CARGOMERS
20190048049 ยท 2019-02-14
Assignee
Inventors
Cpc classification
A61K45/06
HUMAN NECESSITIES
A61K47/64
HUMAN NECESSITIES
A61K39/00
HUMAN NECESSITIES
A61K47/646
HUMAN NECESSITIES
A61K47/554
HUMAN NECESSITIES
A61K2039/507
HUMAN NECESSITIES
G01N2800/52
PHYSICS
A61K39/3955
HUMAN NECESSITIES
A61K39/3955
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
G01N2800/56
PHYSICS
A61K47/42
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
A61K47/6917
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
A61K47/42
HUMAN NECESSITIES
Abstract
Cargomers comprising apolipoprotein molecules complexed with amphipathic molecules and one or more cargo moieties.
Claims
1. A Cargomer comprising: (a) 1-8 apolipoprotein molecules; (b) one or more cargo moieties; (c) an amount of amphipathic molecules sufficient to solubilize the apolipoprotein molecules, wherein one or more of the cargo moieties of (b) and one or more of the amphipathic molecules of (c) can be the same molecule(s) in the Cargomer; (d) optionally, one or more anchors non-covalently coupling one or more cargo moieties to the apolipoprotein molecules; and (e) optionally, one or more linkers covalently coupling one or more cargo moieties to one or more apolipoprotein molecules, one or more amphipathic molecules or one or more anchors, wherein the amphipathic molecules, the cargo moieties and, if present, the anchors and/or linkers together contribute a net charge of at least +1 or ?1 per apolipoprotein molecule in the Cargomer.
2. The Cargomer of claim 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:15.
3. The Cargomer of claim 1, which is not a discoidal particle.
4. The Cargomer of claim 1, wherein at least one amphipathic molecule is also a cargo moiety and/or at least one cargo moiety is coupled to an anchor.
5. The Cargomer of claim 4, wherein at least one cargo moiety is coupled to an anchor and wherein the anchor is an amphipathic molecule, which is optionally a phospholipid or cholesterol.
6. The Cargomer of claim 1, wherein the amphipathic molecules comprise a phospholipid, a detergent, a fatty acid, an apolar moiety or sterol covalently attached to a sugar, or a combination thereof.
7. The Cargomer of claim 1, wherein the apolipoprotein molecules comprise or consist of apolipoprotein A-I (ApoA-I) molecules.
8. The Cargomer of claim 1, wherein the one or more cargo moieties comprise a therapeutic agent, which is optionally an immunoinhibitory agent, an immunostimulatory agent, an anti-cancer agent, an anti-infective agent, a nucleic acid drug, an anti-inflammatory agent, an agent for treating cardiovascular disorders, a caspase inhibitor, or a bioactive agent.
9. The Cargomer of claim 1, wherein the one or more cargo moieties comprise an immunogen, which is optionally an antigen or an antigen-encoding nucleic acid.
10. The Cargomer of claim 1, wherein the one or more cargo moieties comprises a diagnostic agent, which is optionally an imaging agent.
11. A pharmaceutical composition comprising an effective amount of the Cargomers of claim 8 and one or more pharmaceutically acceptable carriers, diluents, and/or excipients.
12. A vaccine composition comprising an effective amount of the Cargomers of claim 9 and one or more pharmaceutically acceptable carriers, diluents, excipients, and/or adjuvants.
13. A diagnostic composition comprising an effective amount of the Cargomers of claim 10 and one or more carriers, diluents, and/or excipients suitable for diagnostic use.
14. A method for treating subject, comprising administering to a subject in need thereof a therapeutically effective amount of the Cargomer of claim 8, which is optionally in the form of a pharmaceutical composition comprising one or more pharmaceutically acceptable carriers, diluents, and/or excipients.
15. A method for diagnosing a subject, comprising administering to a subject in need thereof an effective amount of the Cargomer of claim 10, which is optionally in the form of a diagnostic composition comprising one or more carriers, diluents, and/or excipients suitable for diagnostic use.
16. A method for immunizing subject, comprising administering to a subject in need thereof an effective amount of the Cargomer of claim 9, which is optionally in the form of a vaccine composition comprising one or more pharmaceutically acceptable carriers, diluents, excipients, and/or adjuvants.
17. A method of imaging a tumor in a subject afflicted with a cancer, comprising: (a) administering a Cargomer according to claim 10 which comprises an imaging agent to the subject; and (b) imaging the subject to detect delivery of the imaging agent to the tumor, thereby imaging the tumor.
18. A method of monitoring tumor progression, regression, or recurrence in a subject afflicted with a cancer, comprising: (a) administering a Cargomer according to claim 10 which comprises imaging agent to the subject in a first administration and imaging the subject to detect delivery of the imaging agent to the tumor; and (b) administering the Cargomer in a second administration and imaging the subject to detect delivery of the imaging agent to the tumor, thereby monitoring tumor progression, regression, or recurrence.
19. A method for selecting a subject afflicted with a cancer for treatment with a Cargomer comprising an anti-cancer agent, comprising: (a) administering a Cargomer according to claim 10 which comprises imaging agent to the subject; (b) imaging the subject to detect delivery of the imaging agent to the tumor; and (c) selecting the subject for treatment with a Cargomer comprising an anti-cancer agent if the imaging shows delivery of the imaging agent to the tumor.
20. A method of treating a subject afflicted with a cancer, comprising: (a) administering a Cargomer according to claim 10 which comprises imaging agent to the subject; (b) imaging the subject to detect delivery of the imaging agent to the tumor; and (c) administering a Cargomer comprising an anti-cancer agent to the subject if the imaging shows delivery of the imaging agent to the tumor.
Description
5. BRIEF DESCRIPTION OF THE FIGURES
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
6. DETAILED DESCRIPTION
6.1. Cargomers
[0052] The Cargomers of the disclosure comprise 1-8 apolipoprotein molecules (e.g., 1, 2, 4, or 8 lipoprotein molecules) complexed with a sufficient number of amphipathic molecules to solubilize the apolipoprotein molecules. Preferably, Cargomers of the disclosure are not discoidal, for example as determined using NMR spectroscopy, atomic force microscopy, electron microscopy, or other suitable technique known in the art.
[0053] In certain aspects, the apolipoprotein molecules are complexed with the amphipathic molecules in an apolipoprotein:amphipathic molecule molar ratio ranging from 8:1 to 1:15 (e.g., from 8:1 to 1:15, from 7:1 to 1:15, from 6:1 to 1:15, from 5:1 to 1:15, from 4:1 to 1:15, from 3:1 to 1:15, from 2:1 to 1:15, from 1:1 to 1:15, from 8:1 to 1:14, from 7:1 to 1:14, from 6:1 to 1:14, from 5:1 to 1:14, from 4:1 to 1:14, from 3:1 to 1:14, from 2:1 to 1:14, from 1:1 to 1:14, from 8:1 to 1:13, from 7:1 to 1:13, from 6:1 to 1:13, from 5:1 to 1:13, from 4:1 to 1:13, from 3:1 to 1:13, from 2:1 to 1:13, from 1:1 to 1:13, from 8:1 to 1:12, from 7:1 to 1:12, from 6:1 to 1:12, from 5:1 to 1:12, from 4:1 to 1:12, from 3:1 to 1:12, from 2:1 to 1:12, from 1:1 to 1:12, from 8:1 to 1:11, from 7:1 to 1:11, from 6:1 to 1:11, from 5:1 to 1:11, from 4:1 to 1:11, from 3:1 to 1:11, from 2:1 to 1:11, from 1:1 to 1:11, from 8:1 to 1:10, from 7:1 to 1:10, from 6:1 to 1:10, from 5:1 to 1:10, from 4:1 to 1:10, from 3:1 to 1:10, from 2:1 to 1:10, from 1:1 to 1:10, from 8:1 to 1:9, from 7:1 to 1:9, from 6:1 to 1:9, from 5:1 to 1:9, from 4:1 to 1:9, from 3:1 to 1:9, from 2:1 to 1:9, from 1:1 to 1:9, from 8:1 to 1:8, from 7:1 to 1:8, from 6:1 to 1:8, from 5:1 to 1:8, from 4:1 to 1:8, from 3:1 to 1:8, from 2:1 to 1:8, from 1:1 to 1:8, from 8:1 to 1:7, from 7:1 to 1:7, from 6:1 to 1:7, from 5:1 to 1:7, from 4:1 to 1:7, from 3:1 to 1:7, from 2:1 to 1:7, from 1:1 to 1:7, from 8:1 to 1:6, from 7:1 to 1:6, from 6:1 to 1:6, from 5:1 to 1:6, from 4:1 to 1:6, from 3:1 to 1:6, from 2:1 to 1:6, from 1:1 to 1:6, from 8:1 to 1:5, from 7:1 to 1:5, from 6:1 to 1:5, from 5:1 to 1:5, from 4:1 to 1:5, from 3:1 to 1:5, from 2:1 to 1:5, from 1:1 to 1:5, from 8:1 to 1:4, from 7:1 to 1:4, from 6:1 to 1:4, from 5:1 to 1:4, from 4:1 to 1:4, from 3:1 to 1:4, from 2:1 to 1:4, from 1:1 to 1:4, from 8:1 to 1:3, from 7:1 to 1:3, from 6:1 to 1:3, from 5:1 to 1:3, from 4:1 to 1:3, from 3:1 to 1:3, from 2:1 to 1:3, from 1:1 to 1:3, from 8:1 to 1:2, from 7:1 to 1:2, from 6:1 to 1:2, from 5:1 to 1:2, from 4:1 to 1:2, from 3:1 to 1:2, from 2:1 to 1:2, from 1:1 to 1:2, from 8:1 to 1:1, from 7:1 to 1:1, from 6:1 to 1:1, from 5:1 to 1:1, from 4:1 to 1:1, from 3:1 to 1:1, or from 2:1 to 1:1).
[0054] In some embodiments, the apolipoprotein molecules are complexed with the amphipathic molecules in an apolipoprotein:amphipathic molecule molar ratio ranging from 6:1 to 1:6 (e.g., from 5:1 to 1:6, from 4:1 to 1:6, from 3:1 to 1:6, from 2:1 to 1:6, from 5:1 to 1:5, from 4:1 to 1:5, from 3:1 to 1:5, from 2:1 to 1:5, from 5:1 to 1:4, from 4:1 to 1:4, from 3:1 to 1:4, from 2:1 to 1:4, from 5:1 to 1:3, from 4:1 to 1:3, from 3:1 to 1:3, from 2:1 to 1:3, from 5:1 to 1:2, from 4:1 to 1:2, from 3:1 to 1:2, from 2:1 to 1:2, from 5:1 to 1:1, from 4:1 to 1:1, from 3:1 to 1:1, from 2:1 to 1:1, from 1:1 to 1:6, from 1:1 to 1:5, from 1:1 to 1:4, from 1:1 to 1:3, from 1:1 to 1:2, from 1:2 to 1:6, from 1:2 to 1:5, from 1:2 to 1:4, from 1:2 to 1:3, from 1:3 to 1:6, from 1:3 to 1:5, from 1:3 to 1:4, from 1:4 to 1:6, from 1:4 to 1:5, from 1:5 to 1:6, from 1.5:1 to 1:2, from 5:4 to 4:5, from 5:3 to 3:5, from 5:2 to 2:5, or from 3:2 to 2:3).
[0055] Cargomers include one or more cargo moieties, which are optionally coupled to the Cargomers via an anchor and/or linker. In some embodiments, at least one of the cargo moieties, a majority of the cargo moieties, or all of the cargo moieties in a Cargomer are coupled to the Cargomer via anchors. In some embodiments, at least one of the cargo moieties in a Cargomer is coupled to the Cargomer via an anchor. In some embodiments, a majority of the cargo moieties in a Cargomer are coupled to the Cargomer via anchors. In some embodiments, all of the cargo moieties in a Cargomer are coupled to the Cargomer via anchors. Each anchor in a Cargomer can be the same or, alternatively, different types of anchors can be included in a single Cargomer (e.g., one type of cargo moiety can be coupled to the Cargomer via one type of anchor and a second type of cargo moiety can be coupled to the Cargomer via a second type of anchor).
[0056] An anchor as used herein refers to an amphipathic or apolar moiety that is covalently bound to a cargo moiety and which is non-covalently coupled to the apolipoprotein in the Cargomer, either directly or, where the Cargomer includes an amphipathic molecule other than the anchor moiety, via another amphipathic molecule in the Cargomer. The use of an amphipathic anchor moiety can, in certain embodiments, contribute to the apolipoprotein: amphipathic molecule molar ratio. In other embodiments, the amphipathic anchor molecule is not used in the apolipoprotiein: amphipathic molecule molar ratio calculation.
[0057] A linker as used herein refers to a moiety that covalently links a cargo moiety to an apolipoprotein molecule, an amphipathic molecule, or an anchor.
[0058] The molar ratio of apolipoprotein molecules to amphipathic molecules can be but does not necessarily have to be in integers or reflect a one to one relationship between the apolipoprotein and amphipathic molecules. By way of example and not limitation, a Cargomer can have an apolipoprotein to amphipathic molecule molar ratio of 2:5, 8:7, 3:2, or 4:7.
[0059] The amphipathic molecules, cargo moieties, anchors and linkers, if present, can together contribute a net charge of at least +1 or ?1 per apolipoprotein in the Cargomer (e.g., +1, +2, +3, ?1, ?2, or ?3). In some embodiments, for example when a cargo moiety comprises an oligonucleotide such as a siRNA, the amphipathic molecules, cargo moieties, anchors and linkers, if present, can together contribute a net charge of more than 3 (e.g., 5 to 30, 5 to 20, 5 to 10, 10 to 30, 10 to 20, or 20 to 30). In some embodiments, the net charge is a negative charge. In other embodiments, the net charge is a positive charge. Unless required otherwise by context, charge is measured at physiological pH.
[0060] Cargomers of the disclosure can be made, for example, by combining and mixing a composition comprising apolipoprotein molecules (e.g., a composition comprising multimer aggregates of apolipoprotein) with a solution comprising the amphipathic molecules (e.g., a solution comprising the amphipathic molecules alone or a solution comprising the amphipathic molecules and cargo moieties).
[0061] For example, Cargomers can be prepared by mixing two organic solutions, one containing an apolipoprotein and the other one containing a charged amphipathic molecule, then removing the solvent by methods such as evaporation, freeze-drying (lyophilization), spray-drying, heating or any other method known in the art. Cargomers can also be prepared by mixing two aqueous solutions, one containing an apolipoprotein and the other one containing a charged amphipathic molecule, until an homogeneous solution is obtained. Cargomers can also be prepared by hydrating an apolipoprotein with an aqueous solution of charged amphipathic molecules, then mixing until an homogeneous solution is obtained. The solutions used to make Cargomers, e.g., aqueous solutions, can be at room temperature, at a higher temperature than room temperature, or at a lower temperature than room temperature during formation of the Cargomers. Alternatively, the solutions can be thermal cycled between a higher and lower temperature, e.g., as described in Example 1 or WO 2012/109162, preferably until Cargomers of at least 85%, at least 90%, at least 95% or at least 98% homogeneity are obtained. If the solution comprising the amphipathic molecules does not contain the cargo moieties, a solution comprising the cargo moieties can be combined and mixed with the solution containing the apolipoprotein and amphipathic molecules (e.g., before thermal cycling).
[0062] Without being bound by theory, it is believed that the process of making Cargomers results in the formation of multiple species of Cargomers having different numbers of apolipoprotein molecules in equilibrium. It is known in the art that the self-association of lipid-free ApoA-I is influenced by conditions such as pH, concentration, ionic strength, and temperature (see, e.g., Gianazza et al., 1997, Biochemistry, 36:7898-7905; Jayaraman et al., Journal of Biological Chemistry, 286(41):35610-35623; Schonfeld et al., 2016 J. Phys. Chem. B, 120:1228-1235) and it is believed that the equilibrium between different Cargomer species is similarly influenced by pH, concentration, ionic strength, and temperature. For example, acidic pH promotes formation of monomeric ApoA-I whereas alkaline pH encourages formation of multimeric forms, low concentrations of ApoA-I favor monomeric ApoA-I whereas high concentrations favor multimeric forms, and monomeric forms of ApoA-I are favored as temperature increases or decreases from ApoA-I's self-association maximum of 22? C. Once the Cargomers are formed, they are believed to be relatively stable and may not be as susceptible to dissociation compared to lipid-free apolipoprotein.
[0063] In some embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:1. In other embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:2. In yet other embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:3. In yet other embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:4. In yet other embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:5. In yet other embodiments, the ratio of the apolipoprotein molecules to amphipathic molecules is about 1:6.
[0064] In some embodiments, a Cargomer comprises 1 apolipoprotein molecule.
[0065] In other embodiments, a Cargomer comprises 2 apolipoprotein molecules. Cargomers comprising 2 apolipoprotein molecules preferably have a Stokes radius of 5 nm or less (e.g., 4 nm or less or 3 nm or less). The size of a Cargomer is believed to generally depend on the size of the Cargo moiety, such that Cargomers comprising a relatively large cargo moiety are expected to generally have a larger Stokes radius than a Cargomer having a smaller cargo moiety. In some embodiments, a Cargomer can comprise 2 apolipoprotein molecules and 1, 2, or 3 negatively charged amphipathic molecules (e.g., negatively charged phospholipid molecules) per apolipoprotein molecule.
[0066] In other embodiments, a Cargomer comprises 4 apolipoprotein molecules. Cargomers comprising 4 apolipoprotein molecules preferably have a Stokes radius of 5 nm or less (e.g., 4 nm or less or 3 nm or less). In some embodiments, a Cargomer can comprise 4 apolipoprotein molecules and 1, 2, or 3 negatively charged amphipathic molecules (e.g., negatively charged phospholipid molecules) per apolipoprotein molecule.
[0067] In other embodiments, a Cargomer comprises 8 apolipoprotein molecules. Cargomers comprising 8 apolipoprotein molecules preferably have a Stokes radius of 5 nm or less (e.g., 4 nm or less or 3 nm or less). In some embodiments, a Cargomer can comprise 8 apolipoprotein molecules and 1, 2, or 3 negatively charged amphipathic molecules (e.g., negatively charged phospholipid molecules) per apolipoprotein molecule. In certain embodiments, the Cargomers of the disclosure do not contain cholesterol and/or a cholesterol derivative (e.g., a cholesterol ester).
[0068] The Cargomers of the disclosure are preferably soluble in a biological fluid, for example one or more of lymph, cerebrospinal fluid, vitreous humor, aqueous humor, and blood or a blood fraction (e.g., serum or plasma).
[0069] Cargomers may include a targeting functionality, for example to target the Cargomers to a particular cell or tissue type, or to an infectious agent. In some embodiments, the Cargomer includes a targeting moiety attached to an apolipoprotein molecule or an amphipathic molecule. In some embodiments, one or more cargo moieties that are incorporated into the Cargomer has a targeting capability.
6.1.1. Apolipoproteins
[0070] Suitable apolipoproteins that can be included in the Cargomers of the disclosure include apolipoproteins ApoA-I, ApoA-II, ApoA-IV, ApoA-V, ApoB, ApoC-I, ApoC-II, ApoC-III, ApoD, ApoE, ApoJ, ApoH, and any combination of two or more of the foregoing. Polymorphic forms, isoforms, variants and mutants as well as truncated forms of the foregoing apolipoproteins, the most common of which are Apolipoprotein A-I.sub.Milano (ApoA-I.sub.M), Apolipoprotein A-I.sub.Paris (ApoA-I.sub.P), and Apolipoprotein A-I.sub.Zaragoza (ApoA-I.sub.Z), can also be used. Apolipoproteins mutants containing cysteine residues are also known, and can also be used (see, e.g., U.S. Publication No. 2003/0181372). The apolipoproteins can be modified in their primary sequence to render them less susceptible to oxidations, for example, as described in U.S. Publication Nos. 2008/0234192 and 2013/0137628, and U.S. Pat. Nos. 8,143,224 and 8,541,236. The apolipoproteins can include residues corresponding to elements that facilitate their isolation, such as His tags, or other elements designed for other purposes. Preferably, the apolipoprotein in the Cargomer is soluble in a biological fluid (e.g., lymph, cerebrospinal fluid, vitreous humor, aqueous humor, blood, or a blood fraction (e.g., serum or plasma).
[0071] In some embodiments, an additional peptide can be included in a Cargomer in addition to an apolipoprotein. Such additional peptides include apolipoprotein fragments, peptide agonists of apolipoproteins, peptide analogues of apolipoproteins, and amphipathic peptides. These peptides can be made with natural amino acids, D-amino acids or can contain natural and/or non-natural amino acids. Exemplary peptide agonists are described in U.S. Pat. Nos. 6,004,925, 6,037,323, 6,046,166, and 6,265,377, the contents of which are incorporated herein by reference in their entireties.
[0072] Apolipoproteins can be purified from animal sources (and in particular from human sources) or produced recombinantly as is well-known in the art, see, e.g., Chung et al., 1980, J. Lipid Res. 21(3):284-91; Cheung et al., 1987, J. Lipid Res. 28(8):913-29. See also U.S. Pat. Nos. 5,059,528, 5,128,318, 6,617,134; U.S. Publication Nos. 2002/0156007, 2004/0067873, 2004/0077541, and 2004/0266660; and PCT Publications Nos. WO 2008/104890 and WO 2007/023476. Other methods of purification are also possible, for example as described in PCT Publication No. WO 2012/109162, the disclosure of which is incorporated herein by reference in its entirety.
[0073] The apolipoprotein can be in prepro-form, pro-form, or mature form. For example, a Cargomer can comprise ApoA-I (e.g., human ApoA-I) in which the ApoA-I is preproApoA-I, proApoA-I, or mature ApoA-I. In some embodiments, the Cargomer comprises ApoA-I that has at least 90% sequence identity to SEQ ID NO:2. In other embodiments, the Cargomer comprises ApoA-I that has at least 95% sequence identity to SEQ ID NO:2. In other embodiments, the Cargomer comprises ApoA-I that has at least 98% sequence identity to SEQ ID NO:2. In other embodiments, the Cargomer comprises ApoA-I that has at least 99% sequence identity to SEQ ID NO:2. In other embodiments, the Cargomer comprises ApoA-I that has 100% sequence identity to SEQ ID NO:2.
[0074] The apolipoprotein molecule(s) can comprise a chimeric apolipoprotein comprising an apolipoprotein and one or more attached functional moieties, such as for example, one or more targeting moieties, a moiety having a desired biological activity, an affinity tag to assist with purification, and/or a reporter molecule for characterization or localization studies. An attached moiety with biological activity may have an activity that is capable of augmenting and/or synergizing with the biological activity of a cargo moiety incorporated into a Cargomer. For example, a moiety with biological activity may have antimicrobial (for example, antifungal, antibacterial, anti-protozoal, bacteriostatic, fungistatic, or antiviral) activity. In one embodiment, an attached functional moiety of a chimeric apolipoprotein is not in contact with hydrophobic surfaces of the Cargomer. In another embodiment, an attached functional moiety is in contact with hydrophobic surfaces of the Cargomer. In some embodiments, a functional moiety of a chimeric apolipoprotein may be intrinsic to a natural protein. In some embodiments, a chimeric apolipoprotein includes a ligand or sequence recognized by or capable of interaction with a cell surface receptor or other cell surface moiety.
[0075] In one embodiment, a chimeric apolipoprotein includes a targeting moiety that is not intrinsic to the native apolipoprotein, such as for example, S. cerevisiae ?-mating factor peptide, folic acid, transferrin, or lactoferrin. In another embodiment, a chimeric apolipoprotein includes a moiety with a desired biological activity that augments and/or synergizes with the activity of a cargo moiety incorporated into the Cargomer. In one embodiment, a chimeric apolipoprotein may include a functional moiety intrinsic to an apolipoprotein. One example of an apolipoprotein intrinsic functional moiety is the intrinsic targeting moiety formed approximately by amino acids 130-150 of human ApoE, which comprises the receptor binding region recognized by members of the low density lipoprotein receptor family. Other examples of apolipoprotein intrinsic functional moieties include the region of ApoB-100 that interacts with the low density lipoprotein receptor and the region of ApoA-I that interacts with scavenger receptor type B 1. In other embodiments, a functional moiety may be added synthetically or recombinantly to produce a chimeric apolipoprotein. Another example is an apolipoprotein with the prepro or pro sequence from another preproapolipoprotein (e.g., prepro sequence from preproapoA-II substituted for the prepro sequence of preproapoA-I). Another example is an apolipoprotein for which some of the amphipathic sequence segments have been substituted by other amphipathic sequence segments from another apolipoprotein.
[0076] As used herein, chimeric refers to two or more molecules that are capable of existing separately and are joined together to form a single molecule having the desired functionality of all of its constituent molecules. The constituent molecules of a chimeric molecule may be joined synthetically by chemical conjugation or, where the constituent molecules are all polypeptides or analogs thereof, polynucleotides encoding the polypeptides may be fused together recombinantly such that a single continuous polypeptide is expressed. Such a chimeric molecule is termed a fusion protein. A fusion protein is a chimeric molecule in which the constituent molecules are all polypeptides and are attached (fused) to each other such that the chimeric molecule forms a continuous single chain. The various constituents can be directly attached to each other or can be coupled through one or more linkers. One or more segments of various constituents can be, for example, inserted in the sequence of an apolipoprotein, or, as another example, can be added N-terminal or C-terminal to the sequence of an apolipoprotein. For example, a fusion protein can comprise an antibody light chain, an antibody fragment, a heavy-chain antibody, or a single-domain antibody.
[0077] In some embodiments, a chimeric apolipoprotein is prepared by chemically conjugating the apolipoprotein and the functional moiety to be attached. Means of chemically conjugating molecules are well known to those of skill in the art. Such means will vary according to the structure of the moiety to be attached, but will be readily ascertainable to those of skill in the art. Polypeptides typically contain a variety of functional groups, e.g., carboxylic acid (COOH), free amino (NH2), or sulfhydryl (SH) groups, that are available for reaction with a suitable functional group on the functional moiety or on a linker to bind the moiety thereto. A functional moiety may be attached at the N-terminus, the C-terminus, or to a functional group on an interior residue (i.e., a residue at a position intermediate between the N- and C-termini) of an apolipoprotein molecule. Alternatively, the apolipoprotein and/or the moiety to be tagged can be derivatized to expose or attach additional reactive functional groups.
[0078] In some embodiments, fusion proteins that include a polypeptide functional moiety are synthesized using recombinant expression systems. Typically, this involves creating a nucleic acid (e.g., DNA) sequence that encodes the apolipoprotein and the functional moiety such that the two polypeptides will be in frame when expressed, placing the DNA under the control of a promoter, expressing the protein in a host cell, and isolating the expressed protein.
[0079] A nucleic acid encoding a chimeric apolipoprotein can be incorporated into a recombinant expression vector in a form suitable for expression in a host cell. As used herein, an expression vector is a nucleic acid which, when introduced into an appropriate host cell, can be transcribed and translated into a polypeptide. The vector may also include regulatory sequences such as promoters, enhancers, or other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are known to those skilled in the art (see, e.g., Goeddel, 1990, Gene Expression Technology: Meth. Enzymol. 185, Academic Press, San Diego, Calif.; Berger and Kimmel, Guide to Molecular Cloning Techniques, Methods in Enzymology 152 Academic Press, Inc., San Diego, Calif.; Sambrook et al., 1989, Molecular CloningA Laboratory Manual (2nd ed.) Vol. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor Press, NY, etc.).
