VARIANT POLYPEPTIDES CAPABLE OF AMINATING ALIPHATIC ALPHA KETO ACIDS
20190048326 ยท 2019-02-14
Inventors
- Michael J. Abrahamson (Chicago, IL)
- Rajarathnam E. Reddy (Gurnee, IL)
- William T. Riordan (Libertyville, IL)
- Sanjay R. Chemburkar (Gurnee, IL)
Cpc classification
International classification
Abstract
Disclosed are, among other things, variant polypeptides, nucleic acids encoding the polypeptides, production of the variant polypeptides, and use of the variant polypeptides in various applications, such as screening and synthetic methods. For example, the variant polypeptides, or enzymatically-active fragments thereof, are useful for converting aliphatic keto acids to aliphatic alpha amino acids.
Claims
1-10. (canceled)
11. A nucleic acid encoding a polypeptide; wherein the polypeptide comprises: (a) the amino acid sequence of any one of SEQ ID NOS:2 and 13-18, wherein X is not leucine; (b) an amino acid sequence that is at least 95% identical to: (i) amino acids 6 to 238 of SEQ ID NO:2; (ii) amino acids 7 to 237 of SEQ ID NO:13; (iii) amino acids 4 to 236 of SEQ ID NO:14; (iv) amino acids 4 to 236 of SEQ ID NO:15; (v) amino acids 4 to 236 of SEQ ID NO:16; (vi) amino acids 4 to 236 of SEQ ID NO:17; or (vii) amino acids 4 to 236 of SEQ ID NO:18, wherein X is not leucine; (c) an amino acid sequence that is at least 95% identical to: (i) amino acids 6 to 298 of SEQ ID NO:2; (ii) amino acids 7 to 297 of SEQ ID NO:13; (iii) amino acids 4 to 296 of SEQ ID NO:14; (iv) amino acids 4 to 296 of SEQ ID NO:15; (v) amino acids 4 to 296 of SEQ ID NO:16; (vi) amino acids 4 to 296 of SEQ ID NO:17; or (vii) amino acids 4 to 296 of SEQ ID NO:18, wherein X is not leucine; or (d) the amino acid sequence of SEQ ID NO: 4, 5, 6, or 20; and X is isoleucine, valine, glycine, alanine, serine, or threonine.
12. An expression vector, comprising the nucleic acid of claim 11.
13. A cell, comprising the expression vector of claim 12.
14. A method for producing a polypeptide, comprising culturing the cell of claim 13 under conditions suitable for protein expression, thereby producing a polypeptide.
15. The method of claim 14, further comprising isolating the polypeptide from the cell or from media in which the cell is cultured.
16. (canceled)
