LYOPHILIZED FORMULATIONS FOR FACTOR XA ANTIDOTE
20190046450 ยท 2019-02-14
Inventors
Cpc classification
A61K9/0019
HUMAN NECESSITIES
A61K9/19
HUMAN NECESSITIES
A61P7/00
HUMAN NECESSITIES
C07K14/00
CHEMISTRY; METALLURGY
A61K47/26
HUMAN NECESSITIES
International classification
A61K9/19
HUMAN NECESSITIES
A61K47/18
HUMAN NECESSITIES
A61K47/26
HUMAN NECESSITIES
Abstract
The present disclosure relates to solutions and methods of preparing lyophilized formulations of factor Xa (fXa) antidotes. A suitable aqueous formulation suitable for lyophilization can include a fXa antidote, a solubilizing agent, and a stabilizer, wherein the formulation does not collapse during lyophilization.
Claims
1. A lyophilized composition obtainable by lyophilizing an aqueous formulation, wherein: the aqueous formulation comprises a stabilizer, from 25 mM to 110 mM arginine, and at least 15 mg/mL of a two-chain polypeptide comprising a first chain comprising the amino acid sequence of SEQ ID NO. 4, and a second chain comprising the amino acid sequence of SEQ ID NO. 5, wherein the polypeptide cannot assemble into a prothrombinase complex; the aqueous formulation has a pH from 7.5 to 8; the stabilizer comprises from 2% to 7% sucrose (w/v) and from 0% to 5% mannitol (w/v); and the molar ratio of the stabilizer to the polypeptide is at least 100.
2. The composition of claim 1, wherein the aqueous formulation comprises from 40 mM to 50 mM arginine, from 5.5% to 7.5% sucrose (w/v), and 20 mg/mL of the polypeptide.
3. The composition of claim 1, wherein the aqueous formulation comprises from 90 mM to 110 mM arginine, from 5.5% to 7.5% sucrose (w/v), and at least 30 mg/mL of the polypeptide.
4. The composition of claim 3, wherein the aqueous formulation comprises 45 mg/mL of the polypeptide.
5. The composition of any of the above claims, wherein the aqueous formulation comprises no mannitol.
6. The composition of claim 1, wherein the aqueous formulation comprises no mannitol and 40 mg/mL of the polypeptide.
7. The composition of any of the above claims, wherein the polypeptide comprises an amino acid residue that is modified to be different from natural amino acids.
8. The composition of claim 6, wherein residue Asp29 of the first chain is modified to (3R)-3-hydroxyAsp at Asp29.
9. The composition of any of claims 1-6, wherein the polypeptide comprises at least an intra-chain disulfide bond for each of the first and second chains.
10. A lyophilized composition obtainable by lyophilizing an aqueous formulation, wherein: the aqueous formulation comprises about 45 mM arginine, about 6% sucrose (w/v), 0% mannitol, and about 20 mg/mL of a two-chain polypeptide comprising a first chain comprising the amino acid sequence of SEQ ID NO. 4, and a second chain comprising the amino acid sequence of SEQ ID NO. 5, wherein the polypeptide cannot assemble into a prothrombinase complex, and the aqueous formulation has a pH of about 7.8.
11. A lyophilized composition obtainable by lyophilizing an aqueous formulation, wherein: the aqueous formulation comprises about 100 mM arginine, about 6% sucrose (w/v), 0% mannitol, and about 40 mg/mL of a two-chain polypeptide comprising a first chain comprising the amino acid sequence of SEQ ID NO. 4, and a second chain comprising the amino acid sequence of SEQ ID NO. 5, wherein the polypeptide cannot assemble into a prothrombinase complex; and the aqueous formulation has a pH of about 7.8.
12. The composition of claim 11, wherein the two-chain polypeptide has modifications to the Gla domain and the active site as compared to the wild-type fXa protein, is able to bind to a fXa inhibitor but does not assemble into a prothrombinase complex.
13. The composition of claim 1, wherein the glass transition temperature is from about ?27? C. to about ?37? C.
14. The composition of any of the above claims, wherein the aqueous formulation further comprises a surfactant and a buffer.
15. A method of preparing the lyophilized, amorphous composition of any one of claims 1-14.
16. A method of reducing bleeding in a subject undergoing anticoagulant therapy with a factor Xa inhibitor comprising administering to the subject a solution prepared by dissolving the composition of any one of claims 1-14 in an aqueous solvent.
17. The method of claim 16, wherein the factor Xa inhibitor is apixaban, rivaroxaban or betrixaban.
Description
DETAILED DESCRIPTION
I. Definitions
[0013] All numerical designations, e.g., pH, temperature, time, concentration, and molecular weight, including ranges, are approximations which are varied (+) or (?) by increments of 0.1 or 10%. It is to be understood, although not always explicitly stated that all numerical designations are preceded by the term about. It also is to be understood, although not always explicitly stated, that the reagents described herein are merely exemplary and that equivalents of such are known in the art.
[0014] As used in the specification and claims, the singular form a, an and the include plural references unless the context clearly dictates otherwise. For example, the term a pharmaceutically acceptable carrier includes a plurality of pharmaceutically acceptable carriers, including mixtures thereof.
[0015] As used herein, the term comprising is intended to mean that the compositions and methods include the recited elements, but do not exclude others. Consisting essentially of when used to define compositions and methods, shall mean excluding other elements of any essential significance to the combination for the intended use. Thus, a composition consisting essentially of the elements as defined herein would not exclude trace contaminants from the isolation and purification method and pharmaceutically acceptable carriers, such as phosphate buffered saline, preservatives, and the like. Consisting of shall mean excluding more than trace elements of other ingredients and substantial method steps for administering the compositions of this disclosure. Embodiments defined by each of these transition terms are within the scope of this disclosure.
[0016] The term protein and polypeptide are used interchangeably and in their broadest sense to refer to a compound of two or more subunit amino acids, amino acid analogs or peptidomimetics. The subunits may be linked by peptide bonds. In another embodiment, the subunit may be linked by other bonds, e.g., ester, ether, etc. A protein or peptide must contain at least two amino acids and no limitation is placed on the maximum number of amino acids which may comprise a protein's or peptide's sequence. As used herein the term amino acid refers to either natural and/or unnatural or synthetic amino acids, including glycine and both the D and L optical isomers, amino acid analogs and peptidomimetics. Single letter and three letter abbreviations of the naturally occurring amino acids are listed below.
[0017] Factor Xa or fXa or fXa protein is a serine protease in the blood coagulation pathway, which is produced from the inactive factor X (fX, SEQ ID NO. 1, Table 1). The nucleotide sequence coding human factor X (fX) can be found in GenBank with accession number NM_000504. Upon catalytic cleavage of the first 52 residues of the heavy chain, fX is activated to fXa. FXa contains a light chain and a heavy chain. The first 45 amino acid residues (residues 1-45 of SEQ ID NO. 1) of the light chain is called the Gla domain because it contains 11 post-translationally modified ?-carboxyglutamic acid residues (Gla). It also contains a short (6 amino acid residues) aromatic stack sequence (residues 40-45 of SEQ ID NO. 1). Chymotrypsin digestion selectively removes the 1-44 residues resulting in Gla-domainless fXa. The serine protease catalytic domain of fXa locates at the C-terminal heavy chain. The heavy chain of fXa is highly homologous to other serine proteases such as thrombin, trypsin, and activated protein C.
[0018] Native fXa or wild-type fXa refers to the fXa naturally present in plasma or being isolated in its original, unmodified form, which processes the biological activity of activating prothrombin therefore promoting formation of blood clot. The term includes naturally occurring polypeptides isolated from tissue samples as well as recombinantly produced fXa. Active fXa refers to fXa having the procoagulant activity of activating prothrombin. Active fXa may be a native fXa or modified fXa that retains procoagulant activity.
[0019] As used herein, fXa derivatives refer to modified fXa proteins that do not compete with fXa in assembling into the prothrombinase complex and have reduced or no procoagulant or catalytic activities, and yet bind and/or substantially neutralize the anticoagulants, such as fXa inhibitors. Procoagulant activity of an fXa protein or fXa derivative, in some aspects, refers to the enzymatic activity that the wild-type active fXa polypeptide carries. Examples of fXa derivatives and methods of making these derivatives are provided in U.S. Pat. Nos. 8,153,590, 8,455,441, 9,062,298, 8,268,783, and 9,109,046, U.S. Patent Publication No. 2015/0376592, and PCT publications WO2009/042962 and WO2010/056765, and further provided herein, such as SEQ ID NO: 7-9 and biological equivalents thereof.
[0020] The enzymatic activity of an fXa polypeptide or derivatives thereof refers to the polypeptide's ability to catalyze a biochemical reaction with a substrate through direct interaction with the substrate.
[0021] SEQ ID NO: 7 contains 3 mutations relative to the wild type fXa. The first mutation is the deletion of 6-39 aa in the Gla-domain of fX. The second mutation is replacing the activation peptide sequence 143-194 aa with -RKR-. This produces a -RKRRKR- (SEQ ID NO: 6) linker connecting the light chain (SEQ ID NO: 2) and the heavy chain (SEQ ID NO: 3). Upon secretion, this linker is cleaved resulting in a two-chain polypeptide, SEQ ID NO: 8 (r-Antidote). The third mutation is mutation of active site residue S379 to an Ala residue. This amino acid substitution is bolded in SEQ ID NO: 7-9 in Tables 2-4.