[0080] In some embodiments, an apolipoprotein has been modified such that when the apolipoprotein is incorporated into a Cargomer, the modification will increase stability of the Cargomer, confer targeting ability or increase capacity. In one embodiment, the modification includes introduction of cysteine residues into apolipoprotein molecules to permit formation of intramolecular or intermolecular disulfide bonds, e.g., by site-directed mutagenesis. In another embodiment, a chemical crosslinking agent is used to form intermolecular links between apolipoprotein molecules to enhance stability of the Cargomers. Intermolecular crosslinking prevents or reduces dissociation of apolipoprotein molecules from the Cargomers and/or prevents displacement by endogenous apolipoprotein molecules within an individual to whom the Cargomers are administered. In other embodiments, an apolipoprotein is modified either by chemical derivatization of one or more amino acid residues or by site directed mutagenesis, to confer targeting ability to or recognition by a cell surface receptor.
[0081] Cargomers can be targeted to a specific cell surface receptor by engineering receptor recognition properties into an apolipoprotein. For example, Cargomers may be targeted to a particular cell type known to harbor a particular type of infectious agent, for example by modifying the apolipoprotein to render it capable of interacting with a receptor on the surface of the cell type being targeted. For example, Cargomers may be targeted to macrophages by altering the apolipoprotein to confer recognition by the macrophage endocytic class A scavenger receptor (SR-A). SR-A binding ability can be conferred to a Cargomer by modifying the apolipoprotein by site directed mutagenesis to replace one or more positively charged amino acids with a neutral or negatively charged amino acid. SR-A recognition can also be conferred by preparing a chimeric apolipoprotein that includes an N- or C-terminal extension having a ligand recognized by SR-A or an amino acid sequence with a high concentration of negatively charged residues. Cargomers can also interact with apolipoprotein receptors such as, but not limited to, ABCA1 receptors, ABCG1 receptors, CD36, Megalin, Cubulin and HDL receptors such as SR-B1.
[0082] The SR-B1 and other HDL receptors (e.g., ABCA1) are scavenger receptors essential to cell homeostasis, proliferation, and growth that can be up-regulated in cancer cells. Therefore, Cargomers of the disclosure can be used to target delivery of therapeutic agents (e.g., as described in Section 6.1.3.2) to cancer cells and tumors via the expression of SR-B1 and other HDL receptors on the surface of cancer cells.
6.1.2. Amphipathic Molecules
[0083] An amphipathic molecule is a molecule that possesses both hydrophobic (apolar) and hydrophilic (polar) elements. Amphipathic molecules that can be used in the Cargomers of the disclosure include lipids, detergents, fatty acids, and apolar molecules and sterols covalently attached to polar molecules such as, but not limited to, sugars or nucleic acids. The Cargomers of the disclosure can include a single class of amphipathic molecule (e.g., a single species of phospholipids or a mixture of phospholipids), or can contain a combination of classes of amphipathic molecules (e.g., phospholipids and detergents). The Cargomer can contain one species of amphipathic molecules or a combination of amphipathic molecules configured to facilitate solubilization of the apolipoprotein molecule(s).
6.1.2.1. Lipids
[0084] The Cargomers of the disclosure can include one or more lipids. In various embodiments, one or more lipids can be saturated and/or unsaturated, natural and/or synthetic, charged or not charged, zwitterionic or not. Phospholipids can have two acyl chains that are the same or different (for example, chains having a different number of carbon atoms, a different degree of saturation between the acyl chains, different branching of the acyl chains, or a combination thereof). The lipid can also be modified to contain a fluorescent probe (e.g., as described at avantilipids.com/product-category/products/fluorescent-lipids/). Preferably, the lipid comprises at least one phospholipid.
[0085] Phospholipids can have unsaturated or saturated acyl chains ranging from about 6 to about 24 carbon atoms (e.g., 6-20, 6-16, 6-12, 12-24, 12-20, 12-16, 16-24, 16-20, or 20-24). In some embodiments, a phospholipid used in a Cargomer has one or two acyl chains of 12, 14, 16, 18, 20, 22, or 24 carbons (e.g, two acyl chains of the same length or two acyl chains of different length).
[0086] Non-limiting examples of acyl chains present in commonly occurring fatty acids that can be included in phospholipids are provided in Table 1, below:
TABLE-US-00001 TABLE 1 Length:Number of Unsaturations Common Name 14:0 myristic acid 16:0 palmitic acid 18:0 stearic acid 18:1 cis?.sup.9 oleic acid 18:2 cis?.sup.9,12 linoleic acid 18:3 cis?.sup.9,12,15 linonenic acid 20:4 cis?.sup.5,8,11,14 arachidonic acid 20:5 cis?.sup.5,8,11,14,17 eicosapentaenoic acid (an omega-3 fatty acid)
[0087] Lipids that can be present in the Cargomers include, but are not limited to, small alkyl chain phospholipids, egg phosphatidylcholine, soybean phosphatidylcholine, dipalmitoylphosphatidylcholine, dimyristoylphosphatidylcholine, distearoylphosphatidylcholine 1-myristoyl-2-palmitoyl phosphatidylcholine, 1-palmitoyl-2-myristoylphosphatidylcholine, 1-palmitoyl-2-stearoylphosphatidylcholine, 1-stearoyl-2-palmitoylphosphatidylcholine, dioleoylphosphatidylcholine dioleophosphatidylethanolamine, dilauroylphosphatidylglycerol phosphatidylcholine, phosphatidylserine, phosphatidylethanolamine, phosphatidylinositol, phosphatidylglycerols, diphosphatidylglycerols such as dimyristoylphosphatidylglycerol, di palmitoylphosphatidylglycerol, distearoylphosphatidylglycerol, dioleoylphosphatidylglycerol, dimyristoylphosphatidic acid, dipalmitoylphosphatidic acid, dimyristoylphosphatidylethanolamine, dipalmitoylphosphatidylethanolamine, dimyristoylphosphatidylserine, dipalmitoylphosphatidylserine, brain phosphatidylserine, brain sphingomyelin, palmitoylsphingomyelin, dipalmitoylsphingomyelin, egg sphingomyelin, milk sphingomyelin, phytosphingomyelin, distearoylsphingomyelin, dipalmitoylphosphatidylglycerol salt, phosphatidic acid, galactocerebroside, gangliosides, cerebrosides, dilaurylphosphatidylcholine, (1,3)-D-mannosyl-(1,3)diglyceride, aminophenylglycoside, 3-cholesteryl-6-(glycosylthio)hexyl ether glycolipids, and cholesterol and its derivatives. Synthetic lipids, such as synthetic palmitoylsphingomyelin or N-palmitoyl-4-hydroxysphinganine-1-phosphocholine (a form of phytosphingomyelin) can be used to minimize lipid oxidation.
[0088] In some embodiments, the Cargomer includes two types of phospholipids: a neutral lipid, e.g., lecithin and/or sphingomyelin (abbreviated SM or SPH), and a charged phospholipid (e.g., a negatively charged phospholipid). A neutral phospholipid has a net charge of about zero at physiological pH. In many embodiments, neutral phospholipids are zwitterions, although other types of net neutral phospholipids are known and can be used. In some embodiments, the molar ratio of the charged phospholipid (e.g., negatively charged phospholipid) to neutral phospholipid ranges from 1:1 to 1:3, for example, about 1:1, about 1:2, or about 1:3.
[0089] The neutral phospholipid can comprise, for example, one or both of the lecithin and/or SM, and can optionally include other neutral phospholipids. In some embodiments, the neutral phospholipid comprises lecithin, but not SM. In other embodiments, the neutral phospholipid comprises SM, but not lecithin. In still other embodiments, the neutral phospholipid comprises both lecithin and SM. All of these specific exemplary embodiments can include neutral phospholipids in addition to the lecithin and/or SM, but in many embodiments do not include such additional neutral phospholipids.
[0090] The identity of the SM used is not critical for success. Thus, as used herein, the expression SM includes sphingomyelins derived or obtained from natural sources, as well as analogs and derivatives of naturally occurring SMs that are impervious to hydrolysis by LCAT, as is naturally occurring SM. SM is a phospholipid very similar in structure to lecithin, but, unlike lecithin, it does not have a glycerol backbone, and hence does not have ester linkages attaching the acyl chains. Rather, SM has a ceramide backbone, with amide linkages connecting the acyl chains. The SM can be obtained from virtually any source. For example, the SM can be obtained from milk, egg or brain. SM analogues or derivatives can also be used. Non-limiting examples of useful SM analogues and derivatives include, but are not limited to, palmitoylsphingomyelin, N-palmitoyl-4-hydroxysphinganine-1-phosphocholine (a form of phytosphingomyelin), palmitoylsphingomyelin, stearoylsphingomyelin, D-erythro-N-16:0-sphingomyelin and its dihydro isomer, D-erythro-N-16:0-dihydro-sphingomyelin. Synthetic SM such as synthetic palmitoylsphingomyelin or N-palmitoyl-4-hydroxysphinganine-1-phosphocholine (phytosphingomyelin) can be used in order to produce more homogeneous complexes and with fewer contaminants and/or oxidation products than sphingolipids of animal origin. Methods for synthesizing SM are described in U.S. Publication No. 2016/0075634.
[0091] Sphingomyelins isolated from natural sources can be artificially enriched in one particular saturated or unsaturated acyl chain. For example, milk sphingomyelin (Avanti Phospholipid, Alabaster, Ala.) is characterized by long saturated acyl chains (i.e., acyl chains having 20 or more carbon atoms). In contrast, egg sphingomyelin is characterized by short saturated acyl chains (i.e., acyl chains having fewer than 20 carbon atoms). For example, whereas only about 20% of milk sphingomyelin comprises C16:0 (16 carbon, saturated) acyl chains, about 80% of egg sphingomyelin comprises C16:0 acyl chains. Using solvent extraction, the composition of milk sphingomyelin can be enriched to have an acyl chain composition comparable to that of egg sphingomyelin, or vice versa.
[0092] The SM can be semi-synthetic such that it has particular acyl chains. For example, milk sphingomyelin can be first purified from milk, then one particular acyl chain, e.g., the C16:0 acyl chain, can be cleaved and replaced by another acyl chain. The SM can also be entirely synthesized, by e.g., large-scale synthesis. See, e.g., Dong et al., U.S. Pat. No. 5,220,043, entitled Synthesis of D-erythro-sphingomyelins, issued Jun. 15, 1993; Weis, 1999, Chem. Phys. Lipids 102 (1-2):3-12. SM can be fully synthetic, e.g., as described in U.S. Publication No. 2014/0275590.
[0093] The lengths and saturation levels of the acyl chains comprising a semi-synthetic or a synthetic SM can be selectively varied. The acyl chains can be saturated or unsaturated, and can contain from about 6 to about 24 carbon atoms. Each chain can contain the same number of carbon atoms or, alternatively each chain can contain different numbers of carbon atoms. In some embodiments, the semi-synthetic or synthetic SM comprises mixed acyl chains such that one chain is saturated and one chain is unsaturated. In such mixed acyl chain SMs, the chain lengths can be the same or different. In other embodiments, the acyl chains of the semi-synthetic or synthetic SM are either both saturated or both unsaturated. Again, the chains can contain the same or different numbers of carbon atoms. In some embodiments, both acyl chains comprising the semi-synthetic or synthetic SM are identical. In a specific embodiment, the chains correspond to the acyl chains of a naturally-occurring fatty acid, such as for example oleic, palmitic or stearic acid. In another embodiment, SM with saturated or unsaturated functionalized chains is used. In another specific embodiment, both acyl chains are saturated and contain from 6 to 24 carbon atoms. Non-limiting examples of acyl chains present in commonly occurring fatty acids that can be included in semi-synthetic and synthetic SMs are provided in Table 1, above.
[0094] In some embodiments, the SM is palmitoyl SM, such as synthetic palmitoyl SM, which has C16:0 acyl chains, or is egg SM, which includes as a principal component palmitoyl SM.
[0095] In a specific embodiment, functionalized SM, such as phytosphingomyelin, is used.
[0096] Lecithin can be derived or isolated from natural sources, or it can be obtained synthetically. Examples of suitable lecithins isolated from natural sources include, but are not limited to, egg phosphatidylcholine and soybean phosphatidylcholine. Additional non-limiting examples of suitable lecithins include, dipalmitoylphosphatidylcholine, dimyristoylphosphatidylcholine, distearoylphosphatidylcholine 1-myristoyl-2-palmitoylphosphatidylcholine, 1-palmitoyl-2-myristoylphosphatidylcholine, 1-palmitoyl-2-stearoylphosphatidylcholine, 1-stearoyl-2-palmitoylphosphatidylcholine, 1-palmitoyl-2-oleoylphosphatidylcholine, 1-oleoyl-2-palmitylphosphatidylcholine, dioleoylphosphatidylcholine and the ether derivatives or analogs thereof.
[0097] Lecithins derived or isolated from natural sources can be enriched to include specified acyl chains. In embodiments employing semi-synthetic or synthetic lecithins, the identity(ies) of the acyl chains can be selectively varied, as discussed above in connection with SM. In some embodiments of the Cargomers described herein, both acyl chains on the lecithin are identical. In some embodiments of Cargomers that include both SM and lecithin, the acyl chains of the SM and lecithin are all identical. In a specific embodiment, the acyl chains correspond to the acyl chains of myristitic, palmitic, oleic or stearic acid.
[0098] The Cargomers preferably include one or more negatively charged phospholipids (e.g., alone or in combination with one or more neutral phospholipids). As used herein, negatively charged phospholipids are phospholipids that have a net negative charge at physiological pH. The negatively charged phospholipid can comprise a single type of negatively charged phospholipid, or a mixture of two or more different, negatively charged, phospholipids. In some embodiments, the charged phospholipids are negatively charged glycerophospholipids. Specific examples of suitable negatively charged phospholipids include, but are not limited to, a 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1-glycerol)], a phosphatidylglycerol, a phospatidylinositol, a phosphatidylserine, a phosphatidic acid, and salts thereof (e.g., sodium salts or potassium salts). In some embodiments, the negatively charged phospholipid comprises one or more of phosphatidylinositol, phosphatidylserine, phosphatidylglycerol and/or phosphatidic acid. In a specific embodiment, the negatively charged phospholipid comprises or consists of a salt of a phosphatidylglycerol or a salt of a phosphatidylinositol. In another specific embodiment, the negatively charged phospholipid comprises or consists of 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1-glycerol)], or DPPG, or a salt thereof.
[0099] The negatively charged phospholipids can be obtained from natural sources or prepared by chemical synthesis. In embodiments employing synthetic negatively charged phospholipids, the identities of the acyl chains can be selectively varied, as discussed above in connection with SM. In some embodiments of the Cargomers described herein, both acyl chains on the negatively charged phospholipids are identical. In some embodiments, the acyl chains all types of phospholipids included in a Cargomer are all identical. In a specific embodiment, the Cargomer comprises negatively charged phospholipid(s), and/or SM all having C16:0 or C16:1 acyl chains. In a specific embodiment the fatty acid moiety of the SM is predominantly C16:1 palmitoyl. In one specific embodiment, the acyl chains of the charged phospholipid(s), lecithin and/or SM correspond to the acyl chain of palmitic acid. In yet another specific embodiment, the acyl chains of the charged phospholipid(s), lecithin and/or SM correspond to the acyl chain of oleic acid.
[0100] Cargomers can include one or more positively charged lipids (e.g., alone or in combination with one or more neutral phospholipids). Examples of positively charged phospholipids that can be included in the Cargomers of the disclosure include N1-[2-((1S)-1-[(3-aminopropyl)amino]-4-[di(3-amino-propyl)amino]butylcarboxamido)ethyl]-3,4-di[oleyloxy]-benzamide, 1,2-di-O-octadecenyl-3-trimethylammonium propane, 1,2-dimyristoleoyl-sn-glycero-3-ethylphosphocholine, 1-palmitoyl-2-oleoyl-sn-glycero-3-ethylphosphocholine, 1,2-dioleoyl-sn-glycero-3-ethylphosphocholine, 1,2-distearoyl-sn-glycero-3-ethylphosphocholine, 1,2-dipalmitoyl-sn-glycero-3-ethylphosphocholine, 1,2-dimyristoyl-sn-glycero-3-ethylphosphocholine, 1,2-dilauroyl-sn-glycero-3-ethylphosphocholine, 1,2-dilauroyl-sn-glycero-3-ethylphosphocholine, 1,2-dioleoyl-3-dimethylammonium-propane1,2-dimyristoyl-3-dimethylammonium-propane, 1,2-dipalmitoyl-3-dimethylammonium-propane, N-(4-carboxybenzyl)-N,N-dimethyl-2,3-bis(oleoyloxy)propan-1-aminium, 1,2-dioleoyl-3-trimethylammonium-propane, 1,2-dioleoyl-3-trimethylammonium-propane, 1,2-stearoyl-3-trimethylammonium-propane, 1,2-dipalmitoyl-3-trimethylammonium-propane, 1,2-dimyristoyl-3-trimethylammonium-propane, N-[1-(2,3-dimyristyloxy)propyl]-N, N-dimethyl-N-(2-hydroxyethyl) ammonium bromide, N,N,N-trimethyl-2-bis[(1-oxo-9-octadecenyl)oxy]-(Z,Z)-1propanaminium methyl sulfate, and salts thereof (e.g., chloride or bromide salts). Other positively charged lipids such as stearylamine can also be used.
[0101] The lipids used are preferably at least 95% pure, and/or have reduced levels of oxidative agents (such as but not limited to peroxides). Lipids obtained from natural sources preferably have fewer polyunsaturated fatty acid moieties and/or fatty acid moieties that are not susceptible to oxidation. The level of oxidation in a sample can be determined using an iodometric method, which provides a peroxide value, expressed in milli-equivalent number of isolated iodines per kg of sample, abbreviated meq 0/kg. See, e.g., Gray, 1978, Measurement of Lipid Oxidation: A Review, Journal of the American Oil Chemists Society 55:539-545; Heaton, F. W. and Ur, Improved Iodometric Methods for the Determination of Lipid Peroxides, 1958, Journal of the Science of Food and Agriculture 9:781-786. Preferably, the level of oxidation, or peroxide level, is low, e.g., less than 5 meq 0/kg, less than 4 meq 0/kg, less than 3 meq 0/kg, or less than 2 meq 0/kg.
[0102] Cargomers can in some embodiments include small quantities of additional lipids. Virtually any type of lipids can be used, including, but not limited to, lysophospholipids, galactocerebroside, gangliosides, cerebrosides, glycerides, triglycerides, and sterols and sterol derivatives (e.g., a plant sterol, an animal sterol, such as cholesterol, or a sterol derivative, such as a cholesterol derivative). For example, a Cargomer can contain cholesterol or a cholesterol derivative, e.g., a cholesterol ester. The cholesterol derivative can also be a substituted cholesterol or a substituted cholesterol ester. The Cargomers of the disclosure can also contain an oxidized sterol such as, but not limited to, oxidized cholesterol or an oxidized sterol derivative (such as, but not limited to, an oxidized cholesterol ester). In some embodiments, the Cargomers do not include cholesterol and/or its derivatives (such as a cholesterol ester or an oxidized cholesterol ester).
[0103] The lipid molecules (e.g., phospholipid molecules) can together contribute a net charge of 1-3 (e.g., 1-3, 1-2, 2-3, 1, 2, or 3) per apolipoprotein molecule in the Cargomer. In some embodiments, the net charge is negative. In other embodiments, the net charge is positive.
6.1.2.2. Detergents
[0104] The Cargomers of the disclosure can contain one or more detergents. The detergent can be zwitterionic, nonionic, cationic, anionic, or a combination thereof. Exemplary zwitterionic detergents include 3-[(3-Cholamidopropyl)dimethylammonio]-1-propanesulfonate (CHAPS), 3-[(3-Cholamidopropyl)dimethylammonio]-2-hydroxy-1-propanesulfonate (CHAPSO), and N,N-dimethyldodecylamine N-oxide (LDAO). Exemplary nonionic detergents include D-(+)-trehalose 6-monooleate, N-octanoyl-N-methylglucamine, N-nonanoyl-N-methylglucamine, N-decanoyl-N-methylglucamine, 1-(7Z-hexadecenoyl)-rac-glycerol, 1-(8Z-hexadecenoyl)-rac-glycerol, 1-(8Z-heptadecenoyl)-rac-glycerol, 1-(9Z-hexadecenoyl)-rac-glycerol, 1-decanoyl-rac-glycerol. Exemplary cationic detergents include (S)-O-methyl-serine dodecylamide hydrochloride, dodecylammonium chloride, decyltrimethylammonium bromide, and cetyltrimethylammonium sulfate. Exemplary anionic detergents include cholesteryl hemisuccinate, cholate, alkyl sulfates, and alkyl sulfonates.
[0105] In some embodiments, the Cargomers of the disclosure lack detergents.
6.1.2.3. Fatty Acids
[0106] The Cargomers can contain one or more fatty acids. The one or more fatty acids can include short-chain fatty acids having aliphatic tails of five or fewer carbons (e.g. butyric acid, isobutyric acid, valeric acid, or isovaleric acid), medium-chain fatty acids having aliphatic tails of 6 to 12 carbons (e.g., caproic acid, caprylic acid, capric acid, or lauric acid), long-chain fatty acids having aliphatic tails of 13 to 21 carbons (e.g., myristic acid, palmitic acid, stearic acid, or arachidic acid), very long chain fatty acids having aliphatic tails of 22 or more carbons (e.g., behenic acid, lignoceric acid, or cerotic acid), or a combination thereof. The one or more fatty acids can be saturated (e.g., caprylic acid, capric acid, lauric acid, myristic acid, palmitic acid, stearic acid, arachidic acid, behenic acid, lignoceric acid, or cerotic acid), unsaturated (e.g., myristoleic acid, palmitoleic acid, sapienic acid, oleic acid, elaidic acid, vaccenic acid, linoleic acid, linoelaidic acid, ?-linolenic acid, arachidonic acid, eicosapentaenoic acid, erucic acid, or docosahexaenoic acid) or a combination thereof. Unsaturated fatty acids can be cis or trans fatty acids. In some embodiments, unsaturated fatty acids used in the Cargomers of the disclosure are cis fatty acids.
6.1.2.4. Apolar Molecules and Sterols Attached to a Sugar
[0107] The Cargomers can contain one or more amphipathic molecules that comprise an apolar molecule or moiety (e.g., a hydrocarbon chain, an acyl or diacyl chain) or a sterol (e.g., cholesterol) attached to a sugar (e.g., a monosaccharide such as glucose or galactose, or a disaccharide such as maltose or trehalose). The sugar can be a modified sugar or a substituted sugar. Exemplary amphipathic molecules comprising an apolar molecule attached to a sugar include dodecan-2-yloxy-?-D-maltoside, tridecan-3-yloxy-?-D-maltoside, tridecan-2-yloxy-?-D-maltoside, n-dodecyl-?-D-maltoside (DDM), n-octyl-?-D-glucoside, n-nonyl-?-D-glucoside, n-decyl-?-D-maltoside, n-dodecyl-?-D-maltopyranoside, 4-n-Dodecyl-?,?-trehalose, 6-n-dodecyl-?,?-trehalose, and 3-n-dodecyl-?,?-trehalose.
6.1.3. Cargo Moieties
[0108] The Cargomers of the disclosure comprise one or more cargo moieties (e.g., one, two, or three cargo moieties per Cargomer). In some embodiments, a Cargomer has 1 to 25 cargo moieties (e.g., 1 to 5, 1 to 10, 1 to 15, 1 to 20, 5 to 10, 5 to 15, 5 to 20, 10 to 25, 10 to 20, 10 to 15, 15 to 25, 15 to 20, or 20 to 25 cargo moieties). A Cargomer can have, for example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 cargo moieties.
[0109] A cargo moiety can be, for example, a molecule or molecular assembly that is biologically active or has diagnostic utility (e.g., as described in Sections 6.1.3.1 to 6.1.3.10).
[0110] The cargo moiety can be an amphipathic molecule, for example, a ganglioside. Where the cargo moiety is amphipathic, the Cargomer need not include other amphipathic molecules, for example to solubilize the apolipoprotein, although Cargomers that include amphipathic cargo moieties and additional amphipathic molecules are within the scope of the present invention.
[0111] The cargo moiety need not be amphipathic. In such instances, the cargo moiety can be non-covalently or covalently attached to another component in the Cargomer. By way of example but not limitation, the cargo moeity can be (a) non-covalently bound to an apolar region of the Cargomer (e.g., an apolar core of a Cargomer formed by apolar regions of apolipoprotein molecules), (b) coupled to the Cargomer by being grafted to an amphipathic or apolar anchor that can non-covalently bind to an apolar region of the Cargomer (directly or via a linker) or (c) covalently coupled to an apolipoprotein molecule, for example, via a direct bond or via a linker.
[0112] The cargo moiety can be charged or uncharged. Charged cargo moieties can contribute a net charge (either positive or negative) of 1, 2, 3, or more than 3 per apolipoprotein in the Cargomer. In some embodiments the cargo moiety contributes a net charge of 1 (positive or negative) per apolipoprotein molecule in the Cargomer. In some embodiments the cargo moiety contributes a net charge of 2 (positive or negative) per apolipoprotein molecule in the Cargomer. In some embodiments the cargo moiety contributes a net charge of 3 (positive or negative) per apolipoprotein molecule in the Cargomer. In some embodiments the cargo moiety contributes a net charge of more than 3 (positive or negative) per apolipoprotein molecule in the Cargomer. In other embodiments, charged cargo moieties can contribute a net charge (either positive or negative) of 1, 2, 3, or more than 3 to the Cargomer. In some embodiments, the cargo moiety contributes a net charge of 1 (positive or negative) to the Cargomer. In some embodiments, the cargo moiety contributes a net charge of 2 (positive or negative) to the Cargomer. In some embodiments, the cargo moiety contributes a net charge of 3 (positive or negative) to the Cargomer. In some embodiments, the cargo moiety contributes a net charge of more than 3 (positive or negative) to the Cargomer. For example, a nucleic acid cargo moiety can have a relatively large charge.
[0113] Suitable cargo moieties include therapeutic agents, diagnostic agents, immunogens and adjuvants. Diagnostic agents that can be included are labeled agents such as gold labeled agents, labeled agents with stable isotopes, labeled agents with radioactive isotopes and labeled agents with fluorescent probes. Therapeutic agents that can be included in the Cargomer include immunoinhibitory agents, immunostimulatory agents, anti-cancer agents, anti-infective agents, nucleic acid drugs, anti-inflammatory agents, agents for treating cardiovascular disorders, caspase inhibitors and bioactive molecules. Unless required otherwise by context, identification of a specific agent encompasses salts thereof. Thus, for example, recitation of warfarin encompasses warfarin sodium, recitation of clopidogrel encompasses clopidogrel bisulfate, etc.
[0114] Cargomers can comprise a cargo moiety which targets the Cargomer to a desired body region (e.g., a target organ). The targeting feature can be part of, and or separate from, the therapeutic agent, diagnostic agent, immunogen or adjuvant. Such cargo moieties can assist in delivery of the Cargomers to desired body regions (e.g., bodily regions affected by a cardiovascular related disorder) and, in some instances, altogether deliver a biological (e.g., therapeutic) effect to the desired body region. Examples of targeting agents which can be included in a Cargomer include an antibody or antibody fragment (e.g. an antibody composed of two heavy chains and two light chains, an Fab fragment, a heavy chain antibody, or a single domain antibody), receptor ligand, hormone, vitamin, and antigen. In some embodiments, the antibody or antibody fragment is specific for a disease-specific antigen. In some embodiments, the receptor ligand includes, but is not limited to, a ligand for CFTR, EGFR, estrogen receptor, FGR2, folate receptor, IL-2 receptor, glycoprotein, and VEGFR. In some embodiments, the receptor ligand is folic acid. In some embodiments, the apolipoprotein moiety is the ligand to a receptor.
6.1.3.1. Immunoinhibitory and Immunostimulatory Agents
[0115] A Cargomer can include one or more immunoinhibitory agents. Immunoinhibitory agents that can be included in the Cargomers include steroids, retinoic acid, dexamethasone, cyclophosphamide, and combinations thereof.
[0116] A Cargomer can include one or more immunostimulatory agents. Immunostimulatory agents that can be included in the Cargomers include CpG oligonucleotides (ODNs), polyinosinic:polycytidylic acid (poly-I:poly-C), and other adjuvants (e.g., as described in Section 6.2). CpG ODNs are species-specific synthetic single stranded DNA incorporating unmethylated CpG dinucleotides. The optimal motif CpG motif in humans is GTCGTT and GACGTT in mouse. CpG ODNs mimic the immune stimulatory effects of unmethylated bacterial or viral sequences and activate pattern recognition transmembrane receptors, promote cytokine secretion and mount rapid responses to microbial pathogens. CpG ODNs mimic the natural Toll-like receptor (TLR) 9 ligand for the production of signaling factors and trigger a cascade of immune responses against cancer cells. These molecules can have a partially or completely phosphorothioated (PS) backbone as opposed to the phosphodiester (PO) backbone found in genomic bacterial DNA. There are three major classes (A, B, C) of stimulatory CpG ODNs based on structural characteristics and activity on human peripheral blood mononuclear cells (PBMCs) such as B cells and plasmacytoid dendritic cells (pDCs).
[0117] Class A CpG ODNs contain a central palindromic CpG-containing phosphodiester (PO) sequence and a PS-modified 3 poly-G string. The poly G tails form intermolecular tetrads to enhance stability and increase endosomal uptake which can then promote the maturation of pDCs and therefore production of large amounts of IFN-?. This class strongly activate Natural Killer (NK) cells through indirect cytokine signaling while weakly stimulating NF-?B signaling and pro-inflammatory cytokine (e.g. IL-6) production. Class B molecules are structurally linear and contain a fully PS backbone with one or more 6mer CpG motifs. CpG-B ODNs strongly stimulate B cell proliferation and activation along with NK cell activation through NF-?B signaling to display anti-tumor activity. These molecules are potent Type 1 T-helper cell (Th1) vaccine adjuvants, but are weak activators of IFN-? secretion. CpG-C ODNs are an amalgam of classes A and B with a complete PS backbone and a palindromic CpG-containing motif. These molecules are strong stimulators of B cells, type I IFN secretion and Th1-inducing adjuvants. All the CpG ODNs contain one or more unmethylated CpG dinucleotides in specific sequence contexts, which are readily recognized by mammalian cells as an indication of microbial invasion, due to the rarity of this structure in mammalian genomes.
[0118] In some embodiments, the Cargomer comprises a CpG oligonucleotide which is a class A CpG oligonucleotide, for example, a CpG oligonucleotide having a nucleotide sequence comprising or consisting of the nucleotide sequence of SEQ ID NO:3 or SEQ ID NO:4. In some embodiments, the Cargomer comprises a CpG oligonucleotide which is a class B CpG oligonucleotide, for example, a CpG oligonucleotide having a nucleotide sequence comprising or consisting of the nucleotide sequence of SEQ ID NO:5, SEQ ID NO:6 or SEQ ID NO:7. In yet other embodiments, the Cargomer comprises a CpG oligonucleotide which is a class C CpG oligonucleotide, for example, a CpG oligonucleotide having a nucleotide sequence comprising or consisting of the nucleotide sequence of SEQ ID NO:8, SEQ ID NO:9, or SEQ ID NO:10.
[0119] A lipid moiety (e.g., having characteristics like that of cholesterol or other sterols) can be conjugated to a terminus of a CpG ODN to be used as an anchor to couple the CpG ODN to the Cargomer. A cholesterol tag can be added at the 3 or 5 of an ODN using a C4- to C8-linker or a polyethylene glycol linker to improve transduction of the molecule and improve nuclease resistance with greater target anti-viral activity. Another method of conjugating a CpG ODN to a lipid consists of conjugation of ODNs with alkyl chains (greater than 12 carbons), fatty acids, or lipid substituted crown ethers. Lipophilic dendrimers can be conjugated to either the 5 or 3 ends of ODNs to increase their cellular uptake, but increasing the size of the dendrimer can be a detriment to binding activity for their target inside the cell. Phosphatidyl groups are amenable to conjugation to ODNs and provide a high similarity in molecular structure to many lipid constituents of cell membranes. 1,2-Ditetra, 1,2-dihexa- and 1,2-dioctadecanoylglycerol having the S configuration at the stereogenic carbon can be used. The resulting phosphoramidites have the same stereochemistry at the chiral center as in naturally occurring phospholipids (R) to allow passage into cells. In addition, 5-O-phosphatidyloligodeoxynucleotides with varying phosphatidyl tails and/or the sequence and length of the ODN moiety can be used.
[0120] In some embodiments, the Cargomer comprises a poly-I:poly-C oligonucleotide linked to a cholesterol, a phospholipid, or a fatty acid.
6.1.3.2. Anti-Cancer Agents
[0121] A Cargomer can include one or more anti-cancer agents. Anti-cancer agents that can be included in the Cargomer include topoisomerase inhibitors, DNA alkylating agents, DNA strand break inducing agents, anti-microtubule agents, an anti-metabolic agents, anthracyclines, vinca alkaloids, epipodophyllotoxins, tyrosine kinase inhibitors, CDK inhibitors, MAP kinase inhibitors, EGFR inhibitors, and VEGFR inhibitors.
[0122] In certain aspects, the anti-cancer agent is a chemotherapeutic agent, e.g., a cytotoxic or cytostatic agent. Examples of chemotherapeutic agents include alkylating agents such as thiotepa and CYTOXAN? cyclosphosphamide; alkyl sulfonates such as busulfan, improsulfan, piposulfan and treosulfan; decarbazine; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylamelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethiylenethiophosphoramide and trimethylolomelamine; TLK 286 (TELCYTA?); acetogenins (especially bullatacin and bullatacinone); delta-9-tetrahydrocannabinol (dronabinol, MARINOL?); beta-lapachone; lapachol; colchicines; betulinic acid; a camptothecin (including the synthetic analogue topotecan (HYCAMTIN?), CPT-11 (irinotecan, CAMPTOSAR?), acetylcamptothecin, scopolectin, and 9-aminocamptothecin); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); podophyllotoxin; podophyllinic acid; teniposide; cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; bisphosphonates, such as clodronate; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gamma1I and calicheamicin omegall (see, e.g., Agnew, Chem. Intl. Ed. Engl. 33:183-186 (1994)) and anthracyclines such as annamycin, AD 32, alcarubicin, daunorubicin, dexrazoxane, DX-52-1, epirubicin, GPX-100, idarubicin, KRN5500, menogaril, dynemicin, including dynemicin A, an esperamicin, neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores, aclacinomysins, actinomycin, authramycin, azaserine, bleomycins (e.g., bleomycin A2, bleomycin B2 and peplomycin), cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, detorubicin, 6-diazo-5-oxo-L-norleucine, ADRIAMYCIN? doxorubicin (including morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin, liposomal doxorubicin, and deoxydoxorubicin), esorubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, tiazofurin, ribavarin, EICAR, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, and zorubicin; folic acid analogues such as denopterin, pteropterin, and trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, and thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, and floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, and testolactone; anti-adrenals such as aminoglutethimide, mitotane, and trilostane; folic acid replenisher such as folinic acid (leucovorin); aceglatone; anti-folate anti-neoplastic agents such as ALIMTA?, LY231514 pemetrexed, dihydrofolate reductase inhibitors such as methotrexate and trimetrexate, anti-metabolites such as 5-fluorouracil (5-FU) and its prodrugs such as UFT, S-1 and capecitabine, and thymidylate synthase inhibitors and glycinamide ribonucleotide formyltransferase inhibitors such as raltitrexed (TOMUDEXRM, TDX); inhibitors of dihydropyrimidine dehydrogenase such as eniluracil; aldophosphamide glycoside; aminolevulinic acid; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elfornithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; deferoxamine; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; 2-ethylhydrazide; procarbazine; PSK? polysaccharide complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone; 2,2,2-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine (ELDISINE?, FILDESIN?); dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; cytosine arabinoside (Ara-C); cyclophosphamide; thiotepa; taxoids and taxanes, e.g., TAXOL? paclitaxel (Bristol-Myers Squibb Oncology, Princeton, N.J.), ABRAXANE? Cremophor-free, albumin-engineered nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, Ill.), and TAXOTERE? doxetaxel (Rhone-Poulenc Rorer, Antony, France); chloranbucil; gemcitabine (GEMZAR?); 6-thioguanine; mercaptopurine; platinum; platinum analogs or platinum-based analogs such as cisplatin, oxaliplatin and carboplatin; vinblastine (VELBAN?); epipodophyllins such as etoposide (VP-16), teniposide, tepotecan, 9-aminocamptothecin, camptothecin and crisnatol; ifosfamide; mitoxantrone; vinca alkaloids such as vincristine (ONCOVIN?), vindesine, vinca alkaloid, and vinorelbine (NAVELBINE?); novantrone; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; topoisomerase inhibitor RFS 2000; difluorometlhylornithine (DMFO); retinoids such as retinoic acid; pharmaceutically acceptable salts, acids or derivatives of any of the above.
[0123] In some embodiments, the anti-cancer agent is methotrexate, taxol, L-asparaginase, mercaptopurine, thioguanine, hydroxyurea, cytarabine, cyclophosphamide, ifosfamide, nitrosoureas, cisplatin, carboplatin, mitomycin, dacarbazine, procarbizine, topotecan, nitrogen mustards, cytoxan, etoposide, 5-fluorouracil, BCNU, irinotecan, camptothecins, bleomycin, doxorubicin, idarubicin, daunorubicin, dactinomycin, plicamycin, mitoxantrone, asparaginase, vinblastine, vincristine, vinorelbine, paclitaxel, or docetaxel.
[0124] In some embodiments, the anti-cancer agent is an antibody. In certain embodiments, the anti-cancer antibody is an anti-CD20 antibody, e.g., rituximab or tositumomab (which are useful for treating, inter alia, B-cell non-Hodgkin's lymphoma), an anti-CD52 antibody, e.g., alemtuzumab (which is useful for treating B-cell chronic lymphocytic leukemia), an-anti EGF receptor antibody, e.g., cetuximab or panitumumab (which are useful for treating head and neck cancer and colorectal cancer), an anti-VEGF antibody, e.g., bevacizumab (which is useful for treating, inter alia, colorectal cancer), or an anti-HER2 antibody, e.g., trastuzumab (which is useful for treating HER2-positive metastatic breast cancer).
[0125] In some embodiments, the anti-cancer agent is in the form of an antibody-drug conjugate (ADC). Exemplary ADCs include gemtuzumab ozogamicin (approved to treat acute myeloid leukemia), brentuximab vedotin (approved to treat Hodgkin lymphoma), trastuzumab emtansine (approved to treat HER2-positive metastatic breast cancer), and Inotuzumab ozogamicin (approved to treat acute lymphoblastic leukemia).
[0126] Exemplary topoisomerase inhibitors include type I inhibitors such as irinotecan, topotecan, camptothecin and lamellarin D and type II inhibitor such as etoposide, teniposide, doxorubicin, daunorubicin, mitoxantrone, amsacrine, ellipticines, aurintricarboxylic acid, and HU-331. Exemplary DNA alkylating agents include classical DNA alkylating agents such as nitrogen mustards (e.g., cyclophosphamide, mechlorethamine, uramustine, melphalan, chlorambucil, ifosfamide, and bendamustine) nitrosoureas (e.g., carmustine, lomustine, and streptozocin) and alkyl sulfonates (e.g., busulfan), alkylating-like agents such as cisplatin, carboplatin, nedaplatin, oxaliplatin, satraplatin, and triplatin tetranitrate, and non-classical alkylating agents such as procarbazine and altretamine. Exemplary DNA strand break inducing agents include calicheamicin, etoposide, doxorubicin, ginsenoside Rg3, Bleomycin A5, Raltitrexed, and SCH-900776. Exemplary anti-microtubule agents include paclitaxel, docetaxel, and cabazitaxel. Exemplary anti-metabolic agents include 5-fluorouracil (5-FU), 6-mercaptopurine (6-MP), capecitabine, cytarabine, floxuridine, fludarabine, gemcitabine, hydroxycarbamide, methotrexate, and pemetrexed. Exemplary anthracyclines include daunorubicin and doxorubicin. Exemplary vinca alkaloids include vinblastine, vincristine, vindesine, vinorelbine, vincaminol, vineridine, and vinburnine. Exemplary epipodophyllotoxins include etoposide and teniposide. Exemplary tyrosine kinase inhibitors include imatinib, gefitinib, and erlotinib. Exemplary CDK inhibitors include palbociclib, abemaciclib, and ribociclib. Exemplary EGFR inhibitors include gefitinib, erlotinib, afatinib, brigatinib, icotinib, and cetuximab. Exemplary VEGFR inhibitors include pazopanib, vatalanib, sunitinib, and sorafenib.
[0127] In certain embodiments, a Cargomer of the disclosure comprises an anti-cancer agent that is useful in the treatment of melanoma. It has been demonstrated that melanomas that express high levels of SR-B1 are associated with poorer outcomes than melanomas that express low levels of SR-B1 (Mikula et al., 2017, Mol. Cancer Res., doi:10.1158/1541-7786). Without being bound by theory, it is expected that Cargomers carrying anti-melanoma agents are able to target melanoma cells that are more resistant to therapy. Accordingly, in certain aspects, the disclosure provides Cargomers comprising an anti-melanoma agent, such as, but not limited to, aldesleukin, cobimetinib, dabrafenib, dacarbazine, talimogene laherparepvec, ipilimumab, pembrolizumab, trametinib, nivolumab, or orvemurafenib). Such Cargomers can be administered to subjects with melanoma as monotherapy or as part of combination therapy regimens, for example with chemotherapeutic agents or interferon-based therapies (e.g., recombinant interferon alfa-2b, peginterferon alfa-2a, or peginterferon alfa-2b).
6.1.3.3. Anti-Infective Agents
[0128] A Cargomer can include one or more anti-infective agents. Anti-infective agents that can be included in the Cargomers of the disclosure include anti-bacterial agents, anti-viral agents, anti-parasitic agents, anti-fungal agents, and anti-mycobacterial agents.
[0129] Exemplary anti-bacterial agents include ?-lactam antibiotics, penicillins (e.g., penicillin, methicillin, ampicillin, amoxicillin), cephalosporins (e.g., avibactam, cephalexin, cefepime, ceftaroline), ?-lactamase inhibitors (e.g., tebipenem, clavulanate, sulbactam and tazobactam), vancomycin, aminoglycosides (e.g., gentamycin, neomycin B, neomycin C, neomycin E, streptomycin), tetracyclines (e.g., tetracycline, lymecycline, methacycline, and doxycycline), chloramphenicol, erythromycin, lincomycin, clindamycin, rifampin, metronidazole, polymyxins (e.g., polymyxin B and polymyxin E), sulfonamides (e.g., sulfisoxazole and sulfaisodimidine), and quinolones (e.g., cinoxacin, ciprofloxacin, balofloxacin, and gatifloxacin).
[0130] Exemplary anti-viral agents include amantadine, rimantadine, ribivarin, acyclovir, vidarabine, trifluorothymidine, ganciclovir, zidovudine, retinovir, and interferons.
[0131] Exemplary anti-fungal agents include imidazoles (e.g., bifonazole, sertaconazole), triazoles (e.g., albaconazole, isavuconazole), polyene macrolide antibiotics (e.g., amphotericin B, nystatin, and natamycin), griseofulvin, amphotericin B, and flucytosine.
[0132] Anti-parasitic agents include anthelmintics and antiprotozoal agents.
6.1.3.4. Nucleic Acid Drugs
[0133] A Cargomer can include one or more nucleic acid drugs (which term includes nucleic acids intended for gene therapy). Nucleic acid drugs that can be included in the Cargomer of the disclosure include naturally or non-naturally occurring DNA, naturally or non-naturally occurring RNA, oligonucleotides, triple-helix forming molecules, immunostimulatory nucleic acids, small interfering RNAs (siRNA), microRNAs (miRNA), antisense oligonucleotides, aptamers, ribozymes, gene or gene fragments, and regulatory sequences. The nucleic acid drugs can include modified nucleotides and/or a modified backbone, e.g., a nucleic acid drug can comprise peptide nucleic acids (see, e.g., Pansuwan et al., 2017, Bioconjug Chem. 28(9):2284-2292). The nucleic acid can be complexed to a moiety to facilitate binding to or uptake by a target cell. The nucleic acid can be covently bound to a molecule interacting with the Cargomer. For example, a nucleic acid can be covalently linked to a sterol, a fatty acid or a phospholipid such as those described in Section 6.1.2.1.
[0134] In some embodiments, the nucleic acid drug is a siRNA or antisense oligonucleotide. The antisense oligonucleotide can be, for example, a double-stranded oligonucleotide (e.g., as described in US 2017/0137816). Such embodiments are not limited to a particular size or type of molecule. The length of the region of the siRNA or antisense oligonucleotide complementary to the target, for example, can be from 15 to 100 nucleotides, 18 to 25 nucleotides, 20 to 23 nucleotides, or more than 15, 16, 17 or 18 nucleotides. Where there are mismatches to the corresponding target region, the length of the complementary region is generally required to be somewhat longer.
[0135] In certain embodiments, it is contemplated that delivering siRNA or antisense oligonucleotides using Cargomers disclosed herein can be used to inhibit any gene of interest.
[0136] Loading of a nucleic acid drug into Cargomers can be facilitated through cholesterol modification of the nucleic acid drug. For example, the siRNA can be modified with cholesterol at the 3 sense strand and an intermediate level of chemical modification can be used to stabilize siRNA in the serum without significantly compromising its silencing effect.
[0137] Nucleic acid drugs can be labeled with an imaging agent (e.g., fluorescent dye Cy3) to permit visualization of the biodistribution of the nucleic acid drug at the organ level and also the intracellular delivery profile. In some embodiments, RT-PCR and western blot are used to analyze the target protein at the mRNA level and protein level, respectively.
[0138] In some embodiments, the Cargomers comprise one or more siRNAs specific for proprotein convertase subtilisin/kexin 9 (PCSK9). In some embodiments, the PCSK9 siRNA sequence is cross-reactive to murine, rat, nonhuman primate and human PCSK9 mRNA (see, e.g., Frank-Kamenetsky, et al., 2008, Proceedings of the National Academy of Sciences of the United States of America 105(33):11915-11920).
[0139] In some embodiments, the Cargomers comprise one or more siRNAs specific for the gene coding for apolipoprotein B, the apolipoprotein of LDL lipoproteins.
[0140] In some embodiments, the Cargomers comprise one or more targeted gene silencing molecules (e.g., siRNAs) to block production of the dysfunctional huntingtin (Htt) protein, the cause of Huntington's disease, a fatal, inherited neurodegenerative disorder (see, e.g., www.scbt.com/scbt/product/huntingtin-sirna-h-shrna-and-lentiviral-particle-gene-silencers).
[0141] In some embodiments, the Cargomers comprise one or more targeted gene silencing molecules (e.g., siRNAs) to block production of the amyloid precursor protein (APP) products, which cause Alzheimer's disease.
[0142] In some embodiments, the Cargomers comprise one or more targeted gene silencing molecules, such as those described in WO 2014076195 A1, to block production of proteins involved in pathologic processes.
[0143] In some embodiments, the Cargomers comprise one or more targeted gene silencing molecules (e.g., antisense oligonucleotides or siRNAs) to block production of STAT3, which can be used, for example, for treating pancreatic cancer.
[0144] In some embodiments, the Cargomers comprise one or more targeted gene silencing molecules (e.g., antisense oligonucleotides or siRNAs) to block production of KRAS, which can be used, for example, for treating pancreatic cancer.
[0145] In some embodiments, the Cargomers comprise one or more targeted gene silencing molecules (e.g., antisense oligonucleotides or siRNAs) to block production of EGFR, which can be used, for example, for treating pancreatic cancer.
6.1.3.5. Anti-Inflammatory Agents
[0146] A Cargomer can include one or more anti-inflammatory agents. Anti-inflammatory agents that can be included in the Cargomers of the disclosure include one or more of Alclofenac; Alclometasone Dipropionate; Algestone Acetonide; Alpha Amylase; Amcinafal; Amcinafide; Amfenac Sodium; Amiprilose Hydrochloride; Anakinra; Anirolac; Anitrazafen; Apazone; Aspirin; Balsalazide Disodium; Bendazac; Benoxaprofen; Benzydamine Hydrochloride; Bromelains; Broperamole; Budesonide; Carprofen; Cicloprofen; Cintazone; Cliprofen; Clobetasol Propionate; Clobetasone Butyrate; Clopirac; Cloticasone Propionate; Cormethasone Acetate; Cortodoxone; Deflazacort; Desonide; Desoximetasone; Dexamethasone Dipropionate; Diclofenac Potassium; Diclofenac Sodium; Diflorasone Diacetate; Diflumidone Sodium; Diflunisal; Difluprednate; Diftalone; Dimethyl Sulfoxide; Drocinonide; Endrysone; Enlimomab; Enolicam Sodium; Epirizole; Etodolac; Etofenamate; Felbinac; Fenamole; Fenbufen; Fenclofenac; Fenclorac; Fendosal; Fenpipalone; Fentiazac; Flazalone; Fluazacort; Flufenamic Acid; Flumizole; Flunisolide Acetate; Flunixin; Flunixin Meglumine; Fluocortin Butyl; Fluorometholone Acetate; Fluquazone; Flurbiprofen; Fluretofen; Fluticasone Propionate; Furaprofen; Furobufen; Halcinonide; Halobetasol Propionate; Halopredone Acetate; Ibufenac; Ibuprofen; Ibuprofen Aluminum; Ibuprofen Piconol; Ilonidap; Indomethacin; Indomethacin Sodium; Indoprofen; Indoxole; Intrazole; Isoflupredone Acetate; Isoxepac; Isoxicam; Ketoprofen; Lofemizole Hydrochloride; Lornoxicam; Loteprednol Etabonate; Meclofenamate Sodium; Meclofenamic Acid; Meclorisone Dibutyrate; Mefenamic Acid; Mesalamine; Meseclazone; Methylprednisolone Suleptanate; Morniflumate; Nabumetone; Naproxen; Naproxen Sodium; Naproxol; Nimazone; Olsalazine Sodium; Orgotein; Orpanoxin; Oxaprozin; Oxyphenbutazone; Paranyline Hydrochloride; Pentosan Polysulfate Sodium; Phenbutazone Sodium Glycerate; Pirfenidone; Piroxicam; Piroxicam Cinnamate; Piroxicam Olamine; Pirprofen; Prednazate; Prifelone; Prodolic Acid; Proquazone; Proxazole; Proxazole Citrate; Rimexolone; Romazarit; Salcolex; Salnacedin; Salsalate; Salycilates; Sanguinarium Chloride; Seclazone; Sermetacin; Sudoxicam; Sulindac; Suprofen; Talmetacin; Talniflumate; Talosalate; Tebufelone; Tenidap; Tenidap Sodium; Tenoxicam; Tesicam; Tesimide; Tetrydamine; Tiopinac; Tixocortol Pivalate; Tolmetin; Tolmetin Sodium; Triclonide; Triflumidate; Zidometacin; Glucocorticoids; Gemcabene, Bempedoic acid and Zomepirac Sodium.
6.1.3.6. Agents for Treating Cardiovascular Related Disorders
[0147] The Cargomers of the disclosure can include one or more agents for treating cardiovascular related disorders, such as atherosclerosis, heart failure, arrhythmia, atrial fibrillation, hypertension, coronary artery disease, and angina pectoris). Examples of therapeutic agents known to be useful in treating and/or preventing cardiovascular related disorders include angiotensin-converting enzyme (ACE) inhibitors (e.g., benazepril, enalapril, Lisinopril, perindopril, Ramipril), adenosine, alpha blockers (alpha adrenergic antagonist medications) (e.g., clonidine, guanabenz, labetalol, phenoxybenzamine, terazosin, doxazosin, guanfacine, methyldopa, prazosin), angtiotensin II receptor blockers (ARBs) (e.g., candesartan, irbesartan, olmesartan medoxomil, telmisartan, eprosartan, losartan, tasosartan, valsartan), antiocoagulants (e.g., heparin fondaparinux, warfarin, ardeparin, enoxaparin, reviparin, dalteparin, nadroparin, tinzaparin), antiplatelet agents (e.g., abciximab, clopidogrel, eptifibatide, ticlopidine, cilostazol, dipyridamole, sulfinpyrazone, tirofiban), beta blockers (e.g., acebutolol, betaxolol, carteolol, metoprolol, penbutolol, propranolol, atenolol, bisoprolol, esmolol, nadolol, pindolol, timolol), calcium channel blockers (e.g., amlopidine, felodipine, isradipine, nifedipine, verapamil, diltiazem, nicardipine, nimodipine, nisoldipine), diuretics, aldosterone blockers, loop diuretics (e.g., bumetanide, furosemide, ethacrynic acid, torsemide), potassium-sparing diuretics, thiazide diuretics (e.g., chlorothiazide, chlorthalidone, hydrochlorothiazide, hydroflumethiazide, methyclothiazide, metolazone, polythiazide, quinethazone, trichlormethiazide), inoptropics, bile acid sequestrants (e.g., cholestyramine, coletipol, colesevelam), fibrates (e.g., clofibrate, gemfibrozil, fenofibrate), statins (e.g., atorvastatin, lovastatin, simvastatin, fluvastatin, pravastatin), selective cholesterol absorption inhibitors (e.g., ezetimibe), gemcabene, bempedoic acid, potassium channel blockers (e.g., amidarone, ibutilide, dofetilide), sodium channel blockers (e.g., disopyramide, mexiletine, procainamide, quinidine, flecainide, moricizine, propafenone), thrombolytic agents (e.g., alteplase, reteplase, tenecteplase, anistreplase, streptokinase, urokinase), vasoconstrictors, vasodilators (e.g., hydralazine, minoxidil, mecamylamine, isorbide dintrate, isorbide mononitrate, nitroglycerin), cholesteryl ester transfer protein inhibitors (e.g., anacetrapib, evacetrapib), PPAR agonists (e.g., K-877, CER-002, DSP-8658, INT131, GFT505), apoA-I activators (e.g., RVX-208), sphingosine-1-phosphate, retinoid X receptor (RXR) agonists (e.g., bexarotene, CD3254, docosahexaenoic acid, fluorobexarotene, isotretinoin, retinoic acid, SRI 1237, fenretinide, HX630, liarozole dihydrochloride, LG100754 and LG101506), liver X receptor (LXR) agonists (e.g., TO901317, ATI-111, LXR-623, XL-652, hypocholamide, GW3965, N,N-dimethyl-3beta-hydroxy-cholenamide (DMHCA), 22(R)-hydroxy cholesterol, 24(S)-hydroxy cholesterol, (?)anthrabenzoxocinone and (?) bischloroanthrabenzoxocinone ((?)-BABX)).
6.1.3.7. Caspase Inhibitors
[0148] The Cargomers of the disclosure can include one or more caspase inhibitors (e.g., a caspase-1 inhibitor, a caspase-3 inhibitor, or a caspase-8 inhibitor). Caspase inhibitors may be useful for treating non-alcoholic fatty liver disease, epilepsy, ischemic disorders, Huntington's disease, amyotrophic lateral sclerosis (ALS), autoimmune diseases such as rheumatoid arthritis, osteoarthritis, inflammatory bowel disease, viral infections (e.g., hepatitis C) and sepsis. Exemplary caspase inhibitors that have been studied clinically and which can be included in Cargomers of the disclosure include emricasan, pralnacasan, and VX-765. Other caspase inhibitors that can be included in Cargomers are described in US 2010/0041661, WO/2001/021600, and U.S. Pat. No. 9,365,612.
6.1.3.8. Bioactive Agents
[0149] The Cargomers of the disclosure can include one or more bioactive agents, which are optionally deuterated. Highly deuterated bioactive agents can be useful for inhibiting biological processes. Exemplary bioactive agents include polyphenols, such as flavonoids (e.g., anthoxanthins such as luteolin, apigenin, tangeritin, quercetin, kaempferol, myricetin, fisetin, galangin, isorhamnetin, pachypodol, rhamnazin, pyranoflavonols, and furanoflavonols; flavanones such as hesperetin, naringenin, eriodictyol, and homoeriodictyol; flavanonols such as dihydroquercetin and dihydrokaempferol, flavans such as catechin, gallocatechin, catechin 3-gallate, gallocatechin 3-gallate, epicatechins, epigallocatechin, epicatechin 3-gallate, epigallocatechin 3-gallate, theaflavin, and leucoanthocyanidin), carotenoids (e.g., beta-carotene, alpha-carotene, beta-cryptoxanthin and gamma-carotene, lutein, lycopene, astaxanthin, zeaxanthin) and phytosterols.
6.1.3.9. Diagnostic Agents
[0150] The Cargomers of the disclosure can include one or more imaging agents such as a fluorescent moiety, a phosphorescent moiety, gold, a radioactive moiety, a beta emitter, or a combination thereof. Suitable imaging agents include, but are not limited to, fluorescent molecules such as those described by Molecular Probes (Handbook of fluorescent probes and research products), such as Rhodamine, fluorescein, Texas red, Acridine Orange, Alexa Fluor (various), Allophycocyanin, 7-aminoactinomycin D, BOBO-1, BODIPY (various), Calcien, Calcium Crimson, Calcium green, Calcium Orange, 6-carboxyrhodamine 6G, Cascade blue, Cascade yellow, DAPI, DiA, DID, Di1, DiO, DiR, ELF 97, Eosin, ER Tracker Blue-White, EthD-1, Ethidium bromide, Fluo-3, Fluo4, FM1-43, FM4-64, Fura-2, Fura Red, Hoechst 33258, Hoechst 33342, 7-hydroxy-4-methylcoumarin, Indo-1, JC-1, JC-9, JOE dye, Lissamine rhodamine B, Lucifer Yellow CH, LysoSensor Blue DND-167, LysoSensor Green, LysoSensor Yellow/Blu, Lysotracker Green FM, Magnesium Green, Marina Blue, Mitotracker Green FM, Mitotracker Orange CMTMRos, MitoTracker Red CMXRos, Monobromobimane, NBD amines, NeruoTrace 500/525 green, Nile red, Oregon Green, Pacific Blue. POP-1, Propidium iodide, Rhodamine 110, Rhodamine Red, R-Phycoerythrin, Resorfin, RH414, Rhod-2, Rhodamine Green, Rhodamine 123, ROX dye, Sodium Green, SYTO blue (various), SYTO green (Various), SYTO orange (various), SYTOX blue, SYTOX green, SYTOX orange, Tetramethylrhodamine B, TOT-1, TOT-3, X-rhod-1, YOYO-1, YOYO-3. In some embodiments, ceramides are provided as imaging agents. In some embodiments, S1P agonists are provided as imaging agents. Additionally, radionuclides can be used as imaging agents. Suitable radionuclides include, but are not limited to radioactive species of Fe(III), Fe(II), Cu(II), Mg(II), Ca(II), and Zn(I1) Indium, Gallium and Technetium. For example, the imaging agent can be a radioactive species of iron, copper, magnesium, calcium, zinc, indium, gallium (e.g., gallium-67), technetium, fluorine (e.g., fluorine-18), krypton (e.g., krypton-81), rubidium (e.g., rubidium-82), nitrogen (e.g., nitrogen-13), iodine (e.g. iodine-123), xenon (e.g. xenon-133), thallium (e.g. thallium-201), zirconium (e.g., zirconium-89), or a combination thereof. In some embodiments, the imaging agent comprises zirconium-89.
[0151] Other suitable contrast agents include metal ions generally used for chelation in paramagnetic T1-type MIR contrast agents, and include di- and tri-valent cations such as copper, chromium, iron, gadolinium, manganese, erbium, europium, dysprosium and holmium. Metal ions that can be chelated and used for radionuclide imaging, include, but are not limited to metals such as gallium, germanium, cobalt, calcium, indium, iridium, rubidium, yttrium, ruthenium, yttrium, technetium, rhenium, platinum, thallium and samarium. Additionally metal ions known to be useful in neutron-capture radiation therapy include boron and other metals with large nuclear cross-sections. Also suitable are metal ions useful in ultrasound contrast, and X-ray contrast compositions. Examples of other suitable contrast agents include gases or gas emitting compounds, which are radioopaque.
[0152] Metal imaging agents (e.g., radioactive metals) can be attached to a Cargomer via a metal chelator, such as the bifunctional chelator p-isothiocyanatobenzyl desferrioxamine (Df-Bz-NCS). See, Zheng et al., 2016, Atherosclerosis 251:381-388; Perez-Medina et al., 2015, Journal of Nuclear Medicine, 56(8):1272-1277; and Vosjan et al., 2010, Nat Protoc. 5(4):739-43, the contents of which are incorporated herein by reference. In some embodiments, the chelator is covalently attached to an amphipathic molecule (directly or through a linker). In other embodiments, the chelator is covalently attached to an apolipoprotein molecule (directly or through a linker).
6.1.3.10. Immunogens
[0153] The Cargomers can include one or more immunogens such as an antigen or an antigen-encoding nucleic acid. The antigen can be an antigen associated with an allergic reaction, for example, a pollen, a venom, animal dander, a fungal spore, a drug allergen or a food allergen. The antigen can be an autoantigen, for example, a lupus antigen, a multiple sclerosis antigen, a rheumatoid arthritis antigen, a diabetes mellitus type I antigen, an inflammatory bowel disease antigen, a thyroiditis antigen, or a celiac disease antigen.
[0154] The antigen can be, for example, a peptide based antigen, a protein based antigen, a polysaccharide based antigen, a saccharide based antigen, a lipid based antigen, a glycolipid based antigen, a nucleic acid based antigen, an inactivated organism based antigen, an attenuated organism based antigen, a viral antigen, a bacterial antigen, a parasite antigen, an antigen derived from an allergen, or a tumor antigen.
[0155] A peptide based antigen can be, for example, a retro-inverso peptide (e.g., as described in van Regenmortel et al., 1998, Dev Biol Stand. 92:139-43).
[0156] In some embodiments, the antigen is a self antigen, which is an immunogenic antigen or epitope native to a mammal and which may be involved in the pathogenesis of an autoimmune disease.
[0157] In some embodiments, the antigen is a viral antigen. Viral antigens can be isolated from any virus including, but not limited to, a virus from any of the following viral families: Arenaviridae, Arterivirus, Astroviridae, Baculoviridae, Badnavirus, Bamaviridae, Birnaviridae, Bromoviridae, Bunyaviridae, Caliciviridae, Capillovirus, Carlavirus, Caulimovirus, Circoviridae, Closterovirus, Comoviridae, Coronaviridae (e.g., Coronavirus, such as severe acute respiratory syndrome (SARS) virus), Corticoviridae, Cystoviridae, Delta virus, Dianthovirus, Enamovirus, Filoviridae (e.g., Marburg virus and Ebola virus (e.g., Zaire, Reston, Ivory Coast, or Sudan strain)), Flaviviridae, (e.g., Hepatitis C virus, Dengue virus 1, Dengue virus 2, Dengue virus 3, and Dengue virus 4), Hepadnaviridae, Herpesviridae (e.g., Human herpesvirus 1, 3, 4, 5, and 6, and Cytomegalovirus), Hypoviridae, Iridoviridae, Leviviridae, Lipothrixviridae, Microviridae, Orthomyxoviridae (e.g., Influenzavirus A and B and C), Papovaviridae, Paramyxoviridae (e.g., measles, mumps, and human respiratory syncytial virus), Parvoviridae, Picornaviridae (e.g., poliovirus, rhinovirus, hepatovirus, and aphthovirus), Poxviridae (e.g., vaccinia and smallpox virus), Reoviridae (e.g., rotavirus), Retroviridae (e.g., lentivirus, such as human immunodeficiency virus (HIV) 1 and HIV 2), Rhabdoviridae (for example, rabies virus, measles virus, respiratory syncytial virus, etc.), Togaviridae (for example, rubella virus, dengue virus, etc.), and Totiviridae. Suitable viral antigens also include all or part of Dengue protein M, Dengue protein E, Dengue D1NS1, Dengue D1NS2, and Dengue D1NS3.
[0158] Viral antigens may be derived from a particular strain such as a papilloma virus, a herpes virus, i.e. herpes simplex 1 and 2; a hepatitis virus, for example, hepatitis A virus (HAV), hepatitis B virus (HBV), hepatitis C virus (HCV), the delta hepatitis D virus (HDV), hepatitis E virus (HEV) and hepatitis G virus (HGV), the tick-borne encephalitis viruses; parainfluenza, varicella-zoster, cytomeglavirus, Epstein-Barr, rotavirus, rhinovirus, adenovirus, coxsackieviruses, equine encephalitis, Japanese encephalitis, yellow fever, Rift Valley fever, and lymphocytic choriomeningitis.
[0159] In some embodiments, the antigen is a bacterial antigen. Bacterial antigens can originate from any bacteria including, but not limited to, Actinomyces, Anabaena, Bacillus, Bacteroides, Bdellovibrio, Bordetella, Borrelia, Campylobacter, Caulobacter, Chlamydia, Chlorobium, Chromatium, Clostridium, Corynebacterium, Cytophaga, Deinococcus, Escherichia, Francisella, Halobacterium, Heliobacter, Haemophilus, Hemophilus influenza type B (HIB), Hyphomicrobium, Legionella, Leptspirosis, Listeria, Meningococcus A, B and C, Methanobacterium, Micrococcus, Myobacterium, Mycoplasma, Myxococcus, Neisseria, Nitrobacter, Oscillatoria, Prochloron, Proteus, Pseudomonas, Phodospirillum, Rickettsia, Salmonella, Shigella, Spirillum, Spirochaeta, Staphylococcus, Streptococcus, Streptomyces, Sulfolobus, Thermoplasma, Thiobacillus, and Treponema, Vibrio, and Yersinia.
[0160] In some embodiments, the antigen is a parasite antigen. Parasite antigens can be obtained from parasites such Cryptococcus neoformans, Histoplasma capsulatum, Candida albicans, Candida tropicalis, Nocardia asteroides, Rickettsia ricketsii, Rickettsia typhi, Mycoplasma pneumoniae, Chlamydial psittaci, Chlamydial trachomatis, Plasmodium falciparum, Trypanosoma brucei, Entamoeba histolytica, Toxoplasma gondii, Trichomonas vaginalis and Schistosoma mansoni. These include Sporozoan antigens, Plasmodian antigens, such as all or part of a Circumsporozoite protein, a Sporozoite surface protein, a liver stage antigen, an apical membrane associated protein, or a Merozoite surface protein.
[0161] In some embodiments, the antigen is an allergen and environmental antigen, such as, but not limited to, an antigen derived from naturally occurring allergens such as pollen allergens (tree-, herb, weed-, and grass pollen allergens), insect allergens (inhalant, saliva and venom allergens), animal hair and dandruff allergens, and food allergens. Important pollen allergens from trees, grasses and herbs originate from the taxonomic orders of Fagales, Oleales, Pinales and platanaceae including birch (Betula), alder (Alnus), hazel (Corylus), hornbeam (Carpinus) and olive (Olea), cedar (Cryptomeria and Juniperus), Plane tree (Platanus), the order of Poales including i.e. grasses of the genera Lolium, Phleum, Poa, Cynodon, Dactylis, Holcus, Phalaris, Secale, and Sorghum, the orders of Asterales and Urticales including i.a. herbs of the genera Ambrosia, Artemisia, and Parietaria. Other allergen antigens that may be used include allergens from house dust mites of the genus Dermatophagoides and Euroglyphus, storage mite e.g Lepidoglyphys, Glycyphagus and Tyrophagus, those from cockroaches, midges and fleas e.g. Blatella, Periplaneta, Chironomus and Ctenocepphalides, those from mammals such as cat, dog and horse, birds, venom allergens including such originating from stinging or biting insects such as those from the taxonomic order of Hymenoptera including bees (superfamily Apidae), wasps (superfamily Vespidea), and ants (superfamily Formicoidae). Still other allergen antigens that may be used include inhalation allergens from fungi such as from the genera Alternaria and Cladosporium.
[0162] In some embodiments, the antigen is a tumor antigen. The antigen can be a tumor antigen, including a tumor-associated or tumor-specific antigen or a peptide fragment that elicits an immune response against a tumor-associated or tumor-specific antigen. Examples of tumor-associated or tumor-specific antigens include, but are not limited to, alpha-actinin-4, Bcr-Abl fusion protein, Casp-8, beta-catenin, cdc27, cdk4, cdkn2a, coa-1, dek-can fusion protein, EF2, ETV6-AML1 fusion protein, LDLR-fucosyltransferaseAS fusion protein, HLA-A2, HLA-A11, hsp70-2, KIAA0205, Mart2, Mum-1, 2, and 3, neo-PAP, myosin class I, OS-9, pml-RARa fusion protein, PTPRK, K-ras, N-ras, Triosephosphate isomeras, Bage-1, Gage 3, 4, 5, 6, 7, GnTV, Herv-K-mel, Lage-1, Mage-A1, 2, 3, 4, 6, 10, 12, Mage-C2, NA-88, NY-Eso-1/Lage-2, SP17, SSX-2, and TRP2-Int2, MelanA (MART-1), gp100 (Pmel 17), tyrosinase, TRP-1, TRP-2, MAGE-1, MAGE-3, BAGE, GAGE-1, GAGE-2, p15(58), CEA, RAGE, NY-ESO (LAGS), SCP-1, Hom/Mel-40, PRAME, p53, H-Ras, HER-2/neu, BCR-ABL, E2A-PRL, H4-RET, IGH-IGK, MYL-RAR, Epstein Barr virus antigens, EBNA, human papillomavirus (HPV) antigens E6 and E7, TSP-180, MAGE-4, MAGE-5, MAGE-6, p185erbB2, p180erbB-3, c-met, nm-23H1, PSA, TAG-72-4, CA 19-9, CA 72-4, CAM 17.1, NuMa, K-ras, ?-Catenin, CDK4, Mum-1, p16, TAGE, PSMA, PSCA, CT7, telomerase, 43-9F, 5T4, 791Tgp72, ?-fetoprotein, 13HCG, BCA225, BTAA, CA 125, CA 15-3 (CA 27.29\BCAA), CA 195, CA 242, CA-50, CAM43, CD68\KP1, CO-029, FGF-5, G250, Ga733 (EpCAM), HTgp-175, M344, MA-50, MG7-Ag, MOV18, NB\70K, NY-CO-1, RCAS1, SDCCAG16, TA-90 (Mac-2 binding protein\cyclophilin C-associated protein), TAAL6, TAG72, TLP, and TPS.
[0163] In some embodiments, the antigen is PCSK9.
[0164] In some embodiments, the antigen is gp100 melanoma.
[0165] In some embodiments, the antigen is a neo-antigen. The term neo-antigen is used herein to define any newly expressed antigenic determinant. Neo-antigens may arise upon conformational change in a protein, as newly expressed determinants (especially on the surfaces of transformed or infected cells), as the result of complex formation of one or more molecules or as the result of cleavage of a molecule with a resultant display of new antigenic determinants. Thus, as used herein, the term neo-antigen covers antigens expressed upon infection (e.g. viral infection, protozoal infection or bacterial infection), in prion-mediated diseases, an on cell transformation (cancer), in which latter case the neo-antigen may be termed a tumor-associated antigen.
[0166] Identification of neo-antigens can involve identifying all, or nearly all, mutations in the neoplasia/tumor at the DNA level using whole genome sequencing, whole exome (e.g., only captured exons) sequencing, or RNA sequencing of tumor versus matched germline samples from each patient. In some embodiments, identification of neo-antigens involves analyzing the identified mutations with one or more peptide-MHC binding prediction algorithms to generate a plurality of candidate neo-antigen T cell epitopes that are expressed within the neoplasia/tumor and may bind patient HLA alleles. In some embodiments, identification of neo-antigens involves synthesizing the plurality of candidate neo-antigen peptides selected from the sets of all neo open reading frame peptides and predicted binding peptides for use in a cancer vaccine. Several contract research organizations offer neo-antigen identification services, including Personalis (www.personalis.com), BGI (www.bgi.com), and Cancer Genetics Incorporated (www.cancergenetics.com).
[0167] In some embodiments, the antigen is a shared antigen, i.e., an antigen overexpressed in malignant cell but that also exists in non-malignant cells.
[0168] In certain embodiments the size of a neo-antigenic peptide molecule or shared antigen peptide molecule can be, for example, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, about 30, about 31, about 32, about 33, about 34, about 35, about 36, about 37, about 38, about 39, about 40, about 41, about 42, about 43, about 44, about 45, about 46, about 47, about 48, about 49, about 50, about 60, about 70, about 80, about 90, about 100, about 110, about 120 or greater amino molecule residues, and any range derivable therein. In specific embodiments the neo-antigenic or shared antigenic peptide molecules are equal to or less than 50 amino acids. In some embodiments, the neo-antigenic peptide or shared antigenic peptide molecules are equal to about 10 to 30 amino acids. In some embodiments, the neo-antigenic peptide molecules or shared antigenic peptide molecules are equal to about 10 to about 20 amino acids. In a preferred embodiment, the neo-antigenic peptide molecules or shared antigenic peptide molecules are equal to about 20 to about 30 amino acids.
[0169] Cargomers can include one or more neo-antigenic peptides. In some embodiments, a Cargomer comprises one neo-antigenic peptide. In some embodiments, a Cargomer comprises two neo-antigenic peptides. In some embodiments, a Cargomer comprises at least 5 or more neo-antigenic peptides. In some embodiments, a Cargomer comprises at least about 6, about 8, about 10, about 12, about 14, about 16, about 18, or about 20 distinct peptides. In some embodiments, a Cargomer comprises at least 20 distinct peptides.
[0170] Cargomers can include one or more shared antigen peptides. In some embodiments, a Cargomer comprises one shared antigen peptide. In some embodiments, a Cargomer comprises two shared antigen peptides. In some embodiments, a Cargomer comprises at least 5 or more shared antigen peptides. In some embodiments, a Cargomer comprises at least about 6, about 8, about 10, about 12, about 14, about 16, about 18, or about 20 distinct peptides. In some embodiments, a Cargomer comprises at least 20 distinct peptides.
[0171] Neo-antigenic and shared antigenic peptides, polypeptides, and analogs can be further modified to contain additional chemical moieties not normally part of the protein. Those derivatized moieties can improve the solubility, the biological half-life, absorption of the protein, or binding affinity. The moieties can also reduce or eliminate any desirable side effects of the proteins and the like. An overview for those moieties can be found in Allen et al., eds., 2012, Remington: The Science and Practice of Pharmacy, 22.sup.nd Edition, Pharmaceutical Press, London, UK. For example, neo-antigenic and shared peptides and polypeptides having the desired activity may be modified as necessary to provide certain desired attributes, e.g. improved pharmacological characteristics, while increasing or at least retaining substantially all of the biological activity of the unmodified peptide to bind the desired MHC molecule and activate the appropriate T cell. For instance, the neo-antigenic or shared antigenic peptides and polypeptides may be subject to various changes, such as substitutions, either conservative or non-conservative, where such changes might provide for certain advantages in their use, such as improved MHC binding. Such conservative substitutions may encompass replacing an amino acid residue with another amino acid residue that is biologically and/or chemically similar, e.g., one hydrophobic residue for another, or one polar residue for another. The effect of single amino acid substitutions may also be probed using D-amino acids. Such modifications may be made using well known peptide synthesis procedures.
[0172] In some embodiments, the neo-antigenic or shared antigenic peptides and polypeptides may be modified with linking agents for purposes of facilitating complexing with the Cargomer. The disclosure is not limited to a particular type or kind of linking agent. In some embodiments, the linking agent is a cysteine-serine-serine (CSS) molecule.
[0173] In some embodiments wherein the neo-antigenic or shared antigenic peptide or polypeptide is modified with CSS, the Cargomer is further modified with dioleoyl-sn-glycero-3-phosphoethanolamine-N-[3-(2-pyridyldithio) propionate] (DOPE-PDP) wherein upon mixing, the DOPE-PDP and CSS engage thereby resulting in a complexing (linking) of the CSS-Ag with the Cargomer.
[0174] The neo-antigenic or shared antigenic peptides and polypeptides may also be modified by extending or decreasing the compound's amino acid sequence, e.g., by the addition or deletion of amino acids. The neo-antigenic or shared antigenic peptides, polypeptides, or analogs can also be modified by altering the order or composition of certain residues. It will be appreciated by the skilled artisan that certain amino acid residues essential for biological activity, e.g., those at critical contact sites or conserved residues, may generally not be altered without an adverse effect on biological activity. The non-critical amino acids need not be limited to those naturally occurring in proteins, such as L-a-amino acids, or their D-isomers, but may include non-natural amino acids as well, such as ?-?-?-amino acids, as well as many derivatives of L-a-amino acids. The non-critical amino acids can be engineered so that the peptide is a substrate for a protease, which can promote liberation of the peptide within cells. Cysteine residues at non-critcal amino acids (e.g., added to the N-terminus or C-terminus) can facilitate the coupling to an anchor (e.g., a sterol, phospholipid, or fatty acid). Such peptides can be liberated in a reducing environment.
[0175] Typically, a neo-antigen or shared antigen polypeptide or peptide may be optimized by using a series of peptides with single amino acid substitutions to determine the effect of electrostatic charge, hydrophobicity, etc. on MHC binding. For instance, a series of positively charged (e.g., Lys or Arg) or negatively charged (e.g., Glu) amino acid substitutions may be made along the length of the peptide revealing different patterns of sensitivity towards various MHC molecules and T cell receptors. In addition, multiple substitutions using small, relatively neutral moieties such as Ala, Gly, Pro, or similar residues may be employed. The substitutions may be homo-oligomers or hetero-oligomers. The number and types of residues which are substituted or added depend on the spacing necessary between essential contact points and certain functional attributes which are sought (e.g., hydrophobicity versus hydrophilicity). Increased binding affinity for an MHC molecule or T cell receptor may also be achieved by such substitutions, compared to the affinity of the parent peptide. In any event, such substitutions should employ amino acid residues or other molecular fragments chosen to avoid, for example, steric and charge interference which might disrupt binding. Amino acid substitutions are typically of single residues. Substitutions, deletions, insertions or any combination thereof may be combined to arrive at a final peptide.
[0176] One of skill in the art will appreciate that there are a variety of ways in which to produce such tumor specific neo-antigens or shared antigens. In general, such tumor specific neo-antigens and shared antigens may be produced either in vitro or in vivo. Tumor specific neo-antigens and shared antigens may be produced in vitro as peptides or polypeptides, which may then be formulated into a personalized neoplasia vaccine and administered to a subject. Such in vitro production may occur by a variety of methods known to one of skill in the art such as, for example, peptide synthesis or expression of a peptide/polypeptide from a DNA or RNA molecule in any of a variety of bacterial, eukaryotic, or viral recombinant expression systems, followed by purification of the expressed peptide/polypeptide.
[0177] Alternatively, tumor specific neo-antigens may be produced in vivo by introducing molecules (e.g., DNA, RNA, viral expression systems, and the like) that encode tumor specific neo-antigens into a subject, whereupon the encoded tumor specific neo-antigens are expressed.
[0178] In some embodiments, Cargomers can comprise one or more neoantigens (e.g., a peptide of 10 to 30 amino acid residues) identified in subjects having esophageal cancer attached to an anchor (e.g., a sterol, a phospholipid or a fatty acid) which can be used, for example, for treating esophageal cancer (e.g., adenocarcinoma, squamous cell carcinoma or others). The one or more neoantigens can be directly attached to an anchor or through a linker, e.g., as described in Section 6.1.5.
[0179] In some embodiments, Cargomers can comprise one or more neoantigens (e.g., a peptide of 10 to 30 amino acid residues) identified in subjects having pancreatic cancer attached to an anchor (e.g., a sterol, a phospholipid or a fatty acid), which can be used, for example, for treating pancreatic cancer. The one or more neoantigens can be directly attached to an anchor or through a linker, e.g., as described in Section 6.1.5.
[0180] In some embodiments, Cargomers can comprise one or more shared antigens (e.g., a peptide of 10 to 30 amino acid residues) identified in subjects having cancer (e.g. pancreatic cancer) attached to an anchor (e.g., a sterol, a phospholipid or a fatty acid), which can be used, for example, for treating subjects having cancer (e.g., pancreatic cancer). The one or more shared antigens can be directly attached to an anchor or through a linker, e.g., as described in Section 6.1.5.
[0181] In some embodiments, Cargomers can comprise one or more neoantigens (e.g., a peptide of 10 to 30 amino acid residues) identified in subjects having pancreatic cancer attached to an anchor (e.g., a sterol, a phospholipid or a fatty acid), which can be used, for example, for treating pancreatic cancer. The one or more neoantigens can be directly attached to an anchor or through a linker, e.g., as described in Section 6.1.5.
[0182] In some embodiments, Cargomers can comprise one or antigens (e.g., a peptide of 10 to 30 amino acid residues) from a mutated RAS protein (e.g., KRAS, HRAS, or NRAS) linked to an anchor (e.g., a sterol, a phospholipid or a fatty acid), which can be used, for example, for treating pancreatic cancer. The one or more antigens can be directly attached to an anchor or through a linker, e.g., as described in Section 6.1.5.
[0183] Proteins or peptides may be made by any technique known to those of skill in the art, including the expression of proteins, polypeptides or peptides through standard molecular biological techniques, the isolation of proteins or peptides from natural sources, or the chemical synthesis of proteins or peptides. The nucleotide and protein, polypeptide and peptide sequences corresponding to various genes have been previously disclosed, and may be found at computerized databases known to those of ordinary skill in the art. One such database is the National Center for Biotechnology Information's Genbank and GenPept databases located at the National Institutes of Health website. The coding regions for known genes may be amplified and/or expressed using the techniques disclosed herein or as would be known to those of ordinary skill in the art. Alternatively, various commercial preparations of proteins, polypeptides and peptides are known to those of skill in the art.
[0184] Antigens can be provided as single antigens or can be provided in combination. Antigens can also be provided as complex mixtures of polypeptides or nucleic acids.
6.1.4. Anchors
[0185] A cargo moiety can be covalently bound to an amphipathic or apolar moiety to facilitate coupling of the cargo moiety to a Cargomer. Amphipathic and apolar moieties can interact with apolar regions in Cargomers, thereby anchoring cargo moieties attached to amphipathic and apolar moieties to Cargomers.
[0186] Amphipathic moieties that can be used as anchors include lipids (e.g., as described in Section 6.1.2.1) and fatty acids (e.g., as described in Section 6.1.2.3). In some embodiments, the anchors comprise a sterol or a sterol derivative e.g., a plant sterol, an animal sterol, or a sterol derivative such as a vitamin). For example, sterols such as cholesterol can be covalently bound to a cargo moiety (e.g., via the hydroxyl group at the 3-position of the A-ring of the sterol) and used to anchor the cargo moiety to a Cargomer. Apolar moieties that can be used as anchors include alkyl chains, acyl chains, and diacyl chains. Cargo moieties can be covalently bound to anchor moieties directly or indirectly via a linker (e.g., via a difunctional peptide or other linker described in Section 6.1.5). Cargo moieties that are biologically active may retain their biological activity while covalently bound to the anchor (or linker attached to the anchor), while others may require cleavage of the covalent bond (e.g., by hydrolysis) attaching the cargo moiety to the anchor (or linker attached to the anchor) to regain biological activity.
6.1.5. Linkers
[0187] Linkers comprise a chain of atoms that covalently attach cargo moieties to other moieties in a Cargomer, including apolipoprotein molecules, amphipathic molecules, and anchors. A number of linker molecules are commercially available, for example from ThermoFisher Scientific. Suitable linkers are well known to those of skill in the art and include, but are not limited to, straight or branched-chain carbon linkers, heterocyclic carbon linkers, and peptide linkers. A linker can be a bifunctional linker, which is either homobifunctional or heterobifunctional.
[0188] Suitable linkers include cleavable and non-cleavable linkers.
[0189] A linker may be a cleavable linker, facilitating release of a cargo moiety in vivo. Cleavable linkers include acid-labile linkers (e.g., comprising hydrazine or cis-aconityl), protease-sensitive (e.g., peptidase-sensitive) linkers, photolabile linkers, or disulfide-containing linkers (Chari et al., 1992, Cancer Research 52:127-131; U.S. Pat. No. 5,208,020). A cleavable linker is typically susceptible to cleavage under intracellular conditions. Suitable cleavable linkers include, for example, a peptide linker cleavable by an intracellular protease, such as lysosomal protease or an endosomal protease. In exemplary embodiments, the linker can be a dipeptide linker, such as a valine-citrulline (val-cit), a phenylalanine-lysine (phe-lys), or a serine-serine linker.
[0190] A cleavable linker can be pH-sensitive, i.e., sensitive to hydrolysis at certain pH values. Typically, a pH-sensitive linker is hydrolyzable under acidic conditions. For example, an acid-labile linker that is hydrolyzable in the lysosome (e.g., a hydrazone, semicarbazone, thiosemicarbazone, cis-aconitic amide, orthoester, acetal, ketal, or the like) can be used. (See, e.g., U.S. Pat. Nos. 5,122,368; 5,824,805; 5,622,929; Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123; Neville et al., 1989, Biol. Chem. 264:14653-14661). Such linkers are relatively stable under neutral pH conditions, such as those in the blood, but are unstable at below pH 5.5 or 5.0, the approximate pH of the lysosome. In certain embodiments, the hydrolyzable linker is a thioether linker (such as, e.g., a thioether attached to the cargo moiety via an acylhydrazone bond (see, e.g., U.S. Pat. No. 5,622,929).
[0191] In some embodiments, the linker is cleavable under reducing conditions (e.g., a disulfide linker). A variety of disulfide linkers are known in the art, including, for example, those that can be formed using SATA (N-succinimidyl-5-acetylthioacetate), SPDP (N-succinimidyl-3-(2-pyridyldithio)propionate), SPDB (N-succinimidyl-3-(2-pyridyldithio)butyrate) and SMPT (N-succinimidyloxycarbonyl-alpha-methyl-alpha-(2-pyridyl-dithio)toluene), SPDB and SM PT (see, e.g., Thorpe et al., 1987, Cancer Res. 47:5924-5931; Wawrzynczak et al., In Immunoconjugates: Antibody Conjugates in Radioimagery and Therapy of Cancer (C. W. Vogel ed., Oxford U. Press, 1987. See also, U.S. Pat. No. 4,880,935).
[0192] In some embodiments, the linker is cleavable by a cleaving agent, e.g., an enzyme, that is present in the intracellular environment (e.g., within a lysosome or endosome or caveolea). The linker can be, e.g., a peptidyl linker that is cleaved by an intracellular peptidase or protease enzyme, including, but not limited to, a lysosomal or endosomal protease. In some embodiments, the peptidyl linker is at least two amino acids long or at least three amino acids long. Cleaving agents can include cathepsins B and D and plasmin, all of which are known to hydrolyze dipeptide drug derivatives resulting in the release of active drug inside target cells (see, e.g., Dubowchik and Walker, 1999, Pharm. Therapeutics 83:67-123). In some embodiments, the peptidyl linker cleavable by an intracellular protease is a Val-Cit linker or a Phe-Lys linker.
[0193] In some embodiments, the linker is a malonate linker (Johnson et al., 1995, Anticancer Res. 15:1387-93), a maleimidobenzoyl linker (Lau et al., 1995, Bioorg-Med-Chem. 3(10):1299-1304), ora 3-N-amide analog (Lau et al., 1995, Bioorg-Med-Chem. 3(10): 1305-12).
[0194] In other embodiments, the linker unit is not cleavable and the cargo moiety is released, for example, by Cargomer degradation. Exemplary non-cleavable linkers include maleimidocaproyl, N-succinimidyl 4-(maleimidomethyl)cyclohexanecarboxylate (SMCC) and N-succinimidyl-4-(iodoacetyl)-aminobenzoate (SIAB).
6.2. Compositions Comprising Cargomers
[0195] The disclosure provides compositions comprising Cargomers of the disclosure. Pharmaceutical compositions can include Cargomers and one or more pharmaceutically acceptable carriers, excipients, diluents, or a combination thereof. The Cargomers of the disclosure can also be included in a vaccine composition comprising Cargomers and one or more pharmaceutically acceptable carriers, diluents, excipients, adjuvants, or a combination thereof. The Cargomers of the disclosure can also be included in a diagnostic composition comprising Cargomers of and one or more carriers, diluents, excipients, or a combination thereof which are suitable for diagnostic use.
[0196] Exemplary carriers include solvents or dispersion media containing, for example, water, ethanol, a polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), suitable mixtures thereof, and vegetable oils. Exemplary diluents include water for injection, saline solution, buffered solutions such as phosphate buffered saline solution, and sugar solutions such as sucrose or dextran solutions. Exemplary excipients include fillers, binders, disintegrants, solvents, solubilizing agents, and coloring agents. Exemplary excipients also include positively charged molecules such as, but not limited to, lysine, arginine, ornithine, poly-lysine, poly-arginine, poly-ornithine, poly-lys-arg, and poly-lys-orn.
[0197] Exemplary adjuvants include CPG, polyIC, poly-ICLC, 1018 ISS, aluminum salts, Amplivax, AS15, BCG, CP-870,893, CpG7909, CyaA, dSLIM, GM-CSF, 1030, IC31, Imiquimod, ImuFact IMP321, IS Patch, ISS, ISCOMATRIX, Juvlmmune, LipoVac, MF59, monophosphoryl lipid A, Montanide IMS 1312, Montanide ISA 206, Montanide ISA 50V, Montanide ISA-51, OK-432, OM-174, OM-197-MP-EC, ONTAK, PepTel.R?, vector system, PLGA microparticles, imiquimod, resiquimod, gardiquimod, 3M-052, SRL172, Virosomes and other Virus-like particles, YF-17D, VEGF trap, beta-glucan, Pam3Cys, Aquila's QS21 stimulon, vadimezan, and AsA404 (DMXAA).
[0198] The compositions of the disclosure can be formulated according to techniques known in the art (e.g., as described in Allen et al., eds., 2012, Remington: The Science and Practice of Pharmacy, 22.sup.nd Edition, Pharmaceutical Press, London, UK). For example, the compositions can be formulated for subcutaneous, intradermal, intravenous, or intraperitoneal injection (e.g., as a solution), inhalation (intranasal or intrapulmonary inhalation), implantation (e.g., as a suppository), ocular or intraocular administration (e.g., via eye drops).
[0199] In some embodiments, the compositions are packaged in unit dosage amounts suitable for administration. For example, in some embodiments, the compositions comprise unit dosage amounts of dried (for example lyophilized) Cargomers packaged in sealed vials. Such compositions are suitable for reconstitution with water, physiological solution (such as saline) or buffer, and administration via injection. Such compositions may optionally include one or more anti-caking and/or anti-agglomerating agents to facilitate reconstitution of the Cargomers, or one or more buffering agents, isotonicity agents (e.g., sucrose and/or mannitol), sugars or salts (e.g., sodium chloride) designed to adjust the pH, osmolality and/or salinity of the reconstituted suspension. The compositions described above can be manufactured under conditions that minimize oxidation, thereby reducing the risk of side effects, such as liver damage, caused by oxidized products. For example, the compositions can be manufactured under an inert gas, such as nitrogen, helium, or argon.
[0200] Cargomers may also be formulated in pharmaceutical compositions for controlled release. As used herein, controlled release refers to release of a cargo moiety from a formulation at a rate that the blood concentration of the cargo moiety in an individual is maintained within the therapeutic range for an extended duration, over a time period on the order of hours, days, weeks, or longer. Cargomers may be formulated in a bioerodible or nonbioerodible controlled matrix, a number of which are well known in the art. A controlled release matrix may include a synthetic polymer or copolymer, for example in the form of a hydrogel. Examples of such polymers include polyesters, polyorthoesters, polyanhydrides, polysaccharides, poly(phosphoesters), polyamides, polyurethanes, poly(imidocarbonates) and poly(phosphazenes), and poly-lactide-co-glycolide (PLGA), a copolymer of poly(lactic acid) and poly(glycolic acid). Collagen, albumin, and fibrinogen containing materials may also be used.
[0201] Preferably, the compositions of the disclosure contain only a small amount of uncomplexed amphipathic molecules, apolipoprotein, and cargo moieties. In some embodiments, no more than 20% of the amphipathic molecules in the composition are in uncomplexed form. In other embodiments, no more than 10% of the amphipathic molecules are in uncomplexed form. In yet other embodiments, no more than 5% of the amphipathic molecules are uncomplexed form. In yet other embodiments, no more than 2% of the amphipathic molecules are in uncomplexed form.
[0202] The homogeneity of the Cargomers and compositions of the disclosures can be measured by gel permeation chromatography. A highly homogeneous composition will generally have a main peak corresponding to the Cargomers and, possibly, one or more secondary peaks corresponding to one or more of free protein, free amphipathic molecules, and free cargo moieties. Secondary peaks corresponding to Cargomers or complexes having a different size from the Cargomers in the main peak may also be seen. The area of the main peak on a gel permeation chromatogram relative to the total area of the main and secondary peaks determines the percent homogeneity of a composition. In some embodiments, the compositions of the disclosure are at least 75% homogeneous. In other embodiments, the compositions of the disclosure are at least 85% homogeneous. In other embodiments, the compositions of the disclosure are at least 95% homogeneous. In yet other embodiments, the compositions of the disclosure are at least 98% homogeneous.
[0203] In some embodiments, the homogeneity of the Cargomers in the compositions of the disclosure (i.e., the area of the main peak relative to the total area of the main and secondary peaks corresponding to Cargomers having both apolipoprotein and amphipathic molecules) is at least 75%. In other embodiments, the Cargomers in the compositions of the disclosure are at least 85% homogeneous. In other embodiments, the Cargomers in the compositions of the disclosure are at least 95% homogeneous. In other embodiments, the Cargomers in the compositions of the disclosure are at least 98% homogeneous.
[0204] In the compositions of the disclosure, lipoprotein complexes that (a) have Stokes radii of greater than 2 nm or 3.4 nm (e.g., as determined by gel permeation chromatography) and/or (b) are discoidal and/or (c) have an apolipoprotein:amphipathic molecule molar ratio of 1:8 or greater, if present, preferably represent no more than 10% of the apolipoprotein in the composition on a weight basis. In some embodiments, such complexes represent no more than 5% of the apolipoprotein in the composition on a weight basis. In some embodiments, such complexes represent no more than 2% of the apolipoprotein in the composition on a weight basis. In some embodiments, the compositions are free of detectable lipoprotein complexes that (a) have Stokes radii of greater than 3.4 nm and/or (b) are discoidal and/or (c) have an apolipoprotein:amphipathic molecule molar ratio of 1:8 or greater when the compositions are subjected to gel permeation chromatography under conditions capable of resolving such complexes. Preferably, the compositions of the disclosure are free of lipoprotein complexes having a Stokes radius of greater than 3.25 nm.
[0205] The identity and amount of lipoprotein molecules in a composition of Cargomers can be determined, for example, by mass spectrometry (see, e.g., Zhang et al., 2010, Methods Mol Biol. 673: 211-222) and in particular FT-MS or by NMR. The identity and amount of amphipathic molecules in a composition of Cargomers can be determined, for example, by thin layer chromatography (see, e.g., Clogston and Patri, 2011, Methods Mol Biol. 697:109-17). The presence of discoidal particles in a composition of Cargomers can be determined, for example, using NMR spectroscopy.
6.3. Uses of the Cargomers
6.3.1. Therapeutic Uses of the Cargomers
[0206] The Cargomers and pharmaceutical compositions of the disclosure can be used to treat a subject for a disease or condition treatable with the one or more cargo moieties. For example, a Cargomer having a cargo moiety which is an anti-cancer agent can be used to treat a subject afflicted with cancer. The methods of treatment can comprise administering a therapeutically effective amount of a Cargomer or a pharmaceutical composition containing the Cargomer to the subject alone or in combination with a therapeutically effective amount of a second Cargomer of the disclosure or composition comprising the second Cargomer (e.g., a second pharmaceutical composition or a vaccine composition). Preferably, the Cargomer and second Cargomer comprise different cargo moieties. The Cargomer and the second Cargomer (or compositions thereof) can be administered sequentially or simultaneously. When administered simultaneously, Cargomers having different cargo moieties can be formulated into a single composition or be formulated in two separate compositions.
[0207] Cargomers and Cargomer pharmaceutical compositions can be administered to a subject according to any suitable administration regimen, for example, weekly, twice a week, or daily. Cargomers and Cargomer pharmaceutical compositions can be administered for a set number of doses, (e.g., 1 to 24 doses, 1 to 12 doses, or 12 to 24 doses), such as when the Cargomers contain an anti-infective agent, or can be administered until a disease or condition that the subject is afflicted with subsides. In some embodiments, administration of a Cargomer or Cargomer pharmaceutical composition can be repeated after verification that a biological marker of a disease or condition has regressed.
[0208] Cargomers comprising an immunogen and vaccine compositions of the disclosure can be used to immunize a subject (or induce tolerance to an antigen in a subject) by administering an effective amount of such a Cargomer or vaccine composition to the subject. The methods of immunizing a subject can comprise administering an effective amount of the Cargomer or vaccine composition alone or in combination with an effective amount of a second Cargomer of the disclosure or composition comprising the second Cargomer. Preferably, the Cargomer and second Cargomer comprise different cargo moieties. The Cargomer and the second Cargomer (or compositions thereof) can be administered sequentially or simultaneously. When administered simultaneously, Cargomers having different cargo moieties can be formulated into a single composition or be formulated in two separate compositions.
[0209] Cargomers configured to activate an immune response and vaccine compositions containing such Cargomers are useful for treating a subject having or being predisposed to any disease or disorder to which the subject's immune system mounts an immune response. The compositions are useful as prophylactic vaccines, which confer resistance in a subject to subsequent exposure to infectious agents. The compositions are also useful as therapeutic vaccines, which can be used to initiate or enhance a subject's immune response to a pre-existing antigen, such as a tumor antigen in a subject with cancer, or a viral antigen in a subject infected with a virus. For example, subjects having or at risk of cancer such as esophageal cancer can be treated with a Cargomer containing a neoantigen peptide. As another example, subjects having or at risk of a cancer such as pancreatic cancer can be treated with a Cargomer containing a shared antigen peptide. Exemplary shared antigen peptides include peptides from a mutated RAS protein (e.g., KRAS, HRAS, or NRAS), and peptides derived therefrom, e.g., peptides comprising a neoantigen peptide sequence and an added N-terminal or C-terminal amino acid sequence useful for coupling the peptide to an amphipathic molecule or anchor. Exemplary shared antigen based peptides that can be included in Cargomers of the disclosure are shown in SEQ ID NOs:15-28.
[0210] The compositions are also useful as desensitizing vaccines, which function to make an individual tolerant to an environmental antigen, such as an allergen.
[0211] Cargomers comprising a neo-antigenic peptide can be used to induce a neoplasia/tumor specific immune response in a subject, vaccinate against a neoplasia/tumor, treat and/or alleviate a symptom of cancer in a subject by administering to the subject a therapeutically effective amount of such a Cargomer or a vaccine composition comprising the Cargomer. Such Cargomers and vaccine compositions may be used for a subject that has been diagnosed as having cancer, or at risk of developing cancer. In some embodiments, the subject has a solid tumor such as breast, ovarian, prostate, lung, kidney, gastric, esophageal, colon, testicular, head and neck, pancreas, brain, melanoma, and other tumors of tissue organs and hematological tumors, such as lymphomas and leukemias, including acute myelogenous leukemia, chronic myelogenous leukemia, chronic lymphocytic leukemia, T cell lymphocytic leukemia, and B cell lymphomas. The Cargomer or vaccine composition can be administered in an amount sufficient to induce a CTL response, alone or in combination with other therapeutic agents (e.g., a chemotherapeutic or biotherapeutic agent, radiation, immunotherapy, or an anti-immunosuppressive or immunostimulatory agent). For example, a subject having melanoma can be administered a Cargomer or vaccine composition of the disclosure in combination with another therapeutic agent used to treat melanoma (e.g., aldesleukin, cobimetinib, dabrafenib, dacarbazine, talimogene laherparepvec, recombinant interferon alfa-2b, ipilimumab, pembrolizumab, trametinib, nivolumab, peginterferon alfa-2a, peginterferon alfa-2b, or orvemurafenib).
[0212] In some embodiments, a Cargomer or vaccine composition of the disclosure is administered to a subject diagnosed as having cancer or at risk of developing cancer in combination with an immunotherapy agent. Exemplary immunotherapy agents include alemtuzumab, atezolizumab, ipilimumab, ofatumumab, nivolumab, pembrolizumab, rituximab, and rurvalumab.
[0213] In some embodiments, a Cargomer or vaccine composition of the disclosure is administered to a subject diagnosed as having cancer or at risk of developing cancer in combination with an immunotherapy agent which is a checkpoint inhibitor. Exemplary checkpoint inhibitors include atezolizumab, ipilimumab, pembrolizumab, and nivolumab.
[0214] In some embodiments, a Cargomer or vaccine composition of the disclosure is administered to a subject diagnosed as having cancer or at risk of developing cancer in combination with an antibody-drug conjugate (ADC) comprising an anti-cancer agent (e.g., as described in Section 6.1.3.2). Exemplary ADCs include gemtuzumab ozogamicin (approved to treat acute myeloid leukemia), brentuximab vedotin (approved to treat Hodgkin lymphoma), trastuzumab emtansine (approved to treat HER2-positive metastatic breast cancer), and Inotuzumab ozogamicin (approved to treat acute lymphoblastic leukemia).
[0215] Subjects with or at risk for immunosuppressed conditions can be treated therapeutically or prophylactically with Cargomers configured to activate an immune response as disclosed herein. The Cargomers disclosed herein can be used for treatment of disease conditions characterized by immunosuppression, including, but not limited to, AIDS or AIDS-related complex, idiopathic immuno suppression, drug induced immunosuppression, other virally or environmentally-induced conditions, and certain congenital immune deficiencies. Such Cargomers can also be employed to increase immune function that has been impaired by the use of radiotherapy of immunosuppressive drugs (e.g., certain chemotherapeutic agents), and therefore can be particularly useful when used in conjunction with such drugs or radiotherapy.
[0216] Subjects with or at risk for coronary heart disease and/or elevated LDL-C levels can be treated therapeutically or prophylactically with Cargomers configured to activate an immune response as disclosed herein. Embodiments of the disclosure wherein Cargomers include a PCSK9-antigen and a CpG-adjuvant address such needs. Indeed, vaccination against PCSK9 with such Cargomers can be used to inhibit interaction between PCSK9 and LDLR, while avoiding the need for repeated injections of expensive mAb.
[0217] Subjects having or at risk for coronary heart disease and/or elevated LDL-C levels can be treated with a Cargomer containing a siRNA against a PCSK9 gene and/or an apoB gene.
[0218] Subjects having or at risk for Huntington's disease can be treated with a Cargomer containing a siRNA against a dysfunctional huntingtin gene.
[0219] Subjects having or at risk of Alzheimer's disease can be treated with a Cargomer containing a siRNA against an amyloid precursor protein gene.
[0220] The Cargomers and compositions can be administered in the methods of the disclosure to a subject (which is preferably a mammal and most preferably a human) by any suitable route. For example, administration can be via injection (e.g., subcutaneous, intradermal, intravenous, or intraperitoneal injection), inhalation (e.g., intranasal or intrapulmonary inhalation, implantation, optionally (e.g., via a suppository), or ocular or intraocular routes (e.g., via eye drops). In some embodiments, the solution is administered as a depot injection. In some embodiments, a Cargomer composition is administered as a perfusion over 15 to 24 hours (e.g., 15 minutes to 1 hour, 1 hour to 3 hours, 3 hours to 6 hours, 6 hours to 12 hours, or 12 hours to 24 hours).
6.3.2. Diagnostic Uses of the Cargomers
[0221] Cargomers of the disclosure comprising a diagnostic agent and diagnostic compositions comprising such Cargomers can be used for diagnosing a subject with a disease or condition or evaluating the effect of a treatment on the subject. For example, Cargomers of the disclosure comprising an imaging agent can be used in place of conventional imaging agents in an imaging procedure (e.g., CT scan or MRI scan).
6.3.2.1. Methods of Imaging a Tumor
[0222] The disclosure provides methods of using Cargomers to image tumors. In one aspect, a method for imaging a tumor comprises administering a Cargomer comprising an imaging agent (e.g., zirconium-89) to a subject and subsequently imaging the subject to detect delivery of the imaging agent to the tumor. The Cargomer can be administered by any suitable means prior to the imaging, e.g., orally or intravenously. In a preferred embodiment, the Cargomer is administered intravenously. The imaging can be performed on a part of the subject's body which is known to contain a tumor (e.g., an organ or region of the body, such as abdomen, head, or neck), or can comprise a full body scan (which can be useful, for example, to identify a secondary tumor).
[0223] The amount of time between administration of the Cargomer and the imaging of the subject typically ranges from less than 1 hour (e.g., 15 to 45 minutes, 15 to 30 minutes, or 30 to 45 minutes) to several days (e.g., 3 days to 4 days). In some embodiments, the imaging of the subject is performed from 30 minutes to 4 days after administration of the Cargomer (e.g., 1 hour to 3 days, 1 hour to 1 day, or 1 day to 3 days). In specific embodiments, the imaging is performed 1 hour after administration of the Cargomer, 1 day after administration of the Cargomer, 2 days after administration of the Cargomer, 3 days after administration of the Cargomer, or 4 days after administration of the Cargomer.
[0224] The type of imaging procedure used to detect delivery of the imaging agent to the tumor will depend upon the type of imaging agent in the Cargomer. For example, nuclear imaging scans can be used to detect imaging agents comprising a radioactive moiety. Examples of nuclear imaging scans that can be used to detect delivery of a radioactive moiety to a tumor include positron emission tomography (PET), positron emission tomography-computed tomography (PET-CT), scintigraphy (scint), single-photon emission computed tomography (SPECT), and single-photon emission computed tomography-computed tomography (SPECT-CT). When the imaging agent comprises a radioactive moiety, the amount of Cargomers administered to the subject per administration can contain, for example, 5 Mbq to 20 Mbq of radioactivity (e.g., 5 Mbq to 10 Mbq, 10 Mbq to 15 Mbq, or 15 Mbq to 20 Mbq). In some embodiments, the amount of labeled Cargomers administered to the subject per administration contains 10 Mbq to 18 Mbq of radioactivity.
[0225] Magnetic resonance imaging (MRI) (e.g., dynamic contrast enhanced magnetic resonance imaging (DCE-MRI)) can be used when the imaging agent comprises a contrast agent, and fluorescence imaging (FI) can be used when the imaging agent comprises a fluorescent moiety.
[0226] In some embodiments, an imaging technique for detecting delivery of the imaging agent to a tumor is performed in combination with a second imaging technique (e.g., shortly before or after the first imaging technique). For example, dynamic contrast enhanced magnetic resonance imaging (DCE-MRI) can be used to evaluate tumor microcirculation.
6.3.2.2. Methods of Monitoring Tumor Progression, Regression, or Recurrence
[0227] The disclosure further provides methods of using labeled Cargomers to monitor tumor progression, regression, or recurrence. In one aspect, the methods comprise administering a Cargomer comprising an imaging agent to the subject in a first administration and imaging the subject to detect delivery of the imaging agent to the tumor (e.g., as described in Section 6.3.2.1), and administering the Cargomer comprising an imaging agent to the subject in a second administration and imaging the subject to detect delivery of the imaging agent to the tumor (e.g., as described in Section 6.3.2.1). Repeating the administration of Cargomer comprising an imaging agent and imaging can be used to monitor the progression of a tumor (e.g., in the absence of any treatment or in response to a treatment), regression of a tumor (e.g., in response to a treatment), or recurrence of a tumor (e.g., after surgery to remove the tumor or after cessation of an anti-cancer treatment). As used herein, the expression surgery to remove a tumor, and the like encompasses surgeries in which all or only part of a tumor are removed from the subject.
[0228] The first administration of the Cargomer can be performed, for example, prior to surgery to remove the tumor and/or prior to beginning treatment with an anti-cancer therapy, thereby providing a baseline by which to evaluate the success of the surgery and/or efficacy of treatment. Alternatively, the first administration of the Cargomer can be performed after a surgery to remove the tumor and/or after beginning treatment with an anti-cancer therapy, thereby providing a baseline by which to evaluate tumor recurrence and/or efficacy or continued efficacy of the anti-cancer therapy.
[0229] The second administration of the Cargomer can be performed, for example, after surgery to remove the tumor and/or after the subject has begun receiving treatment with an anti-cancer therapy, thereby allowing for an evaluation of the success of the surgery and/or efficacy of the anti-cancer therapy. The administration of the Cargomer comprising an imaging agent and imaging can be repeated one or more times (e.g., once every week to once every month) to further monitor progression, regression, or recurrence of a tumor. The administration of the Cargomer comprising an imaging agent and imaging can be repeated, for example, for a set period of time, indefinitely, or until the occurrence of a specific event (e.g., remission of the cancer or when the tumor becomes undetectable by the imaging).
[0230] The methods for monitor tumor progression, regression, or recurrence can be used to guide treatment for the subject. For example, for a patient receiving treatment with an anti-cancer therapy, if the imaging indicates a decrease in tumor size from the first administration of the Cargomer comprising an imaging agent to the second administration of the Cargomer comprising an imaging agent, it may be advantageous for the patient to continue receiving the anti-cancer therapy. However, if the imaging does not indicate a decrease in tumor size (or indicates an increase) from the first administration of the Cargomer comprising an imaging agent to the second administration of the Cargomer comprising an imaging agent, it may be advantageous to alter the treatment that the subject is receiving (e.g., to discontinue treatment of the anti-cancer therapy, increase the dose of the anti-cancer therapy and/or begin treatment with a different anti-cancer therapy, for example begin treatment with a Cargomer comprising an anti-cancer agent which is different from a Cargomer comprising an anti-cancer agent which the subject has already received). After continuing or altering treatment, the administration of the Cargomer comprising an imaging agent and imaging can be repeated one or more times (e.g., as described in the preceding paragraph) to further monitor the efficacy of the continued or altered treatment.
6.3.2.3. Methods for Selecting a Subject Afflicted with a Cancer for a Treatment
[0231] The disclosure further provides methods for selecting a subject afflicted with a cancer for treatment with a Cargomer comprising an anti-cancer agent. In one aspect, a method for selecting a subject afflicted with a cancer for treatment with a Cargomer comprising an anti-cancer agent comprises administering a Cargomer comprising an imaging agent to the subject and imaging the subject to detect delivery of the imaging agent to the tumor (e.g., as described in Section 6.3.2.1), and selecting the subject for treatment with a Cargomer comprising an anti-cancer agent if the imaging shows delivery of the imaging agent to the tumor. If the imaging does not show delivery of the imaging agent to the tumor, an alternative treatment can be selected for the subject (e.g., with one or more of the anti-cancer therapies described in Section 6.1.3.2).
[0232] In some embodiments, the subject is selected to receive treatment with a Cargomer comprising an anti-cancer agent as monotherapy. In other embodiments, the subject is selected to receive treatment with a Cargomer comprising an anti-cancer agent in combination with a second anti-cancer therapy. The second anti-cancer therapy can be, for example, any of the anti-cancer therapies identified in Section 6.1.3.2. In some embodiments, the second anti-cancer therapy comprises a second Cargomer comprising a second anti-cancer agent. The subject can be selected to receive the treatment with a Cargomer comprising an anti-cancer agent prior to, concurrently with, or subsequent to the treatment with the second anti-cancer therapy. The term concurrently with is not limited to treatment regimens in which the two therapies are administered to the subject in a single administration, but encompasses regimens in which the therapeutic effect of the two therapies overlaps.
[0233] In the methods for selecting a subject afflicted with a cancer for treatment with a Cargomer comprising an anti-cancer agent described herein, the subject can be selected to receive the treatment with a Cargomer comprising an anti-cancer agent which begins before or after surgery to remove the tumor. In some embodiments, the subject can be selected to receive treatment with a Cargomer comprising an anti-cancer agent which begins before surgery to remove the tumor and continues after the surgery. In other embodiments, the subject can be selected to receive the treatment with a Cargomer comprising an anti-cancer agent in the absence of surgery to remove the tumor (e.g., when the subject's course of treatment does not include a surgery to remove the tumor, for example, when the tumor is inoperable).
6.3.2.4. Methods of Treating a Subject Afflicted with Cancer Following Tumor Imaging
[0234] The disclosure further provides methods of treating a subject afflicted with cancer following tumor imaging. In one aspect, the methods of treating a subject afflicted with a cancer comprise administering a Cargomer comprising an imaging agent to the subject and imaging the subject to detect delivery of the imaging agent to the tumor (e.g., as described in Section 6.3.2.1), and administering a Cargomer comprising an anti-cancer agent to the subject if the imaging shows delivery of the imaging agent to the tumor. If the imaging does not show delivery of the imaging agent to the tumor, an alternative treatment can be selected for the subject (e.g., with one or more of the anti-cancer therapies described in Section 6.1.3.2).
[0235] In some embodiments, the subject is administered treatment with a Cargomer an anti-cancer agent as monotherapy. In other embodiments, the subject is administered treatment with a Cargomer comprising an anti-cancer agent in combination with a second anti-cancer therapy. The second anti-cancer therapy can be, for example, any of the anti-cancer therapies identified in Section 6.1.3.2. In some embodiments, the second anti-cancer therapy comprises a second Cargomer comprising a second anti-cancer agent.
[0236] In the methods for treating a subject afflicted with a cancer described herein, the subject can be administered a Cargomer comprising an anti-cancer agent for the first time before or after surgery to remove the tumor. In some embodiments, the subject can begin receiving treatment with a Cargomer comprising an anti-cancer agent before surgery to remove the tumor and continue receiving the Cargomer comprising an anti-cancer agent after the surgery. In other embodiments, the subject can be administered a Cargomer comprising an anti-cancer agent in the absence of surgery to remove the tumor (e.g., when the subject's course of treatment does not include a surgery to remove the tumor, for example, when the tumor is inoperable).
7. EXEMPLARY METHODS FOR PREPARING CARGOMERS
[0237] Cargomers having a defined number of apolipoprotein molecules can be prepared in an aqueous solution by defining the appropriate pH, the concentration of apolipoprotein monomers and amphipathic molecules, the ionic strength and the temperature to make a solution of empty Cargomers. Cargo moieties can be added to the solution of empty Cargomers as a solution or as a powder in order to make loaded Cargomers having a defined molar ratio of apolipoprotein to cargo moieties. The loaded Cargomers can be used directly after being formed or can be purified in order to separate loaded Cargomers from unbound molecules (e.g., unbound cargo moieties).
[0238] When cargo molecules are not easily soluble in aqueous solutions, the apolipoprotein, amphipathic molecules and the cargo moieties can be solubilized in an organic solvent solution in order to make a homogeneous solution and avoid any aggregates or precipitates. Then the solvent can be removed by any suitable technique known in the art for removing a solvent from a solution, such as but not limited to evaporation, freeze-drying, spray-drying, etc. in order to make a solid powder or film in which the apolipoprotein, amphipathic molecules, and cargo moieties have been intimately mixed. An aqueous solution with the appropriate pH and ionic strength can be added to the powder or film to solubilize the molecules to spontaneously form loaded Cargomers at the appropriate concentrations. Addition of the aqueous solution can be done at a fixed temperature or, right after the addition, the mixture can be heated at a temperature up to 80 degrees Celsius. The mixture can also be thermal cycled (e.g., between 2 and 10 cycles) between a low temperature (e.g., no lower than 10 degrees Celsius) and a higher temperature (e.g., not exceeding 80 degrees Celsius) to form the Cargomers. Thermal cycling methods have been described for making discoidal lipoprotein complexes (see, WO 2012/109162), and those methods can similarly be used to make Cargomers. Among organic solvents, para-xylene, ortho-xylene or acetic acid solutions are preferred for freeze drying. In some embodiments, acetic acid solutions from 70 to 100% are used. Other solvents or mixtures of solvents can be used and be later eliminated by different techniques for removing solvents that are well-known in the art. Solvents can be selected in order to solubilize each component of the Cargomers. In the case of a mixture of solvents, they should be miscible together. After hydration (addition of the aqueous solution) the Cargomers can be purified by any appropriate technique known in the art such as but not limited to chromatography, filtration, electrophoresis, etc. in order to eliminate unbound material or used without further separation/purification. After hydration (addition of the aqueous solution), pH can be adjusted and/or ionic strength can be adjusted, and/or osmolality can be adjusted.
[0239] In one embodiment, the following steps can be followed in order to prepare Cargomers comprising multimeric apolipoprotein. 1) Select conditions that favor formation of multimeric apolipoprotein (e.g., ApoA-I), e.g., select a concentration of apolipoprotein, temperature, ionic strength of the aqueous solvent used, and pH that favor multimeric forms (see Section 6.1). 2) Confirm the presence of multimeric apolipoprotein by an analytical method, e.g., dynamic light scattering (DLS), static light scattering, size exclusion chromatography, or gel electrophoresis. See, e.g., Schonfeld et al., 2016, J. Phys. Chem. B, 120:1228-1235; Jayaraman et al., 2011, Journal of Biological Chemistry, 286(41):35610-35623; Gianazza et al., 1997, Biochemistry, 36:7898-7905. Such analysis should be performed using conditions that will not perturb the existence of the multimeric apolipoprotein. For example, significantly diluting a sample and/or adding the sample to a high salt buffer for analysis can cause dissociation of multimeric apolipoprotein. 3) To the apolipoprotein solution, add one or more cargo moieties (optionally attached to anchors) and an amount of amphipathic molecules sufficient to solubilize the apoliprotein molecules. The one or more of the cargo moieties and the one or more of the amphipathic molecules can be the same molecules or different molecules. The addition of each ingredient can be done sequentially, in mixture, or all at once. The multimeric form of apolipoprotein can be determined for the solution of apolipoprotein alone or after the mixing of apolipoprotein with one or more ingredients. The mixture containing all Cargomer components can be incubated (e.g., at a single temperature or thermal cycled) and/or mixed to promote Cargomer formation. Functional assays can be used to test and select the best loaded Cargomers from a structure point of view, an homogeneity point of view, or from an efficacy point of view.
8. EXAMPLES
8.1. Example 1: ApoA-I/DPPG/Sphingomyelin Cargomers
[0240] Equimolar amounts of 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1-glycerol)] (DPPG) and sphingomyelin (SM) are weighed, solubilized in CHCl.sub.3 and dried under a stream of N2. The lipid film is dispersed in 10 mM phosphate buffer pH 8.0 at 37? C. using a high sheer Ultra-Turax T25 mixer for 5 min. The solution is kept under a nitrogen overlay during preparation.
[0241] A solution comprising a therapeutic agent is made by dissolving an amount of the therapeutic agent in water.
[0242] A solution of purified human ApoA-I is thawed at room temperature. The ApoA-I solution, DPPG:SM solution, and therapeutic agent solution are mixed to provide a mixture having ApoA-I, DPPG, and SM at a 1:2:2 molar ratio, and the therapeutic agent. The mixture is heated to 37? C. for 4 hours. The mixture is then subjected to thermal cycling (three cycles of 20 minutes at 57?+/?2? C. and 5 minutes at 37?+/?2? C.) to complete formation of the Cargomers. After completion of the thermal cycling, the Cargomer solution is cooled down and stored at 4? C.
8.2. Example 2: Study of Cargomers Loaded with Tumor Antigen Peptides and Cholesterol-CpG Oligonucleotides in a Syngeneic Mouse Cancer Model
[0243] The purpose of this study is to evaluate the efficacy of Cargomers loaded with tumor antigen (TA) peptides and cholesterol-CpG oligonucleotides (chol-CpG) in a syngeneic mouse cancer model. The scheme for the study is shown in
8.2.1. Materials and Methods
8.2.1.1. Cargomers
[0244] Cargomers comprising ApoA-I and chol-CpG (5-T*C*C*A*T*G*A*C*G*T*T*C*C*T*G*A*C*G*T*T/3CholTEG/-3 (SEQ ID NO: 11)) at a 10:1 molar ratio and Cargomers comprising ApoA-I and TA peptides M27 (LCPGNKYEM (SEQ ID NO:12)), M30 (CSSVDWENVSPELNSTDQ (SEQ ID NO:13)), and TRP2 (CSVYDFFVWL (SEQ ID NO:14)) at an ApoA-I:TA peptide molar ratio of 1:2 and 1:4 were prepared. To make the Cargomers comprising TA peptides, the TA peptides were first reacted with PDP-PE lipid (1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-(3-(2-pyridyldithio) propionate), sodium salt) and then incorporated into the Cargomers. The Cargomers were stored at 4? C. after preparation and were allowed to stand at room temperature prior to use. The Cargomers containing chol-CpG and the Cargomers containing the TA peptides were mixed prior to administration.
8.2.1.2. Mice
[0245] 64 female C57BL/6 mice 5 weeks of age and weighing 18-22 g at the beginning of the study were used in the study. Animals were housed in cages in 8 groups of 8 animals. Animals were allowed a minimum acclimatization period of 4 days in the housing room prior to initiation of the study. During acclimatization and for the duration of the study, feed and water were offered to the mice ad libitum.
8.2.1.3. Cell Culture and Tumor Induction
[0246] B16F10 murine melanoma cells were cultured in Dulbecco modified Eagle medium supplemented with 10% fetal bovine serum and 2 mM glutamine and maintained in a humidified atmosphere of 5% CO2 in air at 37? C. Tumor induction was performed by implanting 1?10.sup.5 B16F10 murine melanoma cells by subcutaneous injection on the right flank of each animal. Cells for implanatation were prepared in PBS and a final volume of 0.1 mL of cell suspension was injected into each mouse. Implantation was done on Day 0 after shaving and depilation of the animals at Day ?1.
[0247] Tumor engraftment was monitored by daily observation and palpation. Caliper measurement was performed every other day. Tumor size in mm.sup.3 was estimated from the formula w.sup.2?l??/6 where l is the longest diameter of the tumor and w is the diameter perpendicular to the longest diameter measured in millimeters.
8.2.1.4. Treatments
[0248] The 8 groups of mice received one of 8 treatments as shown in Table 2:
TABLE-US-00002 TABLE 2 Treatment Groups Vaccination (SC) Dose (nmol per animal) Immuno- Chol- Volume therapy Group Formulation ApoA-I CpG TA administered (IP) 1 Vehicle 0 0 0 0.1 mL No (PBS) 2 ApoA-I 26 0 0 0.1 mL No 3 TAs + 0 2.3 15 0.1 mL No Chol-CpG (non- Cargomer form) 4 Cargomers 30.5 2.3 15 0.1 mL No (1:2).sup.1 5 Cargomers 26.75 2.3 15 0.1 mL No (1:4).sup.2 6 Cargomers 30.5 2.3 15 0.1 mL Yes (1:2).sup.1 7 Cargomers 26.75 2.3 15 0.1 mL Yes (1:4).sup.2 8 Vehicle 0 0 0 Yes (PBS) .sup.1mixture of ApoA-I:chol-CpG (10:1) Cargomers and ApoA-I:TA (1:2) Cargomers .sup.2mixture of ApoA-I:chol-CpG (10:1) Cargomers and ApoA-I:TA (1:4) Cargomers
[0249] Vaccination was performed once a week for 3 weeks (at days 4, 11 and 18) by subcutaneous injection. Immunotherapy consisting of anti-CTLA4 and anti-PD1 antibodies administered by intraperitoneal injection (100 ?g of each antibody in a final volume of 0.2 mL in PBS per mouse) was performed twice a week for 3 weeks (at days 5, 8, 12, 15, 19 and 22).
8.2.1.5. Results
[0250] Tumor volumes for each of the 8 treatment groups during the course of the study are shown in
[0251] Bodyweights and baseline-corrected bodyweights for the treatment groups are shown in
[0252] Individual tumour growth curves with fraction of complete tumour regression (CR) for the 8 treatment groups are shown in
[0253] The survival proportion for each treatment group of is shown in
[0254] Thus, the results show that Cargomers comprising chol-CpG and TAs can be successfully used to deliver chol-CpG and TAs for cancer immunotherapy.
8.3. Example 3: Follow-Up Study with Surviving Mice from Example 2
[0255] Surviving animals from Example 2 which were treated with Cargomers (with or without check point inhibitor treatment) were injected with new tumor cells and followed over time. Naive mice of same age were added as a control group.
[0256] Tumors grew rapidly in most of the control group while the formerly Cargomer treated mice had slow progression as shown in
8.4. Example 4: Study of Cargomers Loaded with Tumor Antigen Peptides and Cholesterol-CpG Oligonucleotides in a Syngeneic Mouse Cancer Model II
[0257] A study similar to the study of Example 2 was performed with new preparations of Cargomers. Animals were divided into five treatment groups as follows:
TABLE-US-00003 TABLE 3 Treatment groups Vaccination/SC Number Dose (nmol per animal) Immuno- of Formulation Tumor Antigens Volume therapy/ Group animals ID ApoA1 Cho-CpG (M27:M30:TRP2) administered IP 1 8 Vehicle 0 0 0 0.1 mL No 2 8 TAs + 0 2.5 15 0.1 mL No Chol-CpG 3 8 TAs + 0 2.5 15 0.1 mL Yes Chol-CpG 4 8 Cargomers 35 2.5 15 0.1 mL No 1:2.sup.1 5 8 Cargomers 30 2.5 15 0.1 mL No 1:4.sup.2 .sup.1mixture of ApoA-I:chol-CpG (10:1) Cargomers and ApoA-I:TA (1:2) Cargomers .sup.2mixture of ApoA-I:chol-CpG (10:1) Cargomers and ApoA-I:TA (1:4) Cargomers
[0258]
[0259] Example 4 confirms the that Cargomers can induce an immune response preventing tumor growth. Cargomer 1:4 was found to be the most potent and was found to not require check point inhibition for efficacy.
8.5. Example 5: Study of Cargomers Loaded with Tumor Antigen Peptides and Cholesterol-CpG Oligonucleotides in a Syngeneic Mouse Cancer Model III
[0260] A study similar to the study of Example 2 is being performed with new preparations of Cargomers. Tumor volume for the different treatment groups through day 18 of the study is shown in
8.6. Example 6: Cargomers with Nucleic Acid Cargo
[0261] Cargomers were made with the following nucleic acid cargo moieties: an anti-STAT3 antisense oligonucleotide; an anti-KRAS siRNA; an anti-EGFR siRNA; and CpG, an adjuvant. Size exclusion chromatograms showing the Cargomers and components of the Cargomers containing anti-STAT3 antisense oligonucleotide are shown in
[0262] The efficacy of the Cargomers containing an anti-STAT3 antisense oligonucleotide, the Cargomers containing an anti-KRAS siRNA, and the Cargomers containing an anti-EGFR siRNA to silence their respective targets was tested in an in vitro assay using PANC-1 cells. Western blots from the assay are shown in
8.7. Example 7: Cargomers with Peptide Cargo
[0263] Cargomers of the type used in Examples 2 through 4 were made with the following peptide cargo moieties: M27, M30, and TRP2. Size exclusion chromatograms showing the Cargomers and components of the Cargomers containing the peptides are shown in
[0264] An elegant and simple way to assess binding of a peptide to a Cargomer is to increase the temperature to observe the dissociation of the components because as the temperature is increased, the dissociation-association equilibrium is displaced in favor of the monomeric form of ApoA-I, as shown in
[0265]
8.8. Example 8: Study of Cargomers Loaded with siRNA or Antisense Oligonucleotides in a Pancreatic Cancer Model
[0266] The purpose of this study is to evaluate the efficacy of Cargomers loaded with siRNA or antisense oligonucleotide in a pancreatic cancer model.
[0267] Tumor induction is performed by implanting 2?10.sup.6 PANC1 human pancreatic adenocarcinoma cells by subcutaneous injection on the right flank of female BALB/c nude mice.
[0268] Cargomers loaded with siRNA targeting KRASG.sup.12D, siRNA targeting EGFR or antisense oligonucleotide (ASO) targeting STAT3 are administered to the animals according to the following protocol:
TABLE-US-00004 TABLE 4 Example 8 protocol Dose (nmol per Number animal) of siRNA/ Route of Dose Volume Group animals Formulation ID ApoA1 ASO administration (mg/kg) Frequency administered 1 10 Cargomers-siRNA 36 3.6 SC 50 every 0.1 mL scramble other day (negative control) 2 10 siRNA KRAS.sup.G12D + 10.8 SC every 0.3 mL siRNA EGFR + other day ASO STAT3 3 10 Cargomers-siRNA 36 3.6 SC 50 every 0.1 mL KRAS.sup.G12D other day 4 10 Cargomers-ASO 36 3.6 SC 50 every 0.1 mL STAT3 other day 5 10 Cargomers-siRNA 36 3.6 SC 50 every 0.1 mL EGFR other day 6 10 Pool Cargomers- 108 10.8 SC 150 every 0.3 mL siRNA/ASO other day 7 10 Gemcitabine IV 50 twice a 0.1 mL week
[0269] Cargomers loaded with siRNA targeting KRASG.sup.12D, siRNA targeting EGFR or antisense oligonucleotide (ASO) targeting STAT3 reduce tumor growth and prolong survival of tumor bearing mice.
8.9. Example 9: Analysis of Chol-CpG Cargomers
[0270] ApoA-I and sphingomyelin were mixed together to provide a mixture of ApoA-I and SM at 120 ?M and 240 ?M, respectively, in PBS, pH 7.4 ApoA-I is multimeric under these conditions. Cholesterol-CpG (see Example 2) was added to the mixture to provide a final concentration of 12 ?M and an ApoA-I:SM:Chol-CpG molar ratio of 1:2:0.1. The mixture was incubated between 2-8 hours at 37? C. to allow the formation of Cargomers. Separately, a sample of CER-001 was incubated with chol-CpG at a 1:0.5 molar ratio.
[0271] Analysis by HPLC was performed on the Cargomers, the components used to make the Cargomers, CER-001, and CER-001:CpG using a Superdex? 200 10/300 GL column (L?I.D. 30 cm?10 mm, 13 ?m average particle size) (GE Healthcare, Ref. 17-5175-01). The buffer used for the HPLC was a 10 mM phosphate buffer, pH 7.4. The chromatograms are shown in
[0272] As expected, the smaller multimeric ApoA-I (ApoA-I alone) eluted later than CER-001 (
9. SEQUENCE LISTING
[0273]
TABLE-US-00005 SEQ ID NO Sequence 1 MKAAVLTLAVLFLTGSQARHFWQQDEPPQS PWDRVKDLATVYVDVLKDSGRDYVSQFEGS ALGKQLNLKLLDNWDSVTSTFSKLREQLGP VTQEFWDNLEKETEGLRQEMSKDLEEVKAK VQPYLDDFQKKWQEEMELYRQKVEPLRAEL QEGARQKLHELQEKLSPLGEEMRDRARAHV DALRTHLAPYSDELRQRLAARLEALKENGG ARLAEYHAKATEHLSTLSEKAKPALEDLRQ GLLPVLESFKVSFLSALEEYTKKLNTQ 2 DEPPQSPWDRVKDLATVYVDVLKDSGRDYV SQFEGSALGKQLNLKLLDNWDSVTSTFSKL REQLGPVTQEFWDNLEKETEGLRQEMSKDL EEVKAKVQPYLDDFQKKWQEEMELYRQKVE PLRAELQEGARQKLHELQEKLSPLGEEMRD RARAHVDALRTHLAPYSDELRQRLAARLEA LKENGGARLAEYHAKATEHLSTLSEKAKPA LEDLRQGLLPVLESFKVSFLSALEEYTKKL NTQ 3 5-GGGGGACGA:TCGTCGGGGGG-3 (20mer) 4 5-GGGGACGAC:GTCGTGGGGGGG-3 (21mer) 5 5-TCGTCGTTTTGTCGTTTTGTCGTT-3 (24mer) 6 5-TCGACGTTCGTCGTTCGTCGTTC-3 (23mer) 7 5-TCGCGACGTTCGCCCGACGTTCGGTA-3 (26mer) 8 5-TCGTCGTTTTCGGCGC:GCGCCG-3 (22mer) 9 5-TCGTCGTCGTTC:GAACGACGTTGAT-3 (25mer) 10 5-TCGCGAACGTTCGCCGCGTTCGAACGCGG-3 (29mer) 11 5-T*C*C*A*T*G*A*C*G*T*T*C*C*T*G*A*C*G*T*T-3 12 LCPGNKYEM 13 CSSVDWENVSPELNSTDQ 14 CSVYDFFVWL 15 CYKLVVVGADGVGKSAL 16 CYKLVVVGAVGVGKSAL 17 CYKLVVVGACGVGKSAL 18 CYKLVVVGAGGVGKSAL 19 CYKLVVVGADGVGKSALTIQLIQ 20 CGGMTEYKLVVVGAGG 21 CGGEGFLCVFAINNTKS 22 CGGKSALTIQLIQNH 23 KLVVVGADGVGKSAL 24 KLVVVGAVGVGKSAL 25 KLVVVGACGVGKSAL 26 KLVVVGAGGVGKSAL 27 YKLVVVGADGVGKSALTIQLI 28 YKLVVVGAGGVGKSALTIQLI
10. SPECIFIC EMBODIMENTS
[0274] The present disclosure is exemplified by the specific embodiments below.
[0275] 1. A Cargomer comprising: [0276] (a) 1-8 apolipoprotein molecules; [0277] (b) one or more cargo moieties; [0278] (c) an amount of amphipathic molecules sufficient to solubilize the apolipoprotein molecules, wherein one or more of the cargo moieties of (b) and one or more of the amphipathic molecules of (c) can be the same molecule(s) in the Cargomer; [0279] (d) optionally, one or more anchors non-covalently coupling one or more cargo moieties to the apolipoprotein molecules; and [0280] (e) optionally, one or more linkers covalently coupling one or more cargo moieties to one or more apolipoprotein molecules, one or more amphipathic molecules or one or more anchors, [0281] wherein the amphipathic molecules, the cargo moieties and, if present, the anchors and/or linkers together contribute a net charge of at least +1 or ?1 per apolipoprotein molecule in the Cargomer.
[0282] 2. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:15.
[0283] 3. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:15.
[0284] 4. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:15.
[0285] 5. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:15.
[0286] 6. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:15.
[0287] 7. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:15.
[0288] 8. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:15.
[0289] 9. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:15.
[0290] 10. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:14.
[0291] 11. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:14.
[0292] 12. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:14.
[0293] 13. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:14.
[0294] 14. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:14.
[0295] 15. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:14.
[0296] 16. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:14.
[0297] 17. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:14.
[0298] 18. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:13.
[0299] 19. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:13.
[0300] 20. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:13.
[0301] 21. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:13.
[0302] 22. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:13.
[0303] 23. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:13.
[0304] 24. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:13.
[0305] 25. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:13.
[0306] 26. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:12.
[0307] 27. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:12.
[0308] 28. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:12.
[0309] 29. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:12.
[0310] 30. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:12.
[0311] 31. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:12.
[0312] 32. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:12.
[0313] 33. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:12.
[0314] 34. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:11.
[0315] 35. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:11.
[0316] 36. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:11.
[0317] 37. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:11.
[0318] 38. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:11.
[0319] 39. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:11.
[0320] 40. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:11.
[0321] 41. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:11.
[0322] 42. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:10.
[0323] 43. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:10.
[0324] 44. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:10.
[0325] 45. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:10.
[0326] 46. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:10.
[0327] 47. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:10.
[0328] 48. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:10.
[0329] 49. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:10.
[0330] 50. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:9.
[0331] 51. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:9.
[0332] 52. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:9.
[0333] 53. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:9.
[0334] 54. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:9.
[0335] 55. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:9.
[0336] 56. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:9.
[0337] 57. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:9.
[0338] 58. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:8.
[0339] 59. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:8.
[0340] 60. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:8.
[0341] 61. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:8.
[0342] 62. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:8.
[0343] 63. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:8.
[0344] 64. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:8.
[0345] 65. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:8.
[0346] 66. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:7.
[0347] 67. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:7.
[0348] 68. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:7.
[0349] 69. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:7.
[0350] 70. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:7.
[0351] 71. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:7.
[0352] 72. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:7.
[0353] 73. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:7.
[0354] 74. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:6.
[0355] 75. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:6.
[0356] 76. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:6.
[0357] 77. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:6.
[0358] 78. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:6.
[0359] 79. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:6.
[0360] 80. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:6.
[0361] 81. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:6.
[0362] 82. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:5.
[0363] 83. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:5.
[0364] 84. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:5.
[0365] 85. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:5.
[0366] 86. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:5.
[0367] 87. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:5.
[0368] 88. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:5.
[0369] 89. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:5.
[0370] 90. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:4.
[0371] 91. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:4.
[0372] 92. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:4.
[0373] 93. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:4.
[0374] 94. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:4.
[0375] 95. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:4.
[0376] 96. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:4.
[0377] 97. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:4.
[0378] 98. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:3.
[0379] 99. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:3.
[0380] 100. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:3.
[0381] 101. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:3.
[0382] 102. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:3.
[0383] 103. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:3.
[0384] 104. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:3.
[0385] 105. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:3.
[0386] 106. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:2.
[0387] 107. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:2.
[0388] 108. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:2.
[0389] 109. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:2.
[0390] 110. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:2.
[0391] 111. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:2.
[0392] 112. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:2.
[0393] 113. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1:1 to 1:2.
[0394] 114. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:1.
[0395] 115. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 7:1 to 1:1.
[0396] 116. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 6:1 to 1:1.
[0397] 117. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:1 to 1:1.
[0398] 118. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 4:1 to 1:1.
[0399] 119. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:1 to 1:1.
[0400] 120. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 2:1 to 1:1.
[0401] 121. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 1.5:1 to 1:2.
[0402] 122. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:4 to 4:5.
[0403] 123. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:3 to 3:5.
[0404] 124. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 5:2 to 2:5.
[0405] 125. The Cargomer of embodiment 1, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 3:2 to 2:3.
[0406] 126. The Cargomer of any one of embodiments 1 to 125, which is not a discoidal particle.
[0407] 127. The Cargomer of any one of embodiments 1 to 126, which comprises 1 to 25 cargo moieties.
[0408] 128. The Cargomer of embodiment 127, which comprises 1 to 20 cargo moieties.
[0409] 129. The Cargomer of embodiment 127, which comprises 1 to 15 cargo moieties.
[0410] 130. The Cargomer of embodiment 127, which comprises 1 to 10 cargo moieties.
[0411] 131. The Cargomer of embodiment 127, which comprises 1 to 5 cargo moieties.
[0412] 132. The Cargomer of embodiment 127, which comprises 5 to 25 cargo moieties.
[0413] 133. The Cargomer of embodiment 127, which comprises 5 to 20 cargo moieties.
[0414] 134. The Cargomer of embodiment 127, which comprises 5 to 15 cargo moieties.
[0415] 135. The Cargomer of embodiment 127, which comprises 5 to 10 cargo moieties.
[0416] 136. The Cargomer of embodiment 127, which comprises 10 to 25 cargo moieties.
[0417] 137. The Cargomer of embodiment 127, which comprises 10 to 20 cargo moieties.
[0418] 138. The Cargomer of embodiment 127, which comprises 10 to 15 cargo moieties.
[0419] 139. The Cargomer of embodiment 127, which comprises 15 to 25 cargo moieties.
[0420] 140. The Cargomer of embodiment 127, which comprises 15 to 20 cargo moieties.
[0421] 141. The Cargomer of embodiment 127, which comprises 20 to 25 cargo moieties.
[0422] 142. The Cargomer of embodiment 127, which comprises 1 cargo moiety.
[0423] 143. The Cargomer of embodiment 127, which comprises 2 cargo moieties.
[0424] 144. The Cargomer of embodiment 127, which comprises 3 cargo moieties.
[0425] 145. The Cargomer of embodiment 127, which comprises 4 cargo moieties.
[0426] 146. The Cargomer of embodiment 127, which comprises 5 cargo moieties.
[0427] 147. The Cargomer of embodiment 127, which comprises 6 cargo moieties.
[0428] 148. The Cargomer of embodiment 127, which comprises 7 cargo moieties.
[0429] 149. The Cargomer of embodiment 127, which comprises 8 cargo moieties.
[0430] 150. The Cargomer of embodiment 127, which comprises 9 cargo moieties.
[0431] 151. The Cargomer of embodiment 127, which comprises 10 cargo moieties.
[0432] 152. The Cargomer of embodiment 127, which comprises 11 cargo moieties.
[0433] 153. The Cargomer of embodiment 127, which comprises 12 cargo moieties.
[0434] 154. The Cargomer of embodiment 127, which comprises 13 cargo moieties.
[0435] 155. The Cargomer of embodiment 127, which comprises 14 cargo moieties.
[0436] 156. The Cargomer of embodiment 127, which comprises 15 cargo moieties.
[0437] 157. The Cargomer of embodiment 127, which comprises 16 cargo moieties.
[0438] 158. The Cargomer of embodiment 127, which comprises 17 cargo moieties.
[0439] 159. The Cargomer of embodiment 127, which comprises 18 cargo moieties.
[0440] 160. The Cargomer of embodiment 127, which comprises 19 cargo moieties.
[0441] 161. The Cargomer of embodiment 127, which comprises 20 cargo moieties.
[0442] 162. The Cargomer of embodiment 127, which comprises 21 cargo moieties.
[0443] 163. The Cargomer of embodiment 127, which comprises 22 cargo moieties.
[0444] 164. The Cargomer of embodiment 127, which comprises 23 cargo moieties.
[0445] 165. The Cargomer of embodiment 127, which comprises 24 cargo moieties.
[0446] 166. The Cargomer of embodiment 127, which comprises 25 cargo moieties.
[0447] 167. The Cargomer of any one of embodiments 1 to 166, wherein at least one amphipathic molecule is also a cargo moiety.
[0448] 168. The Cargomer of embodiment 167, wherein the amphipathic molecule which is also a cargo moiety is a ganglioside.
[0449] 169. The Cargomer of embodiment 167, wherein the amphipathic molecule which is also a cargo moiety is a nucleic acid.
[0450] 170. The Cargomer of any one of embodiments 1 to 169, wherein at least one cargo moiety is non-covalently bound to an apolar region of the Cargomer.
[0451] 171. The Cargomer of any one of embodiments 1 to 169, wherein a majority of the cargo moieties are non-covalently bound to an apolar region of the Cargomer.
[0452] 172. The Cargomer of any one of embodiments 1 to 169, wherein all of the cargo moieties are non-covalently bound to an apolar region of the Cargomer
[0453] 173. The Cargomer of any one of embodiments 1 to 172, wherein at least one cargo moiety is coupled to an anchor.
[0454] 174. The Cargomer of embodiment 173, wherein the anchor is an amphipathic molecule.
[0455] 175. The Cargomer of embodiment 174, wherein the anchor comprises a phospholipid, which is optionally a negatively charged phospholipid.
[0456] 176. The Cargomer of embodiment 174, wherein the anchor comprises cholesterol.
[0457] 177. The Cargomer of embodiment 173, wherein the anchor is an apolar moiety.
[0458] 178. The Cargomer of embodiment 177, wherein the apolar moiety comprises an alkyl chain, an acyl chain, or a diacyl chain.
[0459] 179. The Cargomer of any one of embodiments 173 to 178, wherein the cargo moiety is coupled to the anchor by a direct bond.
[0460] 180. The Cargomer of any one of embodiments 173 to 178, wherein the cargo moiety is coupled to the anchor by a linker.
[0461] 181. The Cargomer of embodiment 180, wherein the linker coupling the cargo moiety to the anchor is a bifunctional linker.
[0462] 182. The Cargomer of embodiment 180 or embodiment 181, wherein the linker coupling the cargo moiety to the anchor is a cleavable linker.
[0463] 183. The Cargomer of embodiment 182, wherein the cleavable linker is a dipeptide linker.
[0464] 184. The Cargomer of embodiment 180 or embodiment 181, wherein the linker coupling the cargo moiety to the anchor is a non-cleavable linker.
[0465] 185. The Cargomer of any one of embodiments 1 to 184, wherein at least one cargo moiety is coupled to an apolipoprotein molecule.
[0466] 186. The Cargomer of embodiment 185, wherein the cargo moiety is coupled to the apolipoprotein by a direct bond.
[0467] 187. The Cargomer of embodiment 185, wherein the cargo moiety is coupled to the apolipoprotein by a linker.
[0468] 188. The Cargomer of embodiment 187, wherein the linker coupling the cargo moiety to the apolipoprotein is a bifunctional linker.
[0469] 189. The Cargomer of embodiment 187 or embodiment 188, wherein the linker coupling the cargo moiety to the apolipoprotein is a cleavable linker.
[0470] 190. The Cargomer of embodiment 189, wherein the cleavable linker coupling the cargo moiety to the apolipoprotein is a dipeptide linker.
[0471] 191. The Cargomer of embodiment 187 or embodiment 188, wherein the linker coupling the cargo moiety to the apolipoprotein is a non-cleavable linker.
[0472] 192. The Cargomer of any one of embodiments 1 to 191, wherein the amphipathic molecules comprise a phospholipid, a detergent, a fatty acid, an apolar moiety or sterol covalently attached to a sugar, or a combination thereof.
[0473] 193. The Cargomer of embodiment 192, wherein the apolar moiety is an acyl or a diacyl chain.
[0474] 194. The Cargomer of embodiment 192 or embodiment 193, wherein the sugar is a modified sugar or a substituted sugar.
[0475] 195. The Cargomer of embodiment 192, wherein the amphipathic molecules comprise or consist of phospholipid molecules.
[0476] 196. The Cargomer of embodiment 195, wherein the phospholipid molecules comprise positively charged phospholipids, neutral phospholipids, negatively charged lipids or a combination thereof.
[0477] 197. The Cargomer of embodiment 195, wherein the phospholipid molecules comprise positively charged phospholipids, neutral phospholipids, or a combination thereof.
[0478] 198. The Cargomer of embodiment 195, wherein the phospholipid molecules comprise negatively charged phospholipids, neutral phospholipids or a combination thereof.
[0479] 199. The Cargomer of any one of embodiments 196 to 198, wherein the phospholipid molecules contribute a net charge of 1-3 per apolipoprotein molecule in the Cargomer.
[0480] 200. The Cargomer of embodiment 199, wherein the net charge is a negative net charge.
[0481] 201. The Cargomer of embodiment 199, wherein the net charge is a positive net charge.
[0482] 202. The Cargomer of any one of embodiments 196 to 200, wherein the phospholipid molecules consist of a combination of negatively charged and neutral phospholipids.
[0483] 203. The Cargomer of embodiment 202, wherein the molar ratio of negatively charge phospholipid to neutral phospholipid ranges from 1:1 to 1:3.
[0484] 204. The Cargomer of embodiment 203, wherein the molar ratio of negatively charged phospholipid to neutral phospholipid is about 1:1 or about 1:2.
[0485] 205. The Cargomer of any one of embodiments 1 to 204 which comprises 1 apolipoprotein molecule.
[0486] 206. The Cargomer of any one of embodiments 1 to 204 which comprises 2 apolipoprotein molecules.
[0487] 207. The Cargomer of embodiment 206 which has a Stokes radius of 5 nm or less.
[0488] 208. The Cargomer of embodiment 206 which has a Stokes radius of 4 nm or less.
[0489] 209. The Cargomer of embodiment 206 which has a Stokes radius of 3 nm or less.
[0490] 210. The Cargomer of any one of embodiments 206 to 209 which comprises 2 apolipoprotein molecules and 1, 2 or 3 negatively charged phospholipid molecules per apolipoprotein molecule.
[0491] 211. The Cargomer of any one of embodiments 1 to 204 which comprises 4 apolipoprotein molecules.
[0492] 212. The Cargomer of embodiment 211 which has a Stokes radius of 5 nm or less.
[0493] 213. The Cargomer of embodiment 211 which has a Stokes radius of 4 nm or less.
[0494] 214. The Cargomer of any one of embodiments 211 to 213 which comprises 4 apolipoprotein molecules and 1, 2 or 3 negatively charged phospholipid molecules per apolipoprotein molecule.
[0495] 215. The Cargomer of any one of embodiments 1 to 204, which comprises 8 apolipoprotein molecules.
[0496] 216. The Cargomer of embodiment 215, which has a Stokes radius of 5 nm or less.
[0497] 217. The Cargomer of embodiment 215 or embodiment 216 which comprises 8 apolipoprotein molecules and 1, 2 or 3 negatively charged phospholipid molecules per apolipoprotein molecule.
[0498] 218. The Cargomer of any one of embodiments 196 to 217, wherein the amphipathic molecules comprise a negatively charged phospholipid which is a salt of a phosphatidylinositol, a phosphatidylserine, a phosphatidylglycerol or a phosphatidic acid, optionally wherein the salt is a sodium salt or a potassium salt.
[0499] 219. The Cargomer of embodiment 218, wherein the negatively charged phospholipid comprises a salt of a phosphatidylglycerol or a phosphatidylinositol.
[0500] 220. The Cargomer of embodiment 219, wherein the negatively charged phospholipid comprises a salt of 1,2-dipalmitoyl-sn-glycero-3-[phospho-rac-(1-glycerol)] (DPPG).
[0501] 221. The Cargomer of any one of embodiments 1 to 220 wherein the amphipathic molecules comprise a neutral phospholipid.
[0502] 222. The Cargomer of embodiment 221, wherein the neutral phospholipid is a lecithin or a sphingomyelin.
[0503] 223. The Cargomer of embodiment 222, wherein the neutral lipid is a sphingomyelin.
[0504] 224. The Cargomer of embodiment 223, wherein the sphingomyelin is egg sphingomyelin, a plant sphingomyelin, or a synthetic sphingomyelin.
[0505] 225. The Cargomer of any one of embodiments 1 to 224, wherein the apolipoprotein molecules comprise or consist of apolipoprotein A-I (ApoA-I) molecules.
[0506] 226. The Cargomer of embodiment 225, wherein said ApoA-I molecules are human ApoA-I molecules.
[0507] 227. The Cargomer of embodiment 226 wherein said ApoA-I molecules are recombinant.
[0508] 228. The Cargomer of any one of embodiments 225 to 227, wherein the ApoA-I molecules are Apolipoprotein A-I.sub.Milano (ApoA-I.sub.M), Apolipoprotein A-I.sub.Paris (ApoA-I.sub.P), or Apolipoprotein A-I.sub.Zaragoza (ApoA-I.sub.Z) molecules.
[0509] 229. The Cargomer of any one of embodiments 225 to 228, wherein the ApoA-I molecules comprise an amino acid sequence having at least 95% sequence identity to SEQ ID NO:2.
[0510] 230. The Cargomer of embodiment 229, wherein the ApoA-I molecules comprise an amino acid sequence having at least 98% sequence identity to SEQ ID NO:2.
[0511] 231. The Cargomer of embodiment 230, wherein the ApoA-I molecules comprise an amino acid sequence having at least 98% sequence identity to SEQ ID NO:2.
[0512] 232. The Cargomer of embodiment 231, wherein the ApoA-I molecules comprise an amino acid sequence having at least 99% sequence identity to SEQ ID NO:2, optionally wherein the ApoA-I molecules comprise an amino acid sequence identical to SEQ ID NO:2.
[0513] 233. The Cargomer of any one of embodiments 1 to 224, wherein the apolipoprotein molecules are ApoA-I, ApoA-II, ApoA-IV, ApoA-V, ApoB, ApoC-I, ApoC-II, ApoC-III, ApoD, ApoE, ApoJ, or ApoH, or any combination of two or more of the foregoing.
[0514] 234. The Cargomer of any one of embodiments 1 to 233, which comprises a mixture of different apolipoproteins.
[0515] 235. The Cargomer of any one of embodiments 1 to 234, wherein one or more amphipathic molecules are configured to solubilize the apolipoprotein molecule(s).
[0516] 236. The Cargomer of any one of embodiments 1 to 234, wherein the apolipoprotein in the Cargomer is soluble in a biological fluid.
[0517] 237. The Cargomer of any one of embodiments 1 to 236 which is soluble in a biological fluid.
[0518] 238. The Cargomer of embodiment 236 or embodiment 237, wherein the biological fluid is lymph, cerebrospinal fluid, vitreous humor, aqueous humor, plasma, serum or blood.
[0519] 239. The Cargomer of any one of embodiments 1 to 238 in which the cargo moiety contributes a net charge of 1, 2 or 3 per apolipoprotein molecule in the Cargomer.
[0520] 240. The Cargomer of any one of embodiments 1 to 239 in which the cargo moiety contributes a net charge of 1, 2 or 3 to the Cargomer.
[0521] 241. The Cargomer of embodiment 239 or embodiment 240, wherein the net charge is a negative charge.
[0522] 242. The Cargomer of embodiment 239 or embodiment 240, wherein the net charge is a positive charge.
[0523] 243. The Cargomer of any one of embodiments 1 to 242, which does not contain cholesterol or a cholesterol derivative.
[0524] 244. The Cargomer of any one of embodiments 1 to 243, which contains cholesterol or a cholesterol derivative.
[0525] 245. The Cargomer of any one of embodiments 1 to 244, wherein one or more cargo moieties comprise a therapeutic agent, a diagnostic agent or an immunogen.
[0526] 246. The Cargomer of embodiment 245, wherein the one or more cargo moieties comprise a therapeutic agent.
[0527] 247. The Cargomer of embodiment 246, wherein the therapeutic agent comprises an immunoinhibitory agent.
[0528] 248. The Cargomer of embodiment 247, wherein the immunoinhibitory agent comprises a steroid, retinoic acid, dexamethasone, or cyclophosphamide.
[0529] 249. The Cargomer of embodiment 246, wherein the therapeutic agent comprises an immunostimulatory agent.
[0530] 250. The Cargomer of embodiment 249, wherein the immunostimulatory agent comprise a poly-I:poly-C oligonucleotide.
[0531] 251. The Cargomer of embodiment 249, wherein the immunostimulatory agent comprises a CpG oligonucleotide.
[0532] 252. The Cargomer of embodiment 251, wherein the CpG oligonucleotide is a class A CpG oligonucleotide.
[0533] 253. The Cargomer of embodiment 252, wherein the CpG oligonucleotide has a nucleotide sequence comprising or consisting of the nucleotide sequence of SEQ ID NO:3 or SEQ ID NO:4.
[0534] 254. The Cargomer of embodiment 251, wherein the CpG oligonucleotide is a class B CpG oligonucleotide.
[0535] 255. The Cargomer of embodiment 254, wherein the CpG oligonucleotide has a nucleotide sequence comprising or consisting of the nucleotide sequence of SEQ ID NO:5, SEQ ID NO:6 or SEQ ID NO:7.
[0536] 256. The Cargomer of embodiment 251, wherein the CpG oligonucleotide is a class C CpG oligonucleotide.
[0537] 257. The Cargomer of embodiment 256, wherein the CpG oligonucleotide has a nucleotide sequence comprising or consisting of the nucleotide sequence of SEQ ID NO:8, SEQ ID NO:9, or SEQ ID NO:10.
[0538] 258. The Cargomer of any one of embodiments 251 to 257, wherein the CpG oligonucleotide is covalently attached to an amphipathic molecule in the Cargomer.
[0539] 259. The Cargomer of embodiment 258, wherein the amphipathic molecule is a phospholipid.
[0540] 260. The Cargomer of embodiment 258, wherein the amphipathic molecule is cholesterol.
[0541] 261. The Cargomer of embodiment 246, wherein the therapeutic agent comprises an anti-cancer agent, optionally wherein the anti-cancer agent is an anti-melanoma agent, optionally wherein the anti-melanoma agent comprises aldesleukin, cobimetinib, dabrafenib, dacarbazine, talimogene laherparepvec, ipilimumab, pembrolizumab, trametinib, nivolumab, or orvemurafenib.
[0542] 262. The Cargomer of embodiment 261, wherein the anti-cancer agent comprises a topoisomerase inhibitor, a DNA alkylating agent, a DNA strand break inducing agent, an anti-microtubule agent, an anti-metabolic agent, an anthracycline, a vinca alkaloid, or an epipodophyllotoxin, a tyrosine kinase inhibitor, a CDK inhibitor, a MAP kinase inhibitor, an EGFR inhibitor, or a VEGF inhibitor.
[0543] 263. The Cargomer of embodiment 246, wherein the therapeutic agent comprises an anti-infective agent.
[0544] 264. The Cargomer of embodiment 263, wherein the anti-infective agent comprises an anti-bacterial agent, an anti-viral agent, an anti-parasitic agent, an anti-fungal agent, or an anti-mycobacterial agent.
[0545] 265. The Cargomer of embodiment 263, wherein the anti-infective agent comprises an anti-bacterial agent, optionally wherein the anti-bacterial agent is a ?-lactam antibiotic, a penicillin, a cephalosporin, a ?-lactamase inhibitor, vancomycin, an aminoglycoside, a tetracycline, chloramphenicol, erythromycin, lincomycin, clindamycin, rifampin, metronidazole, a polymyxin, a sulfonamide, or a quinoline.
[0546] 266. The Cargomer of embodiment 263, wherein the anti-infective agent comprises an anti-viral agent, optionally wherein the anti-viral agent is amantadine, rimantadine, ribivarin, acyclovir, vidarabine, trifluorothymidine, ganciclovir, zidovudine, retinovir, or an interferon.
[0547] 267. The Cargomer of embodiment 263, wherein the anti-infective agent comprises an anti-fungal agent, optionally wherein the anti-fungal agent is an imidazole, a triazoles, a polyene macrolide antibiotic, griseofulvin, amphotericin B, or flucytosine.
[0548] 268. The Cargomer of embodiment 263, wherein the anti-infective agent comprises an anti-parasitic agent.
[0549] 269. The Cargomer of embodiment 246, wherein the therapeutic agent comprises a nucleic acid drug.
[0550] 270. The Cargomer of embodiment 269, wherein the nucleic acid comprises a naturally or non-naturally occurring DNA, a naturally or non-naturally occurring RNA, an oligonucleotide, a triple-helix forming molecule, an immunostimulatory nucleic acid, a small interfering RNA (siRNA, e.g. targeting STAT3, KRAS, or EGFR), a microRNAs (miRNA), an antisense oligonucleotide (e.g., a double-stranded antisense oligonucleotide) (e.g. targeting STAT3, KRAS, or EGFR), an aptamer, a ribozyme, a gene or gene fragment, a regulatory sequence.
[0551] 271. The Cargomer of embodiment 270, wherein the nucleic acid is complexed to a moiety to facilitate binding to or uptake by a target cell.
[0552] 272. The Cargomer of embodiment 246, wherein the therapeutic agent comprises an anti-inflammatory agent.
[0553] 273. The Cargomer of embodiment 272, wherein the anti-inflammatory agent comprises Alclofenac; Alclometasone Dipropionate; Algestone Acetonide; Alpha Amylase; Amcinafal; Amcinafide; Amfenac Sodium; Amiprilose Hydrochloride; Anakinra; Anirolac; Anitrazafen; Apazone; Aspirin; Balsalazide Disodium; Bendazac; Benoxaprofen; Benzydamine Hydrochloride; Bromelains; Broperamole; Budesonide; Carprofen; Cicloprofen; Cintazone; Cliprofen; Clobetasol Propionate; Clobetasone Butyrate; Clopirac; Cloticasone Propionate; Cormethasone Acetate; Cortodoxone; Deflazacort; Desonide; Desoximetasone; Dexamethasone Dipropionate; Diclofenac Potassium; Diclofenac Sodium; Diflorasone Diacetate; Diflumidone Sodium; Diflunisal; Difluprednate; Diftalone; Dimethyl Sulfoxide; Drocinonide; Endrysone; Enlimomab; Enolicam Sodium; Epirizole; Etodolac; Etofenamate; Felbinac; Fenamole; Fenbufen; Fenclofenac; Fenclorac; Fendosal; Fenpipalone; Fentiazac; Flazalone; Fluazacort; Flufenamic Acid; Flumizole; Flunisolide Acetate; Flunixin; Flunixin Meglumine; Fluocortin Butyl; Fluorometholone Acetate; Fluquazone; Flurbiprofen; Fluretofen; Fluticasone Propionate; Furaprofen; Furobufen; Halcinonide; Halobetasol Propionate; Halopredone Acetate; Ibufenac; Ibuprofen; Ibuprofen Aluminum; Ibuprofen Piconol; Ilonidap; Indomethacin; Indomethacin Sodium; Indoprofen; Indoxole; Intrazole; Isoflupredone Acetate; Isoxepac; Isoxicam; Ketoprofen; Lofemizole Hydrochloride; Lornoxicam; Loteprednol Etabonate; Meclofenamate Sodium; Meclofenamic Acid; Meclorisone Dibutyrate; Mefenamic Acid; Mesalamine; Meseclazone; Methylprednisolone Suleptanate; Morniflumate; Nabumetone; Naproxen; Naproxen Sodium; Naproxol; Nimazone; Olsalazine Sodium; Orgotein; Orpanoxin; Oxaprozin; Oxyphenbutazone; Paranyline Hydrochloride; Pentosan Polysulfate Sodium; Phenbutazone Sodium Glycerate; Pirfenidone; Piroxicam; Piroxicam Cinnamate; Piroxicam Olamine; Pirprofen; Prednazate; Prifelone; Prodolic Acid; Proquazone; Proxazole; Proxazole Citrate; Rimexolone; Romazarit; Salcolex; Salnacedin; Salsalate; Salycilates; Sanguinarium Chloride; Seclazone; Sermetacin; Sudoxicam; Sulindac; Suprofen; Talmetacin; Talniflumate; Talosalate; Tebufelone; Tenidap; Tenidap Sodium; Tenoxicam; Tesicam; Tesimide; Tetrydamine; Tiopinac; Tixocortol Pivalate; Tolmetin; Tolmetin Sodium; Triclonide; Triflumidate; Zidometacin; Glucocorticoids; or Zomepirac Sodium.
[0554] 274. The Cargomer of embodiment 246, wherein the therapeutic agent comprises an agent for treating cardiovascular disorders.
[0555] 275. The Cargomer of embodiment 274, wherein the agent for treating cardiovascular disorders comprises an angiotensin-converting enzyme (ACE) inhibitor (e.g., benazepril, enalapril, Lisinopril, perindopril, Ramipril), adenosine, an alpha blocker (alpha adrenergic antagonist medications) (e.g., clonidine, guanabenz, labetalol, phenoxybenzamine, terazosin, doxazosin, guanfacine, methyldopa, prazosin), an angtiotensin II receptor blocker (ARBs) (e.g., candesartan, irbesartan, olmesartan medoxomil, telmisartan, eprosartan, losartan, tasosartan, valsartan), an anticoagulant (e.g., heparin fondaparinux, warfarin, ardeparin, enoxaparin, reviparin, dalteparin, nadroparin, tinzaparin), an antiplatelet agent (e.g., abciximab, clopidogrel, eptifibatide, ticlopidine, cilostazol, dipyridamole, sulfinpyrazone, tirofiban), a beta blocker (e.g., acebutolol, betaxolol, carteolol, metoprolol, penbutolol, propranolol, atenolol, bisoprolol, esmolol, nadolol, pindolol, timolol), a calcium channel blocker (e.g., amlopidine, felodipine, isradipine, nifedipine, verapamil, diltiazem, nicardipine, nimodipine, nisoldipine), a diuretic, an aldosterone blocker, a loop diuretic (e.g., bumetanide, furosemide, ethacrynic acid, torsemide), a potassium-sparing diuretic, a thiazide diuretic (e.g., chlorothiazide, chlorthalidone, hydrochlorothiazide, hydroflumethiazide, methyclothiazide, metolazone, polythiazide, quinethazone, trichlormethiazide), an inoptropic, a bile acid sequestrant (e.g., cholestyramine, coletipol, colesevelam), a fibrate (e.g., clofibrate, gemfibrozil, fenofibrate), a statin (e.g., atorvastatin, lovastatin, simvastatin, fluvastatin, pravastatin), a selective cholesterol absorption inhibitor (e.g., ezetimibe), a potassium channel blocker (e.g., amidarone, ibutilide, dofetilide), a sodium channel blocker (e.g., disopyramide, mexiletine, procainamide, quinidine, flecainide, moricizine, propafenone), a thrombolytic agent (e.g., alteplase, reteplase, tenecteplase, anistreplase, streptokinase, urokinase), a vasoconstrictor, a vasodilator (e.g., hydralazine, minoxidil, mecamylamine, isorbide dintrate, isorbide mononitrate, nitroglycerin), a cholesteryl ester transfer protein inhibitor (e.g., anacetrapib, evacetrapib), a PPAR agonist (e.g., K-877, CER-002, DSP-8658, INT131, GFT505), an apoA-I activator (e.g., RVX-208), sphingosine-1-phosphate, a retinoid X receptor (RXR) agonist (e.g., bexarotene, CD3254, docosahexaenoic acid, fluorobexarotene, isotretinoin, retinoic acid, SRI 1237, fenretinide, HX630, liarozole dihydrochloride, LG100754 and LG101506), a liver X receptor (LXR) agonist (e.g., TO901317, ATI-111, LXR-623, XL-652, hypocholamide, GW3965, N,N-dimethyl-3beta-hydroxy-cholenamide (DMHCA), 22(R)-hydroxy cholesterol, 24(S)-hydroxy cholesterol, (?) anthrabenzoxocinone or (?) bischloroanthrabenzoxocinone ((?)-BABX)).
[0556] 276. The Cargomer of embodiment 246, wherein the therapeutic agent comprises a caspase inhibitor.
[0557] 277. The Cargomer of embodiment 276, wherein the caspase inhibitor comprises emricasan, pralnacasan, or VX-765.