17. The nucleic acid of claim 11, wherein X is isoleucine.
18. The nucleic acid of claim 11, wherein X is valine.
19. The nucleic acid of claim 11, wherein X is glycine.
20. The nucleic acid of claim 11, wherein X is alanine.
21. The nucleic acid of claim 11, wherein X is serine or threonine.
22. The nucleic acid of claim 11, wherein the amino acid sequence is SEQ ID NO:2.
23. The nucleic acid of claim 22, wherein X is alanine.
24. The expression vector of claim 12, wherein the expression vector is a prokaryotic expression vector.
25. The expression vector of claim 12, wherein the expression vector is a eukaryotic expression vector.
26. The cell of claim 13, wherein the cell is a bacterial cell.
27. The cell of claim 13, wherein the cell is a mammalian cell.
28. The cell of claim 13, wherein the cell is a yeast cell.
29. The cell of claim 13, wherein the cell is an insect cell.
30. The cell of claim 13, wherein the cell is a plant cell.
31. The method of claim 14, wherein the polypeptide comprises: (a) the amino acid sequence of any one of SEQ ID NOS:2 and 13-18, wherein X is not leucine; (b) an amino acid sequence that is at least 95% identical to: (i) amino acids 6 to 238 of SEQ ID NO:2; (ii) amino acids 7 to 237 of SEQ ID NO:13; (iii) amino acids 4 to 236 of SEQ ID NO:14; (iv) amino acids 4 to 236 of SEQ ID NO:15; (v) amino acids 4 to 236 of SEQ ID NO:16; (vi) amino acids 4 to 236 of SEQ ID NO:17; or (vii) amino acids 4 to 236 of SEQ ID NO:18, wherein X is not leucine; (c) an amino acid sequence that is at least 95% identical to: (i) amino acids 6 to 298 of SEQ ID NO:2; (ii) amino acids 7 to 297 of SEQ ID NO:13; (iii) amino acids 4 to 296 of SEQ ID NO:14; (iv) amino acids 4 to 296 of SEQ ID NO:15; (v) amino acids 4 to 296 of SEQ ID NO:16; (vi) amino acids 4 to 296 of SEQ ID NO:17; or (vii) amino acids 4 to 296 of SEQ ID NO:18, wherein X is not leucine; or (d) the amino acid sequence of SEQ ID NO: 4, 5, 6, or 20; and X is isoleucine, valine, glycine, alanine, serine, or threonine.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0053]
[0054]
[0055]
[0056]
[0057]
DETAILED DESCRIPTION
[0058] The disclosure relates to, among other things, polypeptides (e.g., variant polypeptides and enzymatically-active fragments thereof), nucleic acids encoding the polypeptides, production of the polypeptides, and use of the polypeptides in various applications, such as screening and synthetic methods. For example, the variant polypeptides, or enzymatically-active fragments thereof, are useful for converting aliphatic keto acids to aliphatic alpha amino acids. While in no way intended to be limiting, exemplary variant polypeptides, fragments, and methods for making and using any of the foregoing are elaborated on below.
Polypeptides
[0059] The polypeptides described herein include variants of leucine dehydrogenase (LDH) and enzymatically-active fragments of such variants. In some embodiments, the polypeptide is a variant of a LDH expressed by Bacillus cereus, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type polypeptide from Bacillus cereus is as follows:
TABLE-US-00001 (UniProt ID No. P0A392) (SEQ ID NO: 1) MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPALGGTRMWTY DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK LIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDIYAPCALGATVNDETI PQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVTNAGGVINVADEL YGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKN SRSTYLRNGHDIISRR.
[0060] In some embodiments, the polypeptide is a variant of a LDH expressed by Chlamydia pneumoniae, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Chlamydia pneumoniae is as follows:
TABLE-US-00002 (UniProt ID No. Q9Z6Y7) (SEQ ID NO: 7) MKYSLNFKEIKIDDYERVIEVTCSKVRLHAIIAIHQTAVGPALGGVRASL YSSFEDACTDALRLARGMTYKAIISNTGTGGGKSVIILPQDAPSLTEDML RAFGQAVNALEGTYICAEDLGVSINDISIVAEETPYVCGIADVSGDPSIY TAHGGFLCIKETAKYLWGSSSLRGKKIAIQGIGSVGRRLLQSLFFEGAEL YVADVLERAVQDAARLYGATIVPTEEIHALECDIFSPCARGNVIRKDNLA DLNCKAIVGVANNQLEDSSAGMMLHERGILYGPDYLVNAGGLLNVAAAIE GRVYAPKEVLLKVEELPIVLSKLYNQSKTTGKDLVALSDSFVEDKLLAYT S.
[0061] In some embodiments, the polypeptide is a variant of a LDH expressed by Thermoactinomyces intermedius, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Thermoactinomyces intermedius is as follows:
TABLE-US-00003 (UniProt ID No. Q60030) (SEQ ID NO: 8) MKIFDYMEKYDYEQLVMCQDKESGLKAIICIHVTTLGPALGGMRMWTYAS EEEAIEDALRLGRGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEAMFRALG RFIQGLNGRYITAEDVGTTVEDMDIIHEETRYVTGVSPAFGSSGNPSPVT AYGVYRGMKAAAKEAFGDDSLEGKVVAVQGVGHVAYELCKHLHNEGAKLI VTDINKENADRAVQEFGAEFVHPDKIYDVECDIFAPCALGAIINDETIER LKCKVVAGSANNQLKEERHGKMLEEKGIVYAPDYVINAGGVINVADELLG YNRERAMKKVEGIYDKILKVFEIAKRDGIPSYLAADRMAEERIEMMRKTR STFLQDQRNLINFNNK.
[0062] In some embodiments, the polypeptide is a variant of a LDH expressed by Bacillus subtilis, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Bacillus subtilis is as follows:
TABLE-US-00004 (UniProt ID No. P54531) (SEQ ID NO: 9) MELFKYMEKYDYEQLVFCQDEQSGLKAIIAIHDTTLGPALGGTRMWTYEN EEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFG RYIQGLNGRYITAEDVGTTVEDMDIIHDETDYVTGISPAFGSSGNPSPVT AYGVYRGMKAAAKAAFGTDSLEGKTIAVQGVGNVAYNLCRