotaped, and time and frequency spent with each object was measured using Noldus EthoVision XT 11.5 (Noldus information Technology, The Netherlands).
(262) Statistical Analysis
(263) Values shown in the Figures are presented as mean+/−SEM. P values for determination of the statistical significance of differences were calculated by means of paired, two-tailed Student's t test, two-tailed Mann-Whitney U or Wilcoxon's rank-sum tests, one-way ANOVA with a post hoc Dunnet's or one-way ANOVA with Tukey's post test.
Example 1
Generation of scFv and scFv-Fc from Fab Libraries of Healthy Volunteers
(264) A human Fab/scFv library with a repertoire from over 110 individuals and diversity of 1×10.sup.11 was screened against recombinant modified human alpha-synuclein (PFF and oligomers). Use of this library allows for the identification of combinations of variable heavy and variable light chains that are not found together in any of the 110 individuals. High-affinity binders were selected by 3 rounds of bio-panning in which 42 positive clones were identified (
(265) A standard ELISA assay was performed using alpha-synuclein PFFs as the coating protein. As shown in
Example 2
Generation of scFv-Fc from 3 Unique Clones
(266) Three selected unique clones (PMS208, PMS210 and PMS212) were cloned to a mammalian expression vector as a scFv conjugated to human IgG1 Fc format (scFv-Fc). GGGGS×3(SEQ ID NO:47) linker was used to link between the variable regions from heavy (VH) and light (VL) chains (
Example 3
Generation of scFv from Clone PMS208
(267) PMS208 showed high affinity binding to alpha-synuclein PFF's and oligomers seen in surface Plasmon resonance (Biacore SPR system, GE Healthcare Life Sciences) and ELISA assays in scFv-Fc format (
(268) PMS208 was cloned and expressed as single chain variable fragments (scFv) with a molecular weight of 25 KDa. The GSSSS×3 (SEQ ID NO:47) linker was used to link the variable regions from heavy (VH) and light (VL) chains. PMS208 was expressed with and without his-tag for tests.
Example 4
PMS208-Fc Immunoprecipitates α-Syn from PD Patients' Sera and PD/DLB Patients' CSF
(269) The main component of pathological lesions (almost 90%) in patients with Parkinson's Disease (PD) is extensively phosphorylated at α-syn serine 129 (pS129 α-syn), which may play a critical role in synucleinopathy pathogenesis. Phosphorylation at Ser129 can regulate α-syn fibril formation and enhance α-syn toxicity both in vitro and in vivo. Although trace levels of phosphorylated α-syn are detectable in normal brains, nearly all α-syn accumulated within Lewy bodies in Parkinson disease brains is phosphorylated on serine 129 (Ser-129). Phosphorylated α-syn can be secreted from neuronal cells and can be seen in the serum and CSF of PD patients.
(270) Human serum derived from PD patients and human CSF derived from Lewy Body Dementia (DLB) or PD patients were immunoprecipitated with PMS208-Fc to determine its ability to bind endogenous human alpha-synuclein. Three different amounts of PMS208-Fc (50 μg, 10 μg, and 5 μg) were able to immunoprecipitate α-syn from PD patients sera and DLB/PD patients CSF (
Example 5
PMS208 Protects Human Neuronal Cells from PFF and from Oligomer Induced Toxicity
(271) The cytotoxicity of α-syn fibrils and oligomers was assessed on differentiated human neuroblastoma SH-SY5Y cells using the 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) assay (
Example 6
PMS208 Avidly Binds Brain Tissues from Patients with PD/DLB by WB
(272) PMS208 (scFv) was able to bind avidly its target alpha-synuclein in a number of human brain (striatum, cortex) PD, DLB, and control extracts seen in Western blot staining (
Example 7
PMS208 Attenuates Neuroinflammation Induced by Oligomers and PFF in Human PBMC's and Microglia
(273) Microglia is one of the major cell types which are involved in the inflammatory responses in the central nervous system (CNS) that appear to contribute to neuroinflammation in PD pathogenesis. This pro-inflammatory local state is evident by expression of tumor necrosis factor-α (TNF-α; TNFα), interleukin-1 (IL-10), and interferon-gamma (IFN-7) in the midbrain of PD patients which strongly suggest the involvement of immune components in PD pathogenesis.
(274) The scFv form of PMS208 down-regulates (in a dose dependent manner) a panel of pro-inflammatory cytokines (TNF-α, IL-6) produced by microglia after exposure to PFF, whereas Fc containing anti-aSyn antibodies up-regulate these same panel of proteins (
Example 8
PMS208 Attenuates Cellular Uptake of Alpha-Synuclein Oligomers and PFF in Human PBMCs and Mouse Microglia
(275) One of the main functions of macrophages and microglia in the immune system is phagocytosis thereby facilitating clearance of debri. They can also serve as antigen presenting cells that promote T cell mediated cellular immunity. Recently, it has also been shown that PD patients exhibit a systemic autoimmune response to α-syn modified forms further attesting to the role of inflammation in the pathogenesis. Activation of microglia by dying neurons or by various forms of α-syn, as well as T cells, could result in a vicious circle of neuroinflammation and neurodegeneration that is self perpetuating and drives the progression of PD. Flow cytometry was used to measure PFF/oligomers conjugated to Alexa fluor 488 (PFF-488/Oligo-488) cellular uptake (calculated by relative geomean fluorescent intensity (gMFI)) (
(276) Flow cytometry analysis shows that PMS208 in scFv format attenuates mouse and human macrophages cellular uptake of PFF conjugated to Alexa fluor 488 (relative gMFI˜60) compared to cells with PBS treatment (relative gMFI˜590) seen in
Example 9
PMS208 Attenuates Neuroinflammation In Vivo in Murine Cortex of Animals Injected with PFF and Oligomers
(277) Mice were injected with human α-syn PFF into the striatum (with and without PMS208 treatment) to examine in vivo neuroinflammation.