[0558] 278. The Cargomer of embodiment 246, wherein the therapeutic agent comprises a bioactive agent, which is optionally deuterated.
[0559] 279. The Cargomer of embodiment 278, wherein the bioactive agent comprises a polyphenol, such as a flavonoid (e.g., an anthoxanthin such as luteolin, apigenin, tangeritin, quercetin, kaempferol, myricetin, fisetin, galangin, isorhamnetin, pachypodol, rhamnazin, a pyranoflavonol, an furanoflavonols; a flavanone such as hesperetin, naringenin, eriodictyol, and homoeriodictyol; a flavanonol such as dihydroquercetin and dihydrokaempferol, a flavan such as catechin, gallocatechin, catechin 3-gallate, gallocatechin 3-gallate, an epicatechin, epigallocatechin, epicatechin 3-gallate, epigallocatechin 3-gallate, theaflavin, and leucoanthocyanidin), a carotenoid (e.g., beta-carotene, alpha-carotene, beta-cryptoxanthin and gamma-carotene, lutein, lycopene, astaxanthin, zeaxanthin) or a phytosterol, optionally wherein the bioactive agent is deuterated.
[0560] 280. The Cargomer of embodiment 245, wherein the one or more cargo moieties comprise an immunogen.
[0561] 281. The Cargomer of embodiment 280, wherein the immunogen comprises an antigen or an antigen-encoding nucleic acid.
[0562] 282. The Cargomer of embodiment 281, wherein the antigen is an allergic antigen.
[0563] 283. The Cargomer of embodiment 282, wherein the allergic antigen is a pollen, a venom, animal dander, a fungal spore, a drug allergen or a food allergen.
[0564] 284. The Cargomer of embodiment 281, wherein the antigen is an autoantigen.
[0565] 285. The Cargomer of embodiment 284, wherein the antigen is a lupus antigen, a multiple sclerosis antigen, a rheumatoid arthritis antigen, a diabetes mellitus type I antigen, an inflammatory bowel disease antigen, a thyroiditis antigen, or a celiac disease antigen.
[0566] 286. The Cargomer of embodiment 281, wherein the antigen is a tumor antigen.
[0567] 287. The Cargomer of embodiment 286, wherein the tumor antigen is a neoantigen.
[0568] 288. The Cargomer of embodiment 286, wherein the tumor antigen is a shared antigen.
[0569] 289. The Cargomer of embodiment 245, wherein the one or more cargo moieties comprises a diagnostic agent.
[0570] 290. The Cargomer of embodiment 287, wherein the diagnostic agent comprises an imaging agent.
[0571] 291. The Cargomer of embodiment 290, wherein the imaging agent comprises a fluorescent moiety, a phosphorescent moiety, gold, a radioactive moiety, a beta emitter, or a combination thereof.
[0572] 292. The Cargomer of embodiment 291, wherein the imaging agent comprising a radioactive moiety.
[0573] 293. The Cargomer of embodiment 292, wherein the radioactive moiety comprises a radioactive species of iron, copper, magnesium, calcium, zinc, indium, gallium, technetium, fluorine, krypton, rubidium, nitrogen, iodine, xenon, thallium, zirconium, or a combination thereof.
[0574] 294. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of iron.
[0575] 295. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of copper.
[0576] 296. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of magnesium.
[0577] 297. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of calcium.
[0578] 298. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of zinc.
[0579] 299. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of indium.
[0580] 300. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of gallium.
[0581] 301. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of technetium.
[0582] 302. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of fluorine.
[0583] 303. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of krypton.
[0584] 304. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of rubidium.
[0585] 305. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of nitrogen.
[0586] 306. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of iodine.
[0587] 307. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of xenon.
[0588] 308. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of thallium.
[0589] 309. The Cargomer of embodiment 293, wherein the radioactive moiety comprises a radioactive species of zirconium.
[0590] 310. The Cargomer of embodiment 293, wherein the radioactive moiety comprises zirconium-89.
[0591] 311. The Cargomer of any one of embodiments 292 to 310, wherein the radioactive moiety comprises a metal which is a conjugated to a chelator.
[0592] 312. The Cargomer of embodiment 311, wherein the chelator comprises deferoxamine.
[0593] 313. A pharmaceutical composition comprising an effective amount of the Cargomers of any one of embodiments 245 to 279 and one or more pharmaceutically acceptable carriers, diluents, and/or excipients.
[0594] 314. A vaccine composition comprising an effective amount of the Cargomers of any one of embodiments 280 to 288 and one or more pharmaceutically acceptable carriers, diluents, excipients, and/or adjuvants.
[0595] 315. A diagnostic composition comprising an effective amount of the Cargomers of any one of embodiments 289 to 312 and one or more carriers, diluents, and/or excipients suitable for diagnostic use.
[0596] 316. A composition comprising a first Cargomer of any one of embodiments 245 to 312, a second Cargomer of any one or embodiments 245 to 312, and one or more carriers, diluents, and/or excipients.
[0597] 317. The composition of embodiment 316, wherein the first Cargomer comprises an immunostimulatory agent and the second Cargomer comprises an immunogen.
[0598] 318. The composition of embodiment 317, wherein the immunostimulatory agent comprises a CpG oligonucleotide, which is optionally covalently attached to cholesterol.
[0599] 319. The composition of embodiment 317 or 318, wherein the immunogen comprises a tumor antigen, which is optionally a neoantigen or a shared antigen.
[0600] 320. The composition of any one of embodiments 313 to 319, in which no more than 20% of the amphipathic molecules are in uncomplexed form.
[0601] 321. The composition of embodiment 320, in which no more than 10% of the amphipathic molecules are in uncomplexed form.
[0602] 322. The composition of embodiment 321, in which no more than 5% of the amphipathic molecules are uncomplexed form.
[0603] 323. The composition of embodiment 322, in which no more than 2% of the amphipathic molecules are in uncomplexed form.
[0604] 324. The composition of any one of embodiments 313 to 323, wherein a majority of the Cargomers in the composition comprise 1 apolipoprotein molecule.
[0605] 325. The composition of embodiment 324, wherein the composition further comprises Cargomers that comprise 2 apolipoprotein molecules, 4 apolipoprotein molecules, and 8 lipoprotein molecules.
[0606] 326. The composition of embodiment 325, wherein the Cargomers in the composition are in equilibrium.
[0607] 327. The composition of any one of embodiments 313 to 323, wherein a majority of the Cargomers in the composition comprise 2 apolipoprotein molecules.
[0608] 328. The composition of embodiment 327, wherein the composition further comprises Cargomers that comprise 1 apolipoprotein molecule, 4 apolipoprotein molecules, and 8 lipoprotein molecules.
[0609] 329. The composition of embodiment 328, wherein the Cargomers in the composition are in equilibrium.
[0610] 330. The composition of any one of embodiments 313 to 323, wherein a majority of the Cargomers in the composition comprise 4 apolipoprotein molecules.
[0611] 331. The composition of embodiment 330, wherein the composition further comprises Cargomers that comprise 1 apolipoprotein molecule, 2 apolipoprotein molecules, and 8 lipoprotein molecules.
[0612] 332. The composition of embodiment 331, wherein the Cargomers in the composition are in equilibrium.
[0613] 333. The composition of any one of embodiments 313 to 323, wherein a majority of the Cargomers in the composition comprise 8 apolipoprotein molecules.
[0614] 334. The composition of embodiment 333, wherein the composition further comprises Cargomers that comprise 1 apolipoprotein molecule, 2 apolipoprotein molecules, and 4 lipoprotein molecules.
[0615] 335. The composition of embodiment 334, wherein the Cargomers in the composition are in equilibrium.
[0616] 336. The composition of any one of embodiments 313 to 335, wherein the Cargomers are at least 75% homogeneous.
[0617] 337. The composition of embodiment 336, wherein the Cargomers in the composition are at least 85% homogeneous.
[0618] 338. The composition of embodiment 337, wherein the Cargomers in the composition are at least 95% homogeneous.
[0619] 339. The composition of embodiment 337, wherein the Cargomers in the composition are at least 98% homogeneous.
[0620] 340. The composition of any one of embodiments 313 to 339, wherein lipoprotein complexes that (a) have Stokes radii of greater than 2 nm or 3.4 nm and/or (b) are discoidal and/or (c) have an apolipoprotein:amphipathic molecule molar ratio of 1:8 or greater, if present, represent no more than 10% of the apolipoprotein in the composition on a weight basis.
[0621] 341. The composition of any one of embodiments 313 to 339, wherein lipoprotein complexes that (a) have Stokes radii of greater than 2 nm or 3.4 nm and/or (b) are discoidal and/or (c) have an apolipoprotein:amphipathic molecule molar ratio of 1:8 or greater, if present, represent no more than 5% of the apolipoprotein in the composition on a weight basis.
[0622] 342. The composition of any one of embodiments 313 to 339, wherein lipoprotein complexes that (a) have Stokes radii of greater than 2 nm or 3.4 nm and/or (b) are discoidal and/or (c) have an apolipoprotein:amphipathic molecule molar ratio of 1:8 or greater, if present, represent no more than 2% of the apolipoprotein in the composition on a weight basis.
[0623] 343. The composition of any one of embodiments 313 to 342, which is free of detectable lipoprotein complexes that (a) have Stokes radii of greater than 3.4 nm and/or (b) are discoidal and/or (c) have an apolipoprotein:amphipathic molecule molar ratio of 1:8 or greater.
[0624] 344. The composition of any one of embodiments 313 to 343, which lacks lipoprotein complexes having a Stokes radius of greater than 3.25 nm.
[0625] 345. A method for treating subject, comprising administering to a subject in need thereof a therapeutically effective amount of the Cargomer of any one of embodiments 246 to 279, which is optionally in the form of a pharmaceutical composition comprising one or more pharmaceutically acceptable carriers, diluents, and/or excipients.
[0626] 346. The method of embodiment 345, which further comprises administering to the subject a therapeutically effective amount of a second Cargomer of any one of embodiments 246 to 279, which is optionally in the form of a pharmaceutical composition comprising one or more pharmaceutically acceptable carriers, diluents, and/or excipients.
[0627] 347. The method of embodiment 345, which further comprises administering to the subject a therapeutically effective amount of a second Cargomer of any one of embodiments 280 to 286, which is optionally in the form of a vaccine composition comprising one or more pharmaceutically acceptable carriers, diluents, and/or excipients
[0628] 348. The method of embodiment 346 or 347, wherein the Cargomers carry different cargo moieties.
[0629] 349. The method of any one of embodiments 346 to 348, wherein the Cargomers are administered sequentially.
[0630] 350. The method of any one of embodiments 346 to 348, wherein the Cargomers are administered simultaneously.
[0631] 351. The method of embodiment 350, wherein the Cargomers are formulated into a single pharmaceutical composition.
[0632] 352. The method of any one of embodiments 345 to 351, wherein the pharmaceutical composition has the characteristics of a composition according to any one of embodiments 320 to 344.
[0633] 353. The method of any one of embodiments 345 to 352, wherein the administration is: [0634] (a) subcutaneous, intradermal, intravenous, or intraperitoneal injection; [0635] (b) via inhalation, optionally intranasal or intrapulmonary inhalation; [0636] (c) via implantation, optionally via a suppository; or [0637] (d) ocular or intraocular, optionally via eye drops.
[0638] 354. A method for diagnosing a subject, comprising administering to a subject in need thereof an effective amount of the Cargomer of any one of embodiments 289 to 312, which is optionally in the form of a diagnostic composition comprising one or more carriers, diluents, and/or excipients suitable for diagnostic use.
[0639] 355. The method of embodiment 354, wherein the diagnostic composition has the characteristics of a composition according to any one of embodiments 320 to 344.
[0640] 356. The method of embodiment 354 or embodiment 355, wherein the administration is via: [0641] (a) subcutaneous, intradermal, intravenous, or intraperitoneal injection; [0642] (b) via inhalation, optionally intranasal or intrapulmonary inhalation; [0643] (c) via implantation, optionally via a suppository; or [0644] (d) ocular or intraocular, optionally via eye drops.
[0645] 357. A method for immunizing subject, comprising administering to a subject in need thereof an effective amount of the Cargomer of any one of embodiments 280 to 288, which is optionally in the form of a vaccine composition comprising one or more pharmaceutically acceptable carriers, diluents, excipients, and/or adjuvants.
[0646] 358. The method of embodiment 357, which further comprises administering to the subject an effective amount of a second Cargomer of any one of embodiments 280 to 288, which is optionally in the form of a vaccine composition comprising one or more pharmaceutically acceptable carriers, diluents, excipients, and/or adjuvants.
[0647] 359. The method of embodiment 358, wherein the Cargomers carry different cargo moieties.
[0648] 360. The method of embodiment 358 or embodiment 359, wherein the Cargomers are administered sequentially.
[0649] 361. The method of embodiment 358 or embodiment 359, wherein the Cargomers are administered simultaneously.
[0650] 362. The method of embodiment 361, wherein the Cargomers are formulated into a single vaccine composition.
[0651] 363. The method of embodiment any one of embodiments 357 to 362, wherein the pharmaceutical composition has the characteristics of a composition according to any one of embodiments 320 to 344.
[0652] 364. The method of any one of embodiments 357 to 363, wherein the administration is: [0653] (a) subcutaneous, intradermal, intravenous, or intraperitoneal injection; [0654] (b) via inhalation, optionally intranasal or intrapulmonary inhalation; [0655] (c) via implantation, optionally via a suppository; or [0656] (d) ocular or intraocular, optionally via eye drops.
[0657] 365. The method of embodiment 353, 356 or 364, wherein the composition is a solution.
[0658] 366. The method of embodiment 353, 356 or 364, wherein the composition is a depot.
[0659] 367. The method of any one of embodiments 345 to 366, wherein the subject is a mammal.
[0660] 368. The method of embodiment 367, wherein the mammal is human.
[0661] 369. The method of any one of embodiments 345 to 368, wherein the subject has been diagnosed with cancer or is at risk of developing cancer, and wherein the method further comprises administering a chemotherapeutic or biotherapeutic agent, radiation, an immunotherapy agent, or an anti-immunosuppressive or immunostimulatory agent to the subject.
[0662] 370. The method of embodiment 369, which comprises administering an immunotherapy agent, which is optionally alemtuzumab, atezolizumab, ipilimumab, ofatumumab, nivolumab, pembrolizumab, rituximab, or rurvalumab.
[0663] 371. The method of embodiment 369, which comprises administering an immunotherapy agent which is a checkpoint inhibitor, wherein the checkpoint inhibitor is optionally atezolizumab, ipilimumab, pembrolizumab, or nivolumab.
[0664] 372. The method of any one of embodiments 345 to 368, wherein the subject has been diagnosed with melanoma and wherein at least one Cargomer administered to the subject comprises an anti-melanoma agent, optionally wherein the method further comprises administering a chemotherapeutic agent or interferon-based therapy (e.g., recombinant interferon alfa-2b, peginterferon alfa-2a, or peginterferon alfa-2b) to the subject.
[0665] 373. The method of any one of embodiments 345 to 368, wherein the subject has been diagnosed with melanoma, and the method further comprises administering aldesleukin, cobimetinib, dabrafenib, dacarbazine, talimogene laherparepvec, recombinant interferon alfa-2b, ipilimumab, pembrolizumab, trametinib, nivolumab, peginterferon alfa-2a, peginterferon alfa-2b, or orvemurafenib to the subject.
[0666] 374. The method of any one of embodiments 345 to 368, wherein the subject has been diagnosed with pancreatic cancer, and the method further comprises administering gemcitabine, 5-fluorouracil (5-FU), irinotecan, oxaliplatin, albumin-bound paclitaxel, capecitabine, cisplatin, paclitaxel, docetaxel, or irinotecan liposome to the subject.
[0667] 375. The method of any one of embodiments 345 to 368, wherein the subject has been diagnosed with esophageal cancer, and the method further comprises administering carboplatin and paclitaxel, cisplatin and 5-fluorouracil, epirubicin, cisplatin, and 5-FU, docetaxel, cisplatin, and 5-FU, cisplatin and capecitabine, oxaliplatin and either 5-FU or capecitabine, irinotecan, trastuzumab, ramucirumab, pembrolizumab, or any one of the foregoing agents to the subject.
[0668] 376. A method of imaging a tumor in a subject afflicted with a cancer, comprising: [0669] (a) administering a Cargomer of any one of embodiments 290 to 312 or a diagnostic composition of embodiment 315 to the subject, optionally wherein the diagnositic composition has the characteristics of a composition according to any one of embodiments 320 to 344; and [0670] (b) imaging the subject to detect delivery of the imaging agent to the tumor, thereby imaging the tumor.
[0671] 377. A method of monitoring tumor progression, regression, or recurrence in a subject afflicted with a cancer, comprising: [0672] (a) administering a Cargomer of any one of embodiments 290 to 312 or a diagnostic composition of embodiment 315 which comprises an imaging agent to the subject in a first administration and imaging the subject to detect delivery of the imaging agent to the tumor, optionally wherein the diagnositic composition has the characteristics of a composition according to any one of embodiments 320 to 344; and [0673] (b) administering the Cargomer or diagnostic composition to the subject in a second administration and imaging the subject to detect delivery of the imaging agent to the tumor,
[0674] thereby monitoring tumor progression, regression, or recurrence.
[0675] 378. A method for selecting a subject afflicted with a cancer for treatment with a Cargomer comprising an anti-cancer agent, comprising: [0676] (a) administering a Cargomer of any one of embodiments 290 to 312 or a diagnostic composition of embodiment 315 which comprises an imaging agent to the subject, optionally wherein the diagnositic composition has the characteristics of a composition according to any one of embodiments 320 to 344; [0677] (b) imaging the subject to detect delivery of the imaging agent to the tumor; and [0678] (c) selecting the subject for treatment with a Cargomer comprising an anti-cancer agent if the imaging shows delivery of the imaging agent to the tumor.
[0679] 379. A method of treating a subject afflicted with a cancer, comprising: [0680] (a) administering a Cargomer of any one of embodiments 290 to 312 or a diagnostic composition of embodiment 315 which comprises an imaging agent to the subject, optionally wherein the diagnositic composition has the characteristics of a composition according to any one of embodiments 320 to 344; [0681] (b) imaging the subject to detect delivery of the imaging agent to the tumor; and [0682] (c) administering a Cargomer comprising an anti-cancer agent to the subject if the imaging shows delivery of the imaging agent to the tumor.
[0683] 380. The method of embodiment 378 or embodiment 379, wherein the Cargomer comprising an anti-cancer agent is a Cargomer according to embodiment 261 or embodiment 262.
[0684] 381. A Cargomer comprising: [0685] (a) 1-8 apolipoprotein molecules; [0686] (b) one or more cargo moieties; [0687] (c) an amount of amphipathic molecules sufficient to solubilize the apolipoprotein molecules, wherein one or more of the cargo moieties of (b) and one or more of the amphipathic molecules of (c) can be the same molecule(s) in the Cargomer; [0688] (d) optionally, one or more anchors non-covalently coupling one or more cargo moieties to the apolipoprotein molecules; and [0689] (e) optionally, one or more linkers covalently coupling one or more cargo moieties to one or more apolipoprotein molecules, one or more amphipathic molecules or one or more anchors,
[0690] wherein the amphipathic molecules, the cargo moieties and, if present, the anchors and/or linkers together contribute a net charge of at least +1 or ?1 per apolipoprotein molecule in the Cargomer.
[0691] 382. The Cargomer of embodiment 381, wherein the apolipoprotein to amphipathic molecule molar ratio ranges from 8:1 to 1:15.
[0692] 383. The Cargomer of embodiment 381 or embodiment 382, which is not a discoidal particle.
[0693] 384. The Cargomer of any one embodiments 381 to 383, which comprises 1 to 25 cargo moieties.
[0694] 385. The Cargomer of any one of embodiments 381 to 384, wherein at least one amphipathic molecule is also a cargo moiety.
[0695] 386. The Cargomer of any one of embodiments 381 to 385, wherein at least one cargo moiety is coupled to an anchor.
[0696] 387. The Cargomer of embodiment 386, wherein the anchor is an amphipathic molecule.
[0697] 388. The Cargomer of embodiment 387, wherein the anchor comprises a phospholipid, which is optionally a negatively charged phospholipid.
[0698] 389. The Cargomer of embodiment 387, wherein the anchor comprises cholesterol.
[0699] 390. The Cargomer of any one of embodiments 386 to 389, wherein the cargo moiety is coupled to the anchor by a direct bond.
[0700] 391. The Cargomer of any one of embodiments 386 to 389, wherein the cargo moiety is coupled to the anchor by a linker.
[0701] 392. The Cargomer of any one of embodiments 381 to 391, wherein at least one cargo moiety is coupled to an apolipoprotein molecule.
[0702] 393. The Cargomer of any one of embodiments 381 to 392, wherein the amphipathic molecules comprise a phospholipid, a detergent, a fatty acid, an apolar moiety or sterol covalently attached to a sugar, or a combination thereof.
[0703] 394. The Cargomer of embodiment 393, wherein the amphipathic molecules comprise or consist of phospholipid molecules, which are optionally negatively charged phospholipids, neutral phospholipids or a combination thereof.
[0704] 395. The Cargomer of any one of embodiments 381 to 394 which comprises 1 apolipoprotein molecule.
[0705] 396. The Cargomer of any one of embodiments 381 to 394 which comprises 2 apolipoprotein molecules.
[0706] 397. The Cargomer of any one of embodiments 381 to 394 which comprises 4 apolipoprotein molecules.
[0707] 398. The Cargomer of any one of embodiments 381 to 394, which comprises 8 apolipoprotein molecules.
[0708] 399. The Cargomer of any one of embodiments 381 to 398, wherein the apolipoprotein molecules comprise or consist of apolipoprotein A-I (ApoA-I) molecules.
[0709] 400. The Cargomer of any one of embodiments 381 to 399, wherein one or more cargo moieties comprise a therapeutic agent, a diagnostic agent or an immunogen.
[0710] 401. The Cargomer of embodiment 400, wherein the one or more cargo moieties comprise a therapeutic agent, which is optionally an immunoinhibitory agent, an immunostimulatory agent, an anti-cancer agent, an anti-infective agent, a nucleic acid drug, an anti-inflammatory agent, an agent for treating cardiovascular disorders, a caspase inhibitor, or a bioactive agent.
[0711] 402. The Cargomer of embodiment 400, wherein the one or more cargo moieties comprise an immunogen, which is optionally an antigen or an antigen-encoding nucleic acid.
[0712] 403. The Cargomer of embodiment 402, which comprises an antigen, optionally which is an allergic antigen, an autoantigen, or a tumor antigen.
[0713] 404. The Cargomer of embodiment 403, which comprises a tumor antigen, optionally wherein the tumor antigen is a neoantigen or a shared antigen.
[0714] 405. The Cargomer of embodiment 400, wherein the one or more cargo moieties comprises a diagnostic agent, which is optionally an imaging agent.
[0715] 406. A pharmaceutical composition comprising an effective amount of the Cargomers of embodiment 400 or embodiment to 401 and one or more pharmaceutically acceptable carriers, diluents, and/or excipients.
[0716] 407. A vaccine composition comprising an effective amount of the Cargomers of any one of embodiments 402 to 404 and one or more pharmaceutically acceptable carriers, diluents, excipients, and/or adjuvants.
[0717] 408. A diagnostic composition comprising an effective amount of the Cargomers of embodiment 405 and one or more carriers, diluents, and/or excipients suitable for diagnostic use.
[0718] 409. The composition of any one of embodiments 406 to 408, in which no more than 20%, no more than 10%, no more than 5%, or no more than 2% of the amphipathic molecules are in uncomplexed form.
[0719] 410. The composition of any one of embodiments 406 to 409, wherein the Cargomers in the composition are at least 75%, at least 85%, at least 90%, at least 95%, or at least 98% homogeneous.
[0720] 411. A method for treating subject, comprising administering to a subject in need thereof a therapeutically effective amount of the Cargomer of any one of embodiments 400 to 404, which is optionally in the form of a pharmaceutical composition comprising one or more pharmaceutically acceptable carriers, diluents, and/or excipients.
[0721] 412. A method for diagnosing a subject, comprising administering to a subject in need thereof an effective amount of the Cargomer of embodiment 405, which is optionally in the form of a diagnostic composition comprising one or more carriers, diluents, and/or excipients suitable for diagnostic use.
[0722] 413. A method for immunizing subject, comprising administering to a subject in need thereof an effective amount of the Cargomer of any one of embodiments 402 to 404, which is optionally in the form of a vaccine composition comprising one or more pharmaceutically acceptable carriers, diluents, excipients, and/or adjuvants.
[0723] 414. The method of embodiment 411 or embodiment 413, which further comprises administering to the subject a therapeutically effective amount of a second Cargomer, which is optionally in the form of a pharmaceutical composition comprising one or more pharmaceutically acceptable carriers, diluents, and/or excipients.
[0724] 415. The method of embodiment 414, wherein the Cargomers carry different cargo moieties and are optionally formulated into a single pharmaceutical composition.
[0725] 416. The method of any one of embodiments 411 to 415, wherein the subject has been diagnosed with cancer or is at risk of developing cancer, and wherein the method further comprises administering a chemotherapeutic or biotherapeutic agent, radiation, an immunotherapy agent, or an anti-immunosuppressive or immunostimulatory agent to the subject.
[0726] 417. A method of imaging a tumor in a subject afflicted with a cancer, comprising: [0727] (a) administering a Cargomer according to embodiment 405 which comprises an imaging agent to the subject; and [0728] (b) imaging the subject to detect delivery of the imaging agent to the tumor, thereby imaging the tumor.
[0729] 418. A method of monitoring tumor progression, regression, or recurrence in a subject afflicted with a cancer, comprising: [0730] (a) administering a Cargomer according to embodiment 405 which comprises imaging agent to the subject in a first administration and imaging the subject to detect delivery of the imaging agent to the tumor; and [0731] (b) administering the Cargomer in a second administration and imaging the subject to detect delivery of the imaging agent to the tumor,
[0732] thereby monitoring tumor progression, regression, or recurrence.
[0733] 419. A method for selecting a subject afflicted with a cancer for treatment with a Cargomer comprising an anti-cancer agent, comprising: [0734] (a) administering a Cargomer according to embodiment 405 which comprises imaging agent to the subject; [0735] (b) imaging the subject to detect delivery of the imaging agent to the tumor; and [0736] (c) selecting the subject for treatment with a Cargomer comprising an anti-cancer agent if the imaging shows delivery of the imaging agent to the tumor.
[0737] 420. A method of treating a subject afflicted with a cancer, comprising: [0738] (a) administering a Cargomer according to embodiment 405 which comprises imaging agent to the subject; [0739] (b) imaging the subject to detect delivery of the imaging agent to the tumor; and [0740] (c) administering a Cargomer comprising an anti-cancer agent to the subject if the imaging shows delivery of the imaging agent to the tumor.
[0741] While various specific embodiments have been illustrated and described, it will be appreciated that various changes can be made without departing from the spirit and scope of the disclosure(s).
11. CITATION OF REFERENCES
[0742] All publications, patents, patent applications and other documents cited in this application are hereby incorporated by reference in their entireties for all purposes to the same extent as if each individual publication, patent, patent application or other document were individually indicated to be incorporated by reference for all purposes. In the event that there is an inconsistency between the teachings of one or more of the references incorporated herein and the present disclosure, the teachings of the present specification are intended.
12. TRADEMARKS
[0743] Cerenis Therapeutics Holding SA has applied for a trademark for CARGOMER in the United States (U.S. serial no. 87/564,075) and other jurisdictions, and retains all rights to use the term CARGOMER and derivatives thereof (e.g., the plural CARGOMERS) as trademarks in any and all jurisdictions worldwide. The description(s) submitted in any of such trademark applications shall not limit the terms Cargomer and Cargomers as used herein.