[0022] The term r-Antidote refers to a processed two-chain polypeptide processing product of SEQ ID NO: 7, after cleavage of the linker. This is represented by SEQ ID NO: 8. The r-antidote is disclosed in, e.g., U.S. Pat. No. 8,153,590, the content of which is incorporated to the present disclosure by reference. The r-Antidote includes a light chain (SEQ ID NO. 2) and a heavy chain (SEQ ID NO. 3) connected with a single disulfide bond between Cysteine 98 (Cys98) of the light chain and Cysteine 108 (Cys108) of the heavy chain. Like the wild-type fXa, in certain production batches, the r-Antidote undergoes post-translational modifications resulting in glycosylation at certain amino acid residues, e.g., Ser56, Ser72, Ser76 and Thr82 of the light chain and Thr249 of the heavy chain, and a modified residue, (3R)-3-hydroxyAsp at Asp29 of the light chain. Further, in addition to the inter-chain disulfide bond, there can be intra-chain disulfide bonds formed between Cysteines 16 and 27, 21 and 36, 38 and 47, 55 and 66, 62 and 75, and 77 and 90 of the light chain, and between Cysteines 7 and 12, 27 and 43, 156 and 170, and 181 and 209 of the heavy chain.
[0023] Certain variants of the r-Antidote, such as those disclosed in U.S. Pat. Nos. 8,153,590, 8,455,441, 9,062,298, 8,268,783, and 9,109,046, have similar chemical properties and biological activities as the r-Antidote. For instance, SEQ ID NO: 9 (Table 4) shows a two-chain variant that includes amino acids 129-139 of SEQ ID NO: 1 (i.e., with deletions of the Gla domain (1-45), the EGF1 domain (46-84), and the EGF2 domain (85-128)) and amino acids 429-448 of SEQ ID NO: 1 (i.e., with deletion of the beta-peptide), which is shorter than the r-Antidote but retains its antidote activities.
TABLE-US-00001 TABLE1 PolypeptideSequenceofInactiveHumanFactorX (SEQIDNO:1) 1 ANSFLEEMKKGHLERECMEETCSYEEAREVFEDSDKTNEF WNKYKDGDQCETSPCQNQGK 61 CKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFC HEEQNSVVCSCARGYTLADN 121 GKACIPTGPYPCGKQTLERRKRSVAQATSSSGEAPDSITW KPYDAADLDPTENPFDLLDF 181 NQTQPERGDNNLTRIVGGQECKDGECPWQALLINEENEGF CGGTILSEFYILTAAHCLYQ 241 AKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYD FDIAVLRLKTPITFRMNVAP 301 ACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKML EVPYVDRNSCKLSSSFIITQ 361 NMFCAGYDTKQEDACQGDSGGPHVTRFKDTYFVTGIVSWG EGCARKGKYGIYTKVTAFLK 421 WIDRSMKTRGLPKAKSHAPEVITSSPLK
TABLE-US-00002 TABLE2 PolypeptideSequenceofther-Antidotepriorto removalofthe-RKRRKR-(SEQIDNO.6)linker(SEQID NO:7) LightChain(SEQIDNO:2) 1 ANSFLF WNKYEDGDQCETSPCQNQGK 61 CKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFC HEEQNSVVCSCARGYTLADN 121 GKACIPTGPYPCGKQTLFR Linker(SEQIDNO:6) RKRRKR HeavyChain(SEQIDNO:3) 181 IVGGQECKDGECPWQALLINEENEGF CGGTILSEFYILTAAECLYQ 241 AKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYD FDIAVLRLKTPITFRMNVAP 301 ACLPERDWAESTIMTQKTGIVSGFGRTHEKGRQSTPIKML EVPYVDRNSCKISSSFIITQ 361 NMFCAGYDTKQEDACQGDAGGPHVTRFKDTYFVTGIVSWG EGCARKGKYGIYTKVTAFLK 421 WIDRSMKTRGLPKAKSHAPEVITSSPLK
TABLE-US-00003 TABLE3 PolypeptideSequenceofaHumanFactorXatriple mutantafterremovalofthe-RKRRKR-(SEQIDNO. 6)linker(SEQIDNO:8) LightChain(SEQIDNO:2) 1 ANSFLF WNKYKDGDQCETSPCQNQGK 61 CKDGLGEYTCTCLEGFEGKNCELFTRKLCSLDNGDCDQFC HEEQNSVVCSCARGYTLADN 121 GKACIPTGPYPCGKQTLER HeavyChain(SEQIDNO:3) 181 IVGGQECKDGECPWQALLINEENEGF CGGTILSEFYILTAAHCLYQ 241 AKREKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYD FDIAVIRLKTPITFRMNVAP 301 ACLPERDWAESTLMTQKTGIVSGFGRTHEKGRQSTRLKML EVPYVDRNSCKLSSSFIITQ 361 NMFCAGYDTKQEDACQGDAGGPHVTRFKDTYFVTGIVSWG EGCARKGKYGIYTKVTAFLK 421 WIDRSMKTRGLPKAKSHAPEVITSSPLK
TABLE-US-00004 TABLE4 ExampleVariantofther-Antidote(SEQIDNO:9) LightChain(SEQIDNO:4) 121 PYPCGKQTLER HeavyChain(SEQIDNO:5) 181 IVGGQECKDGECPWQALLINEENEGF CGGTILSEFYILTAAHCLYQ 241 AKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYD FDIAVLRLKTPITFRMNVAP 301 ACLPERDWAESTIMQKTGIVSGFGRTHEKGRQSTRLKML EVPYVDRNSCKISSSFIITQ 361 NMFCAGYDTKQEDACQGDAGGPHVTRFKDTYFVTGIVSWG EGCARKGKYGIYTKVTAFLK 421 WIDRSMKT
[0024] The present disclosure also provides a variety of biological equivalents of r-Antidote (or their precursors, represented by SEQ ID NO: 7), or alternatively polypeptides having certain sequence identity to SEQ ID NO: 8 or 9. In one aspect, such biological equivalents retain the structural characteristics of SEQ ID NO: 8 or 9, that is, a modified active site and a deleted or modified Gla domain, optionally with deletion or modification of the EGF1 and/or EGF2 domains. In another aspect, such biological equivalents retain the functional features of SEQ ID NO: 8 or 9, that is, not competing with fXa in assembling into the prothrombinase complex and having reduced or no procoagulant (e.g., enzymatic or catalytic) activities.
[0025] The term active site refers to the part of an enzyme or antibody where a chemical reaction occurs. A modified active site is an active site that has been modified structurally to provide the active site with increased or decreased chemical reactivity or specificity. Examples of active sites include, but are not limited to, the catalytic domain of human factor X comprising the 235-488 amino acid residues, and the catalytic domain of human factor Xa comprising the 195-448 amino acid residues. Examples of modified active site include, but are not limited to, the catalytic domain of human factor Xa comprising 195-448 amino acid residues in SEQ ID NO: 1 with at least one amino acid substitution at position Arg306, Glu310, Arg347, Lys351, Lys414, or Arg424.
[0026] A composition is intended to mean a combination of active agent and another compound or composition, inert (for example, a detectable agent or label) or active, such as an adjuvant.
[0027] A pharmaceutical composition is intended to include the combination of an active agent with a carrier, inert or active, making the composition suitable for diagnostic or therapeutic use in vitro, in vivo or ex vivo.
[0028] The term lyophilized formulation refers to a pharmaceutical formulation or composition comprising a polypeptide of interest that is freeze-dried.
[0029] The term substantially amorphous material embraces material which has no more than about 10% crystallinity; and amorphous material embraces material which has no more than about 2% crystallinity.
[0030] As used herein, the term bulking agent refers to an ingredient that provides bulk to the lyophilized formulation. Examples of bulking agents include, without limitation, mannitol, trehalose, lactose, sucrose, polyvinyl pyrrolidone, sucrose, glucose, glycine, cyclodextrins, dextran, solid PEGs and derivatives and mixtures thereof. In one embodiment, a formulation of the present disclosure optionally includes a bulking agent.
[0031] As used herein, the term lyophilization or freeze drying refers to a process in which water is removed from a product after it is frozen and placed under a vacuum, allowing the ice to change directly from solid to vapor without passing through a liquid phase. The process consists of three separate, unique, and interdependent processes; freezing, primary drying (sublimation), and secondary drying (desorption). Methods for lyophilizing polypeptides used in this disclosure are described herein and well known in the art.
[0032] The term stabilizer denotes a pharmaceutical acceptable excipient, which protects the active ingredient (e.g., the fXa derivative polypeptides) and/or the formulation from chemical and/or physical degradation during manufacturing, storage and application. The stabilizer may be a cryoprotectant or lyoprotectant. Examples of stabilizers may be include sucrose, arginine, citrate, mannitol, trehalose, glycine, sodium chloride, dextran and glucose. In some embodiments, the stabilizer is amorphous.
[0033] Cryoprotectants are known in the art and include without limitation, e.g., sucrose, trehalose, and glycerol. A cryoprotectant exhibiting low toxicity in biological systems is generally used.
[0034] A lyoprotectant refers to a pharmaceutically acceptable substance that stabilizes a protein during lyophilization (the process of rapid freezing and drying in a high vacuum). Examples of lyoprotectants include, without limitation, sucrose, or trehalose.
[0035] As used herein, the term surfactant refers to a pharmaceutically acceptable organic substance having amphipathic structures; namely, it is composed of groups of opposing solubility tendencies, typically an oil-soluble hydrocarbon chain and a water-soluble ionic group. Surfactants can be classified, depending on the charge of the surface-active moiety, into anionic, cationic, and nonionic surfactants. Surfactants may lower the surface tension (or interfacial tension) between two liquids or between a liquid and a solid. Such surfactants, e.g., minimize aggregation of lyophilized particles during reconstitution of the product. Surfactants are often used as wetting, emulsifying, solubilizing, and dispersing agents for various pharmaceutical compositions and preparations of biological materials. In some embodiments of the pharmaceutical formulations described herein, the amount of surfactant is described as a percentage expressed in weight/volume percent (w/v %). Suitable pharmaceutically acceptable surfactants include but are not limited to the group of fatty acid and alkyl sulfonates, benzethanium chloride (e.g., HY AMINE 1622); polyoxyethylensorbitan fatty acid esters (Tween), polyoxyethylene alkyl ethers (Brij), alkylphenylpolyoxyethylene ethers (Triton-X), polyoxyethylene-polyoxypropylene copolymer (Poloxamer, Pluronic), or sodium dodecyl sulphate (SDS). Polyoxyethylenesorbitan-fatty acid esters include polysorbate 20, (sold under the trademark Tween 20?) and polysorbate 80 (sold under the trademark Tween 80?). Polyethylene-polypropylene copolymers include those sold under the names Pluronic? F68 or Poloxamer 188?. Polyoxyethylene alkyl ethers include those sold under the trademark Brij?. Alkylphenolpolyoxyethylene ethers include those sold under the tradename Triton-X. Natural surfactants may also be used, such as sodium taurocholic acid, l-palmitoyl-2-Sn-glycero-3-phosphocholine, lecithin and other phospholipids. Surfactants may comprise from about 0.001% to about 5% w/v.
[0036] A crystalline component refers to a molecule that forms a crystalline matrix in a formulation that includes a polypeptide, during a freeze drying process. Non-limiting examples of crystalline components include mannitol and glycine.
[0037] The term solubilizing agent refers to salts, ions, carbohydrates, complexation agent, polymers and other compounds which, when present in solution, increases the solubility of another molecule (e.g., an active ingredient) in the solution. Non-limiting examples of solubilizing agents include arginine and citrate. In one aspect, the solubilizing agent is arginine. In one aspect, the solubilizing agent is citrate.
[0038] The term buffer as used herein denotes a pharmaceutically acceptable excipient, which stabilizes the pH of a pharmaceutical preparation. Suitable buffers are well known in the art and can be found in the literature. Pharmaceutically acceptable buffers comprise but are not limited to tris-buffers, arginine-buffers, histidine-buffers, citrate-buffers, succinate-buffers and phosphate-buffers. Independently from the buffer used, the pH can be adjusted with an acid or a base known in the art, e.g., succinic acid, hydrochloric acid, acetic acid, phosphoric acid, sulfuric acid and citric acid, succinate, citrate, tris base, histidine, histidine HCl, sodium hydroxide and potassium hydroxide. Suitable buffers include, without limitation, histidine buffer, 2-morpholinoethanesulfonic acid (MES), cacodylate, phosphate, acetate, succinate, and citrate. The concentration of the buffer can be between about 4 mM and about 60 mM, or alternatively about 4 mM to about 40 mM, or alternatively about 5 mM to about 25 mM.
[0039] An antioxidant refers to a molecule capable of slowing or preventing the oxidation of other molecules. Oxidation is a chemical reaction that transfers electrons from a substance to an oxidizing agent. Oxidation reactions can produce free radicals, which start chain reactions that destabilize the protein therapeutics and ultimately affect the product activity. Antioxidants terminate these chain reactions by removing free radical intermediates, and inhibit other oxidation reactions by being oxidized themselves. As a result, antioxidants are often reducing agents, chelating agent and oxygen scavengers such as citrate, EDTA, DPTA, thiols, ascorbic acid or polyphenols. Non-limiting examples of antioxidants include ascorbic acid (AA, E300), thiosulfate, methionine, tocopherols (E306), propyl gallate (PG, E310), tertiary butylhydroquinone (TBHQ), butylated hydroxyanisole (BHA, E320) and butylated hydroxytoluene (BHT, E321).
[0040] A preservative is a natural or synthetic chemical that is added to products such as foods, pharmaceuticals, paints, biological samples, wood, etc. to prevent decomposition by microbial growth or by undesirable chemical changes. Preservative additives can be used alone or in conjunction with other methods of preservation. Preservatives may be antimicrobial preservatives, which inhibit the growth of bacteria and fungi, or antioxidants such as oxygen absorbers, which inhibit the oxidation of constituents. Common antimicrobial preservatives include, benzalkonium chloride, benzoic acid, cholorohexidine, glycerin, phenol, potassium sorbate, thimerosal, sulfites (sulfur dioxide, sodium bisulfite, potassium hydrogen sulfite, etc.) and disodium EDTA. Other preservatives include those commonly used in patenteral proteins such as benzyl alcohol, phenol, m-cresol, chlorobutanol or methylparaben.
[0041] The term tonicity agent as used herein denotes pharmaceutically acceptable agents used to modulate the tonicity of the formulation. Isotonicity generally relates to the osmotic pressure relative to a solution, usually relative to that of human blood serum. A formulation can be hypotonic, isotonic or hypertonic. In one aspect, the formulation is isotonic. An isotonic formulation is liquid or liquid reconstituted from a solid form, e.g. from a lyophilized form and denotes a solution having the same tonicity as some other solution with which it is compared, such as physiologic salt solution and the blood serum. Suitable isotonicity agents include but are not limited to sodium chloride, potassium chloride, glycerin and any component from the group of amino acids, sugars, as defined herein as well as combinations thereof.
II. Formulations
[0042] As provided, the wild-type fXa is a two-chain polypeptide. So are many forms of fXa antidotes, including the r-Antidote (SEQ ID NO: 8 and 9), which includes a light chain (SEQ ID NO. 2 or 4) and a heavy chain (SEQ ID NO. 3 or 5) connected with a single disulfide bond between Cysteine 98 (Cys98 in SEQ ID NO: 2, or Cys4 in SEQ ID NO: 4): of the light chain and Cysteine 108 (Cys108 in SEQ ID NO: 3 or 5) of the heavy chain. Also like the wild-type fXa, the r-Antidote expressed in cells undergoes post-translational modifications resulting in glycosylation at certain amino acid residues, e.g., Ser56, Ser72, Ser76 and Thr82 of the light chain and Thr249 of the heavy chain, and a modified residue, (3R)-3-hydroxyAsp at Asp29 of the light chain. Further, in addition to the inter-chain disulfide bond, there can be one or more intra-chain disulfide bonds formed between Cysteines 16 and 27, 21 and 36, 38 and 47, 55 and 66, 62 and 75, and 77 and 90 of the light chain, and between Cysteines 7 and 12, 27 and 43, 156 and 170, and 181 and 209 of the heavy chain.
[0043] Given the two-chain structure and various post-translational modifications of the fXa antidotes, development of a stable lyophilized formulation that includes a high concentration of the polypeptide is a great challenge.
[0044] It is desirable to develop a suitable amorphous formulation for high concentrations of the polypeptide. With higher concentrations of polypeptide, higher concentrations of amorphous stabilizer (i.e., cryoprotectants and lyoprotectants) may be needed, while still maintaining an appropriate osmolality for delivery. In mixed systems of amorphous and crystalline components, higher amounts of the amorphous stabilizer (i.e. cryoprotectants and lyoprotectants) can increase the glass transition temperature (Tg) while a crystalline component decreases Tg in formulations comprising high concentrations of a polypeptide. As such, higher concentrations of a stabilizer and lower concentrations of a crystalline component can increase Tg. Formulations with high Tg are desirable as these formulations can be more amenable for lyophilization, if needed.
[0045] Accordingly, it was found that, when mannitol and sucrose are present in formulations of the present disclosure, formulations with a ratio of sucrose to mannitol greater than 1 were amorphous and exhibited a Tg. It was also found that lyophilized, amorphous formulations may be achieved when a crystalline component is not present and an amorphous stabilizer is included in the formulation. It is also contemplated that increasing concentrations of the stabilizer (such as a lyoprotecting agent) can increase the stability of the polypeptide.
[0046] It was also found that increasing concentrations of a polypeptide as described herein can increase the Tg. High concentrations of a polypeptide can be achieved at higher pH or by increasing the addition of a solubilizing agent, such as arginine.
[0047] More specifically, a suitable lyophilized, amorphous formulation can be generated from aqueous formulations as described herein. An exemplary r-Antidote solution includes about 100 mM arginine (90 mM to about 110 mM), about 6% sucrose (4-5%), and 0% mannitol (i.e. does not include mannitol). Another exemplary r-Antidote solution includes about 45 mM arginine (35 mM to about 55 mM), about 6% sucrose (4-5%), and 0% mannitol (i.e. does not include mannitol). Further, these solutions include about 10 mM tris (about 5 mM to about 15 mM), and 0.01%-0.02% (0.001%-0.5%) polysorbate 80 (PS80) along with a desired amount of r-Antidote (e.g., 20 mg/mL, 25 mg/mL, 30 mg/mL, 35 mg/mL, 40 mg/mL, 45 mg/mL, 50 mg/mL, 55 mg/mL, 60 mg/mL, 65 mg/mL, 70 mg/mL, 75 mg/mL, 80 mg/mL, 85 mg/mL, 90 mg/mL, 95 mg/mL, 100 mg/mL, 110 mg/mL, 115 mg/mL, 120 mg/mL, 125 mg/mL, 130 mg/mL, 135 mg/mL, 140 mg/mL, 145 mg/mL, or 150 mg/mL), and has a pH of about 7.8.
[0048] Accordingly, when these solutions are lyophilized, it will form a composition that maintains the stabilizer (such as sucrose) and/or polypeptide in an amorphous form. In some embodiments, formulations described herein exhibit a glass transition temperature from about ?5? C. to about ?50? C., ?10? C. to about ?45? C., ?15? C. to about ?40? C., ?20? C. to about ?30? C., or about ?27? C. to about ?37? C.
[0049] The results observed with the r-Antidote can be readily extrapolated to other fXa antidotes that have similar structures including biological equivalents of r-Antidote (or their precursors, represented by SEQ ID NO: 2). In one aspect, such biological equivalents have at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO: 8 or 9. In one aspect, such biological equivalents include two peptide chains, each having at least 80%, 85%, 90%, or 95% sequence identity to SEQ ID NO: 2 or 4 or SEQ ID NO: 3 or 5, respectively. In one aspect, such biological equivalents retain the structural characteristics of SEQ ID NO: 8, that is, a modified active site and a deleted or modified Gla domain. In another aspect, such biological equivalents retain the functional features of SEQ ID NO: 8, that is, not competing with fXa in assembling into the prothrombinase complex and having reduced or no procoagulant (e.g., enzymatic or catalytic) activities. In one aspect, such biological equivalents retain the structural characteristics of SEQ ID NO: 9, that is, a modified active site and a deleted or modified Gla and either or both EGF1 and EGF2 domains. In another aspect, such biological equivalents retain the functional features of SEQ ID NO: 9, that is, not competing with fXa in assembling into the prothrombinase complex and having reduced or no procoagulant (e.g., enzymatic or catalytic) activities.
[0050] Also, it is contemplated that arginine can be substituted with another solubilizing agent and sucrose can be substituted with another stabilizer (i.e., cryoprotectant or lyoprotectant), adequate examples of each of which are available in the art and are provided in the present disclosure.
A. Polypeptide Solution Suitable for Lyophilization
[0051] In one embodiment, the present disclosure provides an aqueous formulation suitable for lyophilization, which formulation includes a fXa antidote as disclosed here or its biological equivalents, along with a solubilizing agent and a stabilizer (i.e. cryoprotectant or lyoprotectant), wherein the molar ratio of the stabilizer to fXa antidote is about 100 or higher. The aqueous formulation can further include a surfactant and/or a buffer. In some aspects, the presence of each of these agents maintains the fXa antidote in an amorphous form. In some aspects, the presence of each of these agents prevents the fXa antidote from collapsing during lyophilization, for instance, when the freeze-dry temperature is higher than ?30? C., ?25? C., ?20? C., ?15? C., ?10? C., ?5? C., or 0? C.
[0052] One embodiment of the disclosure provides an aqueous formulation which can be used for lyophilization. The aqueous formulation includes a fXa derivative polypeptide, e.g., a polypeptide comprising the amino acid sequence of SEQ ID NO. 8 or 9 or an amino acid sequence having at least 95% sequence identity to SEQ ID NO. 8 or 9. In addition to the polypeptide, the aqueous formulation further includes a solubilizing agent and a stabilizer, wherein the molar ratio of the stabilizer to fXa derivative polypeptide is about 100 or higher.
[0053] In one aspect, the fXa derivative polypeptide has modifications to the Gla domain and the active site as compared to the wild-type fXa protein. In one aspect, the fXa derivative polypeptide retains fXa's ability to bind to a fXa inhibitor but does not assemble into a prothrombinase complex. In one aspect, the fXa derivative polypeptide is a two-chain polypeptide having an amino acid sequence of SEQ ID NO. 8, which includes a light chain (SEQ ID NO. 2) and a heavy chain (SEQ ID NO. 3) connected with a single disulfide bond between Cysteine 98 (Cys98) of the light chain and Cysteine 108 (Cys108) of the heavy chain. In one aspect, the fXa derivative polypeptide is a two-chain polypeptide having an amino acid sequence of SEQ ID NO. 9, which includes a light chain (SEQ ID NO. 4) and a heavy chain (SEQ ID NO. 5) connected with a single disulfide bond between Cysteine 4 (Cys4) of the light chain and Cysteine 108 (Cys108) of the heavy chain. In one aspect, the aqueous formulation includes at least 15 mg/mL of the polypeptide. In one aspect, the aqueous formulation includes at least 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 mg/mL of the polypeptide.
[0054] In some aspects, a solubilizing agent is included in the aqueous formulation. The presence of the solubilizing agent is demonstrated herein to be useful in keeping the fXa polypeptide soluble and stable in the formulation. In some aspects, the concentration of the solubilizing agent (e.g., arginine) is at least 40 mM, or alternatively at least 20 mM, 25 mM, 30 mM, 35 mM, 45 mM, 50 mM, 60 mM, 70 mM, 80 mM, 90 mM, or 100 mM. In some aspects, the concentration of the solubilizing agent (e.g., arginine) is not higher than 150 mM, 145 mM, 140 mM, 135 mM, 130 mM, 125 mM, 120 mM, 115 mM, or 110 mM. In some aspects, the concentration of the solubilizing agent is from about 25 mM to about 110 mM, about 20 mM to about 130 mM, about 30 mM to about 120 mM, or about 40 mM to about 110 mM, or about 40 mM to about 105 mM. In some aspects, the concentration of the solubilizing agent is about 40 mM to about 50 mM or about 45 mM. In some aspects, the concentration of the solubilizing agent is about 90 mM to about 110 mM, or about 95 mM to about 105 mM, or about 100 mM. It is noted that as used herein, the term arginine refers to the amino acid as well as the salts (e.g., arginine HCl) thereof. Arginine has a molecular weight of about 174.2 Dalton and arginine HCl (e.g., L-arginine HCl) has a molecular weight of about 210.7 Dalton.
[0055] In one embodiment, the solubilizing agent is citrate or a salt thereof. The salt of citrate is sodium citrate. In one aspect, the citrate comprises a concentration from about 1.0 mM to about 200.0 mM. In a further aspect, the concentration of the citrate is about 25 mM. In another aspect, the concentration of the citrate is about 50 mM. In further embodiment, the concentration of the citrate is about 5 mM, 10 mM, or 20 mM. In another embodiment, the citrate comprises a concentration from about 0.05 M to about 0.2 M.
[0056] In some aspects, a stabilizer is included in the aqueous formulation. In one aspect, the stabilizer is amorphous mannitol and/or amorphous sucrose. In one aspect, the stabilizer is amorphous sucrose.
[0057] In one aspect, the concentration of the stabilizer in the aqueous formulation (e.g., sucrose) is at least about 1.5% (w/v). In one aspect, the concentration of the stabilizer in the aqueous formulation (e.g., sucrose) is at least about 2.5%, 3%, 3.5%, 4%, 4.5%, 5%, 5.5%, 6%, 6.5%, or about 7?/% (w/v). In one aspect, the concentration of the stabilizer in the aqueous formulation (e.g., sucrose) is not greater than about 10%, 9.5%, 90%, 8.5%, 8%, 7.5%, or 7% (w/v). In one aspect, the concentration of the stabilizer in the aqueous formulation (e.g., sucrose) is from about 2% to about 8%, or from about 2% to about 7%, or from about 2.5% to about 7.5%, or from about 3% to about 7%, or from about 3.5% to about 6.5%, or from about 4% to about 7%, or from about 4% to about 6%, or from about 4.5% to about 5.5%, or from about 3% to about 5%, or from about 3.5% to about 4.5%, or from 5% to 7%, or from about 5.5% to about 7.5%, or from about 5.5% to about 6.5%, or at about 3.5%, 4%, 4.5%, 5%, 5.5%, 6%, 6.5%, or 7% (w/v).
[0058] In one aspect, the concentration of mannitol in the aqueous formulation is from about 0%? to about 5% (w/v), about 0% to about 4%, or about 0% to about 3%. In some embodiments, the concentration of mannitol in the aqueous formulation is at least about 0.001%, about 0.5%, about 1%, about 1.5%, or about 2% (w/v). In one aspect, the concentration of the mannitol in the aqueous formulation is not greater than about 6%, about 5.5%, about 5%, about 4.5%, about 4%, or about 3.5% (w/v). In some embodiments, the aqueous formulation does not include mannitol.
[0059] In one aspect, the molar ratio of the stabilizer to protein in the aqueous formulation is at least about 50, at least about 75, at least about 100, at least about 200, at least about 300, at least about 400, at least about 500, at least about 600, at least about 700, at least about 800, at least about 900, or at least about 1000. In one aspect, the molar ratio of the stabilizer to protein in the aqueous formulation is 10 to about 1000, about 50 to about 900, about 60 to about 800, about 70 to about 700, about 80 to about 800, about 90 to about 700, about 100 to about 600, about 100 to about 500, 100 to about 400, 110 to about 380, about 150 to about 200, about 175 to about 185, about 350 to about 400, or about 355 to about 365. In some aspects, the molar ratio of the stabilizer to protein in the aqueous formulation is at least about 90, 110, 120, 130, 140, or 150.