(278) The scFv form of PMS208 down-regulated a panel of pro-inflammatory cytokines and up-regulated anti-inflammatory genes produced in mice brain after 72 hours of exposure to human PFF (
Example 10
PMS208 Attenuates Neuroinflammation by Tuning Down the Autoimmune Response of T Cells to Oligomers/PFF as Evident by IL-5 and IFN-g ELISpots
(279) α-synuclein aggregated forms act as antigenic epitopes and drive helper and cytotoxic T cell responses in patients with Parkinson's disease. To determine whether α-syn pff/oligomers were recognized by T cells, HLA class I type and HLA class II responses were assayed. IFNγ was used as a representative cytokine to detect CD8.sup.+HLA class I and CD4.sup.+ T helper 1 (Th1) class II T cells, and IL-5 was used as a representative cytokine secreted by CD4.sup.+T helper 2 (Th2) class II T cells. Peripheral blood mononuclear cells (PBMCs) from patients with Parkinson's disease were stimulated for 14 days (PFF/oligomers at 10 g/ml, diluted 1:1 every 3-4 days). These cultures were then stimulated with α-synuclein PFF/oligomers (25 μg/ml) with and without PMS208 (15 g/ml) and Interferon-T (IFNγ) or interleukin-5 (IL-5) responses were measured by colour enzyme-linked immunospot (ELISPOT) assay, enabling quantification of responsive T cells.
(280) Fourteen (14) days of α-synuclein oligomers PBMCs stimulation compared to un-stimulated PBMCs (PBS) increased the number of IL-5 secreted cells when re-exposed to α-synuclein oligomers (
Example 12
PMS208 Inhibits α-Syn Aggregation In Vitro
(281) Aggregation of misfolded proteins is a feature common to many neurodegenerative diseases. Parkinson's Disease is a progressive movement disorder which is characterized neuropathologically by the presence of intra-neuronal Lewy Bodies (LB) and Lewy Neurites (LN). Misfolded and aggregated alpha-synuclein (fibrillar alpha-synuclein) is major component of LB's and LN's.
(282) Misfolded proteins are rich in β-sheet structures with a high tendency to form long fibrillar aggregates known as amyloid deposits. β-structures are harder to degrade than α-helixes (main conformation of native proteins), which explains why amyloid deposits cannot be removed by the proteasome system. The aggregation of misfolded proteins is believed to occur when hydrophobic residues exposed at the surface of proteins interact with other misfolded proteins. Human recombinant alpha-synuclein monomers can be driven to aggregate by constant shaking (orbital shaker) 1000 rpm at 37′C for 7 days (
Example 13
PMS208 Abrogates Spreading and Seeding of Human PFF In Vitro
(283) Evidence suggests that many neurodegenerative diseases involve spreading aggregation of specific proteins through the nervous system, potentially via a prion-like mechanism. Prion proteins propagate by auto-catalytic conversion of native, nonpathogenic forms of the protein expressed in several types of human cells, into misfolded pathological conformation. In prion disease, the pathological conformation is the primary infectious agent that propagates using a mechanism called “seeding/nucleation,” where misfolded pathological form of the protein acts like a seed that recruits and converts soluble protein into aggregates of native-nonpathogenic protein, which form polymers. As prions grow and spread, they interfere with the function of the nervous system, resulting in progression of the disease in affected patients.
(284) Synucleinopathies are typified by pathologically aggregated alpha-synuclein in specific neuronal (e.g., Parkinson's Disease and Dementia with Lewy Bodies) or glial (e.g., Multiple System Atrophy) populations where cell loss occurs. In this model, the ability of PMS208 to abrogate PFF seeding was tested. Small seeds of PFFs generated from recombinant α-syn were added directly to primary neurons with and without PMS208. These seeds of PFFs induced recruitment of endogenously expressed α-syn into abnormal, phosphorylated, insoluble and ubiquitinated aggregates. The formation of these aggregates from endogenous α-syn in primary neurons derived from wild-type, nontransgenic mice follows an initial lag phase of 2-4 days, which are then seen in the SDS extract of neuronal cells (insoluble protein) in the nitrocellulose membrane immunostaining (
Example 14
Intranasal (IN) Administration of PMS208 Motor Dysfunction Induced by the aSyn Aggregation—Rotenone in Rats
(285) Causes of sporadic PD remain unknown. Epidemiological studies suggest that exposures to pesticides, metals and solvents are contributing risk factors. In general, most sporadic cases are believed to stem from a combination of environmental exposures and individual genetic susceptibility. Several useful animal models of PD exist, each with its own advantages and disadvantages. The rotenone model of PD provides certain advantages in modeling the pathogenesis of PD. In this model, systemic inhibition of mitochondrial complex I produces selective degeneration of the nigrostriatal dopamine system and reproduces key pathological features of clinical PD. Indeed, rotenone administration affects many of the pathogenic pathways including: oxidative stress, alpha-synuclein phosphorylation and aggregation and Lewy pathology, DJ-1 acidification and translocation, proteasomal dysfunction and nigral iron accumulation.
(286) Daily intraperitoneal injections of rotenone in natural oil (olive oil) were done for 12 days in 20 animals. 4 animals were injected with natural oil only as a control group. Animals were treated by intranasal (i.n.) administration of PMS208 (˜40 ug/kg) and PBS as sham at day 1, 4, 7, and 10. Animal weight was measured each day in order to calculate % change in mass (
Example 15
PMS208 Intranasal Treatment Attenuates Motor Dysfunction Induced by Intracerebral Injections of AAV-aSyn in Rats
(287) An ideal model would replicate most, if not all, of the behavioral and pathologic characteristics of PD. Traditional models of PD include neurotoxin models, such as 6-hydroxydopamine or MPTP, to lesion dopamine neurons of the SNpc (substantia nigra pars compacta). These models can successfully predict the efficacy of dopaminergic-based therapeutics to alleviate motor symptoms. However, many compounds that showed neuroprotection in the neurotoxin models have failed in clinical trials. Toxin models did not sufficiently take into account the contribution of pathologic α-synuclein. The progressive time course of the α-synuclein models has provided interesting data suggesting that synaptic abnormalities in the striatum precede neurodegeneration. One of the greatest advantages of the rAAV-α-synuclein model is that α-synuclein can be expressed in dopaminergic neurons of the SNpc for long periods of time (a cell population particularly vulnerable in PD). Expression of the human wild-type α-synuclein leads to progressive loss of dopaminergic neurons in the SNpc, and loss of dopamine terminals in the striatum. Showing significant defects in motor behavior. The rapid early loss of striatal dopamine function seen in the rAAV-α-synuclein model replicates the pattern seen in human disease. Furthermore, neuroinflammation is one of the most robust phenotypes found by rAAV-α-synuclein over-expression, and replicates many features seen in human PD. These changes include early activation of microglia, increased pro-inflammatory cytokine expression, increased adaptive and innate immune responses, and infiltration of lymphocytes before cell loss. This inflammatory induction is caused by over-expression of α-synuclein, and not the virus itself, because control mice injected with rAAV-green fluorescent protein (GFP) do not show neuroinflammatory responses. The increase in inflammation likely contributes to neurodegeneration. Thus, targeting signaling in the inflammatory pathway may provide a therapeutic target that can prevent the progression for PD.
(288) Testing neuromuscular strength,
Example 16
PMS208 Treatment Attenuates Motor Dysfunction in the Mouse PFF IC PD Model
(289) Sonicated fibrils made from recombinant α-synuclein, when added to primary cultured neurons or injected into the striatum or other brain areas, can produce robust formation of inclusions that resemble Lewy bodies and Lewy neurites found in diseased brains. Thus, this model of PFF injection allows investigation of the impact of misfolded α-synuclein on the neuronal function and consequent phenotypes, and determination of whether preventing inclusion formation can reverse these phenotypes. Similar to rAAV-a-synuclein models, inducing inclusion formation with protein fibrils is advantageous because transgenic over-expression of human α-synuclein is not required. Inclusion formation occurs in neurons from hippocampus, cortex, and midbrain and other brain regions, and thus the impact of these aggregates on diverse neuronal populations can be examined. Regardless of the injection site, α-synuclein inclusions form at the injection site and appear in brain areas distant from the site of injection. In this model, defects occur well before any neuron death, suggesting that neuronal dysfunction emerges in response to abnormal α-synuclein very early before neurodegeneration begins. This is important in light of the development of novel techniques showing the presence of a-synuclein aggregates at a very early stage in brains of patients with PD and dementia with Lewy bodies.
(290) As shown in
Example 19
PMS208 Affects TH+ Neurons and Dopaminergic (DA) Neurons
(291)
(292) Although the invention has been described in conjunction with specific embodiments thereof, it is evident that many alternatives, modifications and variations will be apparent to those skilled in the art. Accordingly, it is intended to embrace all such alternatives, modifications and variations that fall within the spirit and broad scope of the appended claims.
(293) All publications, patents and patent applications mentioned in this specification are herein incorporated in their entirety by reference into the specification, to the same extent as if each individual publication, patent or patent application was specifically and individually indicated to be incorporated herein by reference. In addition, citation or identification of any reference in this application shall not be construed as an admission that such reference is available as prior art to the present invention. To the extent that section headings are used, they should not be construed as necessarily limiting.