[0060] In some aspects, the aqueous formulation can further include a surfactant, a buffer, a tonicity agent, a cryoprotectant, a surfactant, a lyoprotectant, a preservative or combinations thereof.
[0061] In some aspects, the aqueous formulation has a pH that is 6 or higher, or 6.5 or higher, or 7 or higher, or 7.5 or higher. In some aspects, the pH is not higher than 9, 8.5, or 8. In some aspects, the pH is between 6 and 9, between 6.5 and 8.5, between 7 and 8.5, between 7.5 and 8.2, between 7.6 and 8.1, between 7.7 and 7.9, or at about 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9 or 8.
[0062] In some embodiments, in addition to the polypeptide, the aqueous formulation further includes a solubilizing agent, crystalline component (such as mannitol), and a stabilizer (such as sucrose), wherein the ratio of the stabilizer to crystalline component is sufficiently high to prevent crystallization. Such formulations also do not collapse during lyophilization under desired conditions and can be lyophilized to obtain lyophilized, amorphous compositions. In one aspect, the desired condition is freeze drying at a temperature that is higher than ?40? C., or alternatively higher than ?30? C., ?25? C., ?20? C., ?15? C., or ?10? C. In another aspect, the desired condition is freeze drying at a temperature that is lower than 5? C., 0? C., ?5? C., or ?10? C.
[0063] In some aspects, the aqueous formulation can include a buffer, wherein the buffer is Tris. In such embodiments, the aqueous formulation can include at least about 1 mM tris, 2 mM tris, 4 mM tris, 6 mM tris, 8 mM tris, 10 mM tris, 12 mM tris, 14 mM tris, 16 mM tris, 18 mM tris, or 20 mM tris. In some aspects, the aqueous formulation can include less than about 35 mM tris, 33 mM tris, 30 mM tris, 28 mM tris, 26 mM tris, or 25 mM tris.
[0064] In some aspects, the aqueous formulation can include a surfactant, such as polysorbate 80. In some aspects, the concentration of the polysorbate 80 is from about 0.0001% to about 1%, 0.001% to about 0.9%, 0.001% to about 0.5%0, about 0.001% to about 0.3%, about 0.005% to about 0.03%, about 0.005% to about 0.02%, or about 0.01% to about 0.02%. In some aspects, the concentration of the polysorbate 80 is at least about 0.0001%, 0.001%, or 0.002%.
[0065] In one aspect, the aqueous formulation includes about 45 mM arginine, about 6% sucrose (w/v), and about 20 mg/mL of a two-chain r-Antidote, wherein the formulation has a pH of about 7.8. In one aspect, the aqueous formulation includes about 100 mM arginine, about 6% sucrose (w/v), and about 40 mg/mL of a two-chain r-Antidote, wherein the formulation has a pH of about 7.8. In one aspect, the aqueous formulation includes about 100 mM arginine, about 6% sucrose (w/v), and about 40 mg/mL of a two-chain r-Antidote, wherein the formulation has a pH of about 7.8. In one aspect, the aqueous formulation further includes 0.005%-0.02% (w/v) Polysorbate 80 and a buffer. In one aspect, the aqueous formulation further includes 0.01?/% (w/v) Polysorbate 80 and a buffer.
B. Lyophilization and Lyophilized Compositions
[0066] Also provided, in some embodiments, are methods of lyophilizing the aqueous formulations of the present disclosure.
[0067] In another aspect, the lyophilization cycle includes the steps as described in Table 9. It is further noted that, once an aqueous solution suitable for lyophilization is identified, the method of lyophilizing the solution can be derived accordingly, with methods known in the art. In one aspect, one, or more or all of the drying steps are carried out at a temperature of ?40? C. or higher. In one aspect, the drying steps are carried out at a temperature of about ?35? C., ?30? C., ?25? C., ?20? C., ?15? C., ?10? C., ?5? C., or 0? C.
[0068] In some aspects, also provided are lyophilized, amorphous compositions prepared by lyophilizing the aqueous formulation of the present disclosure. Based on the concentrations of each agent in the aqueous formulation, the relative content of the agent in the lyophilized composition can readily be determined.
[0069] In one aspect, the lyophilized composition includes at least 5%, or alternatively at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55% or 60% (w/w) of the fXa derivative polypeptide. In some embodiments, the lyophilized composition comprises sucrose in amorphous form.
[0070] Still, in some aspects, provided is a solution prepared by dissolving the lyophilized composition of the present disclosure in a solvent. In some aspects, the solvent is water or saline. In one aspect, the solvent is water. In one aspect, the solution includes at least 20 mg/ml or alternatively at least 40 mg/ml of the target polypeptide.
III. Methods of Using the Formulations
[0071] The present disclosure also relates to therapeutic methods of treating, preventing or reducing bleeding in a subject undergoing anticoagulant therapy with a fXa inhibitor comprising administering to a subject an effective amount of the lyophilized formulation upon being dissolved in a suitable solvent. It is contemplated that the antidotes or derivatives of the present disclosure may be short-duration drugs to be used in elective or emergency situations, which can safely and specifically neutralize a fXa inhibitor's conventional anticoagulant properties without causing deleterious hemodynamic side-effects or exacerbation of the proliferative vascular response to injury.
[0072] As used herein, the terms treating, treatment and the like are used herein to mean obtaining a desired pharmacologic and/or physiologic effect. The effect may be prophylactic in terms of completely or partially preventing a disorder or sign or symptom thereof, and/or may be therapeutic in terms of a partial or complete cure for a disorder and/or adverse effect attributable to the disorder.
[0073] Treating also covers any treatment of a disorder in a mammal, and includes: (a) preventing a disorder from occurring in a subject that may be predisposed to a disorder, but may have not yet been diagnosed as having it, e.g., prevent bleeding in a patient with anticoagulant overdose; (b) inhibiting a disorder, i.e., arresting its development, e.g., inhibiting bleeding; or (c) relieving or ameliorating the disorder, e.g., reducing bleeding.
[0074] As used herein, to treat further includes systemic amelioration of the symptoms associated with the pathology and/or a delay in onset of symptoms. Clinical and sub-clinical evidence of treatment will vary with the pathology, the individual and the treatment.
[0075] Administration can be effected in one dose, continuously or intermittently throughout the course of treatment. Methods of determining the most effective means and dosage of administration are known to those of skill in the art and will vary with the composition used for therapy, the purpose of the therapy, the target cell being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician. Suitable dosage formulations and methods of administering the agents are known in the art. A subject of diagnosis or treatment is a cell or a mammal, including a human. Non-human animals subject to diagnosis or treatment include, for example, murine, such as rats, mice, canine, such as dogs, leporids, such as rabbits, livestock, sport animals, and pets.
[0076] The agents and compositions of the present disclosure can be used in the manufacture of medicaments and for the treatment of humans and other animals by administration in accordance with conventional procedures, such as an active ingredient in pharmaceutical compositions.
[0077] An agent of the present disclosure can be administered for therapy by any suitable route, specifically by parental (including subcutaneous, intramuscular, intravenous and intradermal) administration. It will also be appreciated that the preferred route will vary with the condition and age of the recipient, and the disease being treated.
[0078] The phrase pharmaceutically acceptable polymer refers to the group of compounds which can be conjugated to one or more polypeptides described here. It is contemplated that the conjugation of a polymer to the polypeptide is capable of extending the half-life of the polypeptide in vivo and in vitro. Non-limiting examples include polyethylene glycols, polyvinylpyrrolidones, polyvinylalcohols, cellulose derivatives, polyacrylates, polymethacrylates, sugars, polyols and mixtures thereof.
[0079] Anticoagulant agents or anticoagulants are agents that inhibit blood clot formation. Examples of anticoagulant agents include, but are not limited to, specific inhibitors of thrombin, factor IXa, factor Xa, factor XIa, factor XIIa or factor VIIa, heparin and derivatives, vitamin K antagonists, and anti-tissue factor antibodies. Examples of specific inhibitors of thrombin include hirudin, bivalirudin (Angiomax?), argatroban and lepirudin (Refludan?). Examples of heparin and derivatives include unfractionated heparin (UFH), low molecular weight heparin (LMWH), such as enoxaparin (Lovenox?), dalteparin (Fragmin?), and danaparoid (Orgaran?); and synthetic pentasaccharide, such as fondaparinux (Arixtra?). Examples of vitamin K antagonists include warfarin (Coumadin?), phenocoumarol, acenocoumarol (Sintrom?), clorindione, dicumarol, diphenadione, ethyl biscoumacetate, phenprocoumon, phenindione, and tioclomarol. In one embodiment, the anticoagulant is an inhibitor of factor Xa. In one embodiment, the anticoagulant is betrixaban.
[0080] Anticoagulant therapy refers to a therapeutic regime that is administered to a patient to prevent undesired blood clots or thrombosis. An anticoagulant therapy comprises administering one or a combination of two or more anticoagulant agents or other agents at a dosage and schedule suitable for treating or preventing the undesired blood clots or thrombosis in the patient.
[0081] The term factor Xa inhibitors or inhibitors of factor Xa refer to compounds that can inhibit, either directly or indirectly, the coagulation factor Xa's activity of catalyzing conversion of prothrombin to thrombin in vitro and/or in vivo.
[0082] Direct factor Xa inhibitors bind to the fXa directly and non-limiting examples include NAP-5, rNAPc2, tissue factor pathway inhibitor (TFPI), DX-DX-9065a (as described in, e.g., Herbert, J. M., et al, J Pharmacol Exp Ther. 1996 276(3):1030-8), YM-60828 (as described in, e.g., Taniuchi, Y., et al, Thromb Haemost. 1998 79(3):543-8), YM-150 (as described in, e.g., Eriksson, B. I. et. al, Blood 2005; 106(11), Abstract 1865), apixaban, rivaroxaban, TAK-442, PD-348292 (as described in, e.g., Pipeline Insight: AntithromboticsReaching the Untreated Prophylaxis Market, 2007), otamixaban, edoxaban (as described in, e.g., Hylek E M, Curr Opin Invest Drugs 2007 8(9):778-783), LY517717 (as described in, e.g., Agnelli, G., et al, J. Thromb. Haemost. 2007 5(4):746-53), GSK913893, razaxaban, betrixaban or a pharmaceutically acceptable salt thereof, and combinations thereof. In a particular aspect, the direct factor Xa inhibitor is rivaroxaban. In some aspects, a direct fXa inhibitor is a small molecule chemical compound.
[0083] Indirect factor Xa inhibitors inhibition of the fXa activity is mediated by one or more other factors. Non-limiting examples of indirect factor Xa inhibitors include fondaparinux, idraparinux, biotinylated idraparinux, enoxaparin, fragmin, tinzaparin, low molecular weight heparin (LMWH), and combinations thereof. In a particular aspect, the indirect factor Xa inhibitor is enoxaparin.
[0084] In one embodiment, the factor Xa inhibitor is selected edoxaban, fondaparinux, idraparinux, biotinylated idraparinux, enoxaparin, fragmin, NAP-5, rNAPc2, tissue factor pathway inhibitor, DX-9065a, YM-60828, YM-150, apixaban, rivaroxaban, PD-348292, otamixaban, DU-176b, LY517717, GSK913893, razaxaban, low molecular weight heparin, betrixaban or a pharmaceutically acceptable salt thereof, and combinations thereof.
[0085] The term betrixaban refers to the compound [2-({4-[(dimethylamino)iminomethyl]phenyl)}carbonylamino)-5-methoxyphenyl]-N-(5-chloro(2-pyridyl))carboxamide or pharmaceutically acceptable salts thereof. [2-({4-[(dimethylamino)iminomethyl]phenyl}carbonylamino)-5-methoxyphenyl]-N-(5-chloro(2-pyridyl))carboxamide refers to the compound having the following structure:
##STR00001##
or a tautomer or pharmaceutically acceptable salt thereof. In one embodiment, it is the maleate salt.
[0086] Betrixaban is described in U.S. Pat. Nos. 6,376,515 and 6,835,739 and U.S. Patent Application Publication No. 2007/0112039, filed on Nov. 7, 2006, the contents of which are incorporated herein by reference. Betrixaban is known to be a specific inhibitor of factor Xa.
[0087] Neutralize, reverse or counteract the activity of an inhibitor of fXa or similar phrases refer to inhibit or block the factor Xa inhibitory or anticoagulant function of a fXa inhibitor. Such phrases refer to partial inhibition or blocking of the function, as well as to inhibiting or blocking most or all of fXa inhibitor activity, in vitro and/or in vivo.
[0088] An effective amount refers to the amount of derivative sufficient to induce a desired biological and/or therapeutic result. That result can be alleviation of the signs, symptoms, or causes of a disease, or any other desired alteration of a biological system. In the present disclosure, the result will typically involve one or more of the following: neutralization of a fXa inhibitor that has been administered to a patient, reversal of the anticoagulant activity of the fXa inhibitor, removal of the fXa inhibitor from the plasma, restoration of hemostasis, and reduction or cessation of bleeding. The effective amount will vary depending upon the specific antidote agent used, the specific fXa inhibitor the subject has been administered, the dosing regimen of the fXa inhibitor, timing of administration of the antidote, the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the manner of administration and the like, all of which can be determined readily by one of ordinary skill in the art.
[0089] In certain aspects, the solution is administered to deliver an amount of the fXa derivative (e.g., the r-antidote) from about 10 milligrams (mg) to about 2 grams (g). Other amounts of the r-antidote used include from about 100 mg to about 1.5 g; from about 200 mg to about 1 g; and from about 400 mg to about 900 mg. In some aspects, the amount of the r-antidote used is about 400 mg or 960 mg. In some aspects, the amount of the r-antidote used is from about 10 mg to about 100 mg; from about 15 mg to about 95 mg; and from about 20 mg to about 80 mg.
[0090] In another embodiment, the solution administered in a neutralizing amount that is at least about a 1:1 fold molar ratio of circulating concentration of r-antidote over circulating concentration of the factor Xa inhibitor for a period of at least about 30 minutes. In other embodiments the molar ratio is about 1:1 or about 2:1 or about 4:1.
[0091] The formulation when administered neutralizes the factor Xa inhibitor by at least about 20%, or by at least about 50%, or by at least about 75%, or by at least about 90%, or by at least about 95%.
[0092] One can determine if the method, i.e., inhibition or reversal of a factor Xa inhibitor is achieved, by a number of in vitro assays, such as thrombin generation assay, and clinical clotting assays such as aPTT, PT and ACT.
[0093] One aspect of the present disclosure relates methods of selectively binding and inhibiting an exogenously administered fXa inhibitor in a subject undergoing anticoagulant therapy with a fXa inhibitor comprising administering to the subject an effective amount of a solution of the lyophilized formulation. Patients suitable for this therapy have undergone prior anticoagulant therapy, for example, they have been administered one, or more of an anticoagulant, such as a direct or indirect inhibitor of fXa.
[0094] In some embodiments, the solution is administered after the administration of an overdose of a fXa inhibitor or prior to a surgery, which may expose subjects to the risk of hemorrhage. The subject may be a cell or a mammal, such as a human.
[0095] In another aspect the method provide herein selectively binds and inhibits an exogenously administered factor Xa inhibitor in a subject undergoing anticoagulant therapy with a factor Xa inhibitor comprising administering a solution of the lyophilized formulation to the subject. The subject may be a cell or a mammal, such as a human.
[0096] Subjects that will benefit from the administration of the dissolved lyophilized formulation described herein and the accompanying methods include those that are experiencing, or predisposed to a clinical major bleeding event or a clinically significant non-major bleeding event. Examples of clinical major bleeding events are selected from the group consisting of hemorrhage, bleeding into vital organs, bleeding requiring re-operation or a new therapeutic procedure, and a bleeding index of ?2.0 with an associated overt bleed. (Turpie A G G, et al, NEAM, 2001, 344: 619-625.) Additionally, the subject may be experiencing or predisposed to a non-major bleeding event selected from the group consisting of epistaxis that is persistent or recurrent and in substantial amount or will not stop without intervention, rectal or urinary tract bleeding that does not rise to a level requiring a therapeutic procedure, substantial hematomas at injection sites or elsewhere that are spontaneous or occur with trivial trauma, substantial blood loss more than usually associated with a surgical procedure that does not require drainage, and bleeding requiring unplanned transfusion.
[0097] In some embodiments, the dissolved lyophilized formulation is administered after the administration of an overdose of a fXa inhibitor or prior to a surgery, which may expose subjects to the risk of hemorrhage.
[0098] In any of the methods described herein, it should be understood, even if not always explicitly stated, that an effective amount of the dissolved lyophilized formulation is administered to the subject. The amount can be empirically determined by the treating physician and will vary with the age, gender, weight and health of the subject. Additional factors to be considered by the treating physician include but are not limited to the identity and/or amount of factor Xa inhibitor, which may have been administered, the method or mode that the lyophilized formulation will be administered to the subject, and the therapeutic end point for the patient. With these variables in mind, one of skill will administer a therapeutically effective amount to the subject to be treated.
EXAMPLES
[0099] The disclosure is further understood by reference to the following examples, which are intended to be purely exemplary of the disclosure. The present disclosure is not limited in scope by the exemplified embodiments, which are intended as illustrations of single aspects of the disclosure only. Any methods that are functionally equivalent are within the scope of the disclosure. Various modifications of the disclosure in addition to those described herein will become apparent to those skilled in the art from the foregoing description and accompanying figures. Such modifications fall within the scope of the appended claims.
[0100] Unless otherwise stated all temperatures are in degrees Celsius. Also, in these examples and elsewhere, abbreviations have the following meanings:
[0101] hr=hour
[0102] M=molar
[0103] mg=milligram
[0104] mg/kg=milligram/kilogram
[0105] mg/mL=milligram/milliliter
[0106] min=minute
[0107] mL=milliliter
[0108] mM=millimolar
[0109] PS80=Polysorbate 80
[0110] RH=Relative humidity
[0111] w/v=Weight/volume
[0112] ?L or uL=microliter
[0113] ?M=Micromolar
Example 1. Preparation of Aqueous Solutions for Preparing Amorphous Formulations r-Antidote
[0114] r-Antidote was manufactured in a 10 mM tris, 45 mM L-arginine HCl, 6% w/v sucrose, pH 7.8 formulation by ultrafiltration/diafiltration. r-Antidote was buffer exchanged into 10 mM tris, 45 mM L-arginine HCl, 6% w/v sucrose, pH 7.8 at 12 mg/mL, and then concentrated to 30 mg/mL. After dilution, the target r-Antidote concentration was 20 mg/mL.
Example 2a. Thermal Characterization
[0115] Eleven different formulations were prepared to test the effects of pH, mannitol (crystalline component), sucrose (stabilizer), and r-Antidote concentration on the Tg (glass transition temperature) of the formulation. The Tg was measured by differential scanning calorimetry (DSC). The amount of each component and Tg of these formulations are summarized in Table 5.
TABLE-US-00005 TABLE 5 r-Antidote L-Arg Sucrose:r- Formulation Concentration Tris HCl Mannitol Sucrose PS80 Antidote # (mg/mL) (mM) (mM) (% w/v) (% w/v) (% w/v) pH Molar Ratio Tg 1a 20 10 45 0 6 0.01 7.7 359 ?29.7 2a 20 10 100 4 4 0.01 6.8 240 ?36.0 3a 20 10 45 4 4 0.01 7.7 240 ?35.9 4a 20 10 100 0 6 0.01 6.9 359 ?30.1 5a 20 10 45 0 4 0.01 6.9 240 ?31.6 6a 20 10 45 4 6 0.01 6.9 359 ?34.7 7a 20 10 100 4 6 0.01 7.6 359 ?34.3 8a 20 10 100 0 4 0.01 7.7 240 ?30.9 9a 20 10 72.5 2 5 0.01 7.3 299 ?34.2 10a 11 10 45 5 2 0.01 7.6 240 * 11a 39 10 100 0 6 0.01 7.6 180 ?27.9 * No Tg detected. Solution exhibited crystallization event.
[0116] Based on the above thermal characterization, it was found that formulations containing r-Antidote, Tris, L-arginine hydrochloride, mannitol, sucrose, and polysorbate 80 wherein the ratio of sucrose to mannitol were greater than 1 were amorphous and exhibited a Tg. In formulations, such as Formulation 10a in Table 5, where the ratio of sucrose to mannitol was less than 1, a crystallization event was observed. Statistical analysis indicates that increasing amounts of sucrose and r-Antidote increase the Tg, while increasing amounts of mannitol decrease the Tg for the amorphous formulations.
Example 2b. Thermal Characterization
[0117] Formulations of increasing concentrations of r-Antidote in 10 mM Tris, 100 mM L-arginine hydrochloride at pH 8.0 were evaluated by DSC. All formulations with a Tg were amorphous. As shown in Table 6 below, as the protein concentration increases, the Tg increases. Formulations with high Tg are desirable, since they are more amenable for lyophilization, if needed.
TABLE-US-00006 TABLE 6 r-Antidote Concentration (mg/mL) Tg (? C.) 25.2 ?33.5 46.8 ?30.7 72.1 ?28.7 91.2 ?26.2 116.2 ?25.5
Example 3. Stability of Formulations-Liquid
[0118] The liquid formulations in Table 5 were put on stability. The formulations were tested by size exclusion chromatography (SEC) after 14 days at 5? C. and 25? C./60% RH and after 4 days at 40? C./75% RH. Ion exchange (IEX) chromatography was also performed after 4 days at 25? C./60% RH and 40? C./75% RH. Formation of SEC high molecular weight (HMW) species was primarily affected by pH, but overall, all formulations retained high SEC monomer content. For IEX, there was no change after 4 days at 25? C./60% RH and an increase in acidic species with a decrease in basic species after 4 days at 40? C./75% RH. Overall, the formulations were stable as shown by SEC and IEX (Table 7).
TABLE-US-00007 TABLE 7 SEC SEC IEX % IEX % Formulation Time Temperature HMW Monomer Acidic IEX % IEX % IEX % Basic # (days) (? C.) (%) (%) Peaks Peak 1 Peak 2 Peak 3 Peaks 1a 0 5 1.1 98.8 NT NT NT NT NT 1a 14 5 1.9 98.0 NT NT NT NT NT 2a 0 5 0.6 99.3 NT NT NT NT NT 2a 14 5 0.8 99.1 NT NT NT NT NT 3a 0 5 1.1 98.8 NT NT NT NT NT 3a 14 5 1.7 98.2 NT NT NT NT NT 4a 0 5 0.7 99.2 NT NT NT NT NT 4a 14 5 0.9 98.9 NT NT NT NT NT 5a 0 5 0.8 99.1 NT NT NT NT NT 5a 14 5 0.9 99.0 NT NT NT NT NT 6a 0 5 0.9 99.0 NT NT NT NT NT 6a 14 5 0.9 99.0 NT NT NT NT NT 7a 0 5 1.0 98.9 NT NT NT NT NT 7a 14 5 1.5 98.3 NT NT NT NT NT 8a 0 5 1.0 99.0 NT NT NT NT NT 8a 14 5 1.6 98.3 NT NT NT NT NT 9a 0 5 0.9 99.0 NT NT NT NT NT 9a 14 5 1.3 98.6 NT NT NT NT NT 10a 0 5 1.0 99.0 NT NT NT NT NT 10a 14 5 1.4 98.5 NT NT NT NT NT 11a 0 5 1.1 98.8 NT NT NT NT NT 11a 14 5 1.8 98.1 NT NT NT NT NT 1a 0 25 0.7 99.2 29.7 20.5 20.2 8.9 20.6 1a 4 25 1.3 98.1 30.9 20.0 18.6 9.4 21.0 1a 7 25 1.2 98.1 NT NT NT NT NT 1a 14 25 3.0 96.5 NT NT NT NT NT 2a 0 25 0.7 99.2 29.8 20.8 20.3 8.7 20.4 2a 4 25 1.2 98.4 30.5 20.0 18.8 9.4 21.2 2a 7 25 1.2 98.2 NT NT NT NT NT 2a 14 25 2.9 96.0 NT NT NT NT NT 3a 0 25 1.2 98.7 30.1 20.6 20.1 8.8 20.4 3a 4 25 2.3 97.6 30.9 20.0 18.3 9.1 21.7 3a 7 25 2.5 97.2 NT NT NT NT NT 3a 14 25 2.8 96.8 NT NT NT NT NT 4a 0 25 0.7 99.2 29.8 20.7 20.3 8.8 20.4 4a 4 25 1.5 98.0 29.4 19.7 19.4 9.8 21.7 4a 7 25 1.5 97.8 NT NT NT NT NT 4a 14 25 1.2 97.7 NT NT NT NT NT 5a 0 25 0.8 99.1 29.6 21.4 18.6 8.7 21.7 5a 4 25 1.1 98.6 28.5 20.3 19.2 10.2 21.8 5a 7 25 0.9 98.5 NT NT NT NT NT 5a 14 25 3.1 95.5 NT NT NT NT NT 6a 0 25 0.9 99.1 29.6 21.2 20.5 8.7 19.9 6a 4 25 1.2 98.5 30.8 19.8 18.6 9.3 21.4 6a 7 25 1.0 98.5 NT NT NT NT NT 6a 14 25 2.3 96.4 NT NT NT NT NT 7a 0 25 1.1 98.8 30.5 20.3 20.4 9.1 19.6 7a 4 25 2.2 97.5 30.4 19.3 18.9 9.4 22.1 7a 7 25 2.4 97.1 NT NT NT NT NT 7a 14 25 2 7 96.6 NT NT NT NT NT 8a 0 25 1.0 98.9 29.7 20.3 20.0 8.8 21.2 8a 4 25 2.4 97.5 31.6 19.8 18.9 9.5 20.2 8a 7 25 2.7 96.9 NT NT NT NT NT 8a 14 25 3.3 96.4 NT NT NT NT NT 9a 0 25 1.0 99.0 30.1 20.2 20.0 8.8 20.9 9a 4 25 2.2 97.4 30.8 19.6 19.3 9.7 20.6 9a 7 25 2.4 97.2 NT NT NT NT NT 9a 14 25 2.7 96.8 NT NT NT NT NT 10a 0 25 1.0 98.9 31.4 18.8 20.6 8.9 20.3 10a 4 25 1.9 97.8 29.9 18.8 18.7 9.3 23.3 10a 7 25 2.1 97.6 NT NT NT NT NT 10a 14 25 2.3 97.3 NT NT NT NT NT 11a 0 25 1.1 98.8 30.4 20.1 21.0 9.8 18.7 11a 4 25 2.8 97.0 31.7 19.4 19.0 9.7 20.2 11a 7 25 3.2 96.5 NT NT NT NT NT 11a 14 25 4.2 95.4 NT NT NT NT NT 1a 0 40 0.7 99.2 29.7 20.5 20.2 8.9 20.6 1a 4 40 5.9 93.1 42.3 20.8 16.6 8.4 11.9 2a 0 40 0.7 99.2 29.8 20.8 20.3 8.7 20.4 2a 4 40 5.9 93.1 30.5 18.0 18.6 11.2 21.7 3a 0 40 1.2 98.7 30.1 20.6 20.1 8.8 20.4 3a 4 40 12.1 87.7 40.7 20.9 16.4 8.0 14.0 4a 0 40 0.7 99.2 29.8 20.7 20.3 8.8 20.4 4a 4 40 7.8 91.6 34.2 19.1 18.0 10.0 18.7 5a 0 40 0.8 99.1 29.6 21.4 18.6 8.7 21.7 5a 4 40 9.0 90.3 33.7 19.1 18.0 10.5 18.7 6a 0 40 0.9 99.1 29.6 21.2 20.5 8.7 19.9 6a 4 40 5.1 94.0 31.0 18.2 18.5 10.8 21.5 7a 0 40 1.1 98.8 30.5 20.2 20.4 9.1 19.6 7a 4 40 8.9 91.0 40.0 20.5 16.1 8.0 15.4 8a 0 40 1.0 98.9 29.7 20.3 20.0 8.8 21.2 8a 4 40 12.7 87.0 41.9 20.4 16.4 7.9 13.4 9a 0 40 1.0 99.0 30.1 20.2 20.0 8.8 20.9 9a 4 40 8.2 91.6 36.7 20.0 17.1 9.0 17.1 10a 0 40 1.0 98.9 31.4 18.8 20.6 8.9 20.3 10a 4 40 5.8 94.0 37.3 20.8 17.4 12.8 11.6 11a 0 40 1.1 98.8 30.4 20.1 21.0 9.8 18.7 11a 4 40 19.3 80.4 41.8 20.6 16.5 8.3 12.8 NT = not tested
Example 4. Collapse Temperature
[0119] Two formulations were evaluated by freeze dry microscopy to identify their collapse temperature.
[0120] Approximately 0.15 mL of solution was dispensed into a glass cell. The cell was placed on a temperature-controlled freeze-drying stage. The sample cell had 2 thermocouples placed directly into the material at the bottom and center of the cell. The liquid samples was cooled at 0.5? C./min to ?60? C. The stage chamber was evacuated to initiate sublimation. The stage was then warmed at an average rate of 0.5? C./min. The sample was examined for collapse using an Infinivar Microscope capable of magnification from 16 to 330? coupled to a Super WDR CCD Camera.
[0121] A formulation of 20 mg/mL r-Antidote, 10 mM tris, 45 mM L-arginine, 6% w/v sucrose, 0.01% w/v polysorbate 80 at pH 7.8, exhibited a collapse temperature of ?26? C.
[0122] A formulation of 40 mg/mL r-Antidote, 10 mM tris, 45 mM L-arginine, 6% w/v sucrose, 0.01% w/v polysorbate 80 at pH 7.8 exhibited a collapse temperature of ?24? C.
[0123] The collapse temperature of the two formulations are sufficiently high enough for the development of a lyophilization cycle.
Example 5. Lyophilization
[0124] The formulations summarized in Table 8 were lyophilized using the lyophilization cycle summarized in Table 9. 2.5 mL of each formulation was filled into 5 mL glass vials and partially stoppered prior to start of the lyophilization cycle.
TABLE-US-00008 TABLE 8 Sucrose:r- Formulation r-Antidote Tris Arginine Sucrose Mannitol PS80 Antidote # (mg/mL) (mM) (mM) (mM) (mM) (%) pH Molar Ratio 1b 20 10 45 6 0 0.01 7.8 359 2b 40 10 100 6 0 0.01 7.8 180 3b 20 10 45 2 5 0.01 7.8 120
TABLE-US-00009 TABLE 9 Step Description Process Parameter Target Freezing Freezing Ramp Rate (? C./min) 1 Freezing Shelf Temperature (? C.) ?40 Freezing Hold Time (min) ?180 Annealing Annealing Ramp Rate (? C./min) 1 Annealing Hold Shelf Temperature (? C.) ?20 Annealing Hold Time (min) ?180 Refreezing Refreezing Ramp Rate (? C./min) 1 Refreezing Shelf Temperature (? C.) ?40 Refreezing Hold Time (min) ?180 Primary Ramp Rate (? C./min) 0.5 Drying Shelf Temperature ?30.0 Chamber Pressure
100 Hold Time (min) Hold until Pirani indicates completion Secondary Ramp Rate (? C./min) 0.5 Drying Shelf Temperature
25 Chamber Pressure
75 Hold Time (min) Hold until
indicates completion (4-8 hours) Stoppering Backfill Pressure (manual stoppering) Atmosphere Temperature
Ramp Rate
[0125] All lyophilized formulations were solid in appearance and pharmaceutically elegant. Formulation 1b exhibited minor collapse, while Formulations 2b and 3b did not show any collapse.
Example 6. Stability of Lyophilized Formulations
[0126] The lyophilized formulations were placed on accelerated stability at 40? C./75% RH for up to 1 month. The stability results as determined by SEC, HPLC, and IEX are shown below in Tables 10, 11, and 12, respectively. The formulations are stable up to 1 month at 40? C.
TABLE-US-00010 TABLE 10 Protein SEC Formulation Time Concentration Moisture SEC SEC % Post- # (weeks) (mg/mL) (% w/w) % HMW % Monomer Peak 1b 0 26.0 0.7 1.4 98.6 0.0 1b 2 25.9 1.6 98.3 0.1 1b 4 25.9 1.5 98.5 0.1 2b 0 46.5 0.5 1.3 98.6 0.1 2b 2 44.4 1.6 98.4 0.1 2b 4 45.6 1.4 98.5 0.1 3b 0 17.6 0.6 0.8 99.2 0.1 3b 2 17.2 1.1 98.9 0.0 3b 4 17.3 1.0 98.9 0.1
TABLE-US-00011 TABLE 11 Protein RP-HPLC RP-HPLC RP-HPLC Formulation Time Concentration Moisture % Pre- % Main RP-HPLC % Post # (weeks) (mg/mL) (% w/w) Peaks Peak % BetaPeak Peaks 1b 0 26.0 0.7 0.7 89.9 9.2 0.3 1b 2 25.9 0.9 88.6 9.1 1.4 1b 4 25.9 1.0 89.0 9.0 1.1 2b 0 46.5 0.5 0.7 89.8 9.2 0.4 2b 2 44.4 1.0 89.2 8.4 1.4 2b 4 45.6 1.0 88.9 8.9 1.1 3b 0 17.6 0.6 0.5 91.8 7.4 0.3 3b 2 17.2 0.7 90.9 7.3 1.1 3b 4 17.3 1.1 90.6 7.1 1.3
TABLE-US-00012 TABLE 12 Protein IEX IEX Formulation Time Concentration Moisture % Acidic IEX IEX IEX % Basic # (weeks) (mg/mL) (% w/w) Peaks % Peak 1 % Peak 2 % Peak 3 Peaks 1b 0 26.0 0.7 31.3 17.6 20.3 8.6 22.2 1b 2 25.9 30.0 15.8 18.3 8.1 27.7 1b 4 25.9 33.5 21.5 17.1 7.4 20.5 2b 0 46.5 0.5 31.5 17.1 20.8 8.8 21.8 2b 2 44.4 29.8 14.8 17.7 7.9 29.9 2b 4 45.6 33.2 21.0 17.4 7.9 20.6 3b 0 17.6 0.6 31.8 16.9 20.5 8.8 21.9 3b 2 17.2 29.8 14.7 17.4 7.9 30.2 3b 4 17.3 33.2 21.0 17.9 7.3 20.5
Example 7. r-Antidote Solubility
[0127] The solubility of r-Antidote in various pH and various concentrations of excipients was examined. r-Antidote was buffer exchanged and concentrated into the formulations detailed in Table 13. The solutions were filtered with a 0.45 ?m filter. Visual appearance, concentration, and pH measurements were performed for the formulations at room temperature. The protein increases in solubility with increasing pH from 6.8 to 7.8. For formulations containing L-Arginine hydrochloride from 25 mM to 100 mM, the concentrations obtained ranged from 114 to 151 mg/mL. The solutions were clear, indicating that the protein could be concentrated higher, and the solubility limit was not reached. With the addition of L-arginine hydrochloride, the effects of pH are lessened on solubility. Based on these results, formulations of high concentrations of r-Antidote can be achieved at higher pHs or with the addition of L-arginine hydrochloride. Based on Example 2b, higher protein concentration formulations decrease the Tg, which allow for more efficient lyophilization cycles for the manufacturing of lyophilized protein solutions.
TABLE-US-00013 TABLE 13 L-Arginine Hydro- Visual Tris chloride Sucrose Appearance Meas- Protein Sam- Conc. Conc. Conc. Prior to ured Conc. ple (mM) (mM) (% w/v) Filtration pH (mg/mL) 1 10 0 0 Cloudy 6.8 11.4 2 10 0 0 Cloudy 7.1 30.4 3 10 0 0 Cloudy 7.5 54.0 4 10 0 0 Cloudy 7.8 94.6 5 10 100 0 Clear* 6.7 126.2 6 10 100 0 Clear* 8.0 137.5 7 10 100 6 Clear* 8.0 114.2 8 10 45 4 Clear* 7.7 130.5 9 10 25 0 Clear* 8.0 129.6 10 10 50 0 Clear* 8.0 151.3 11 10 75 0 Clear* 8.1 137.9 *Conc. = concentration. Formulations were clear indicating the solubility limit was not reached. Concentration values reported are values obtained from concentrating the solution but are not representative of the solubility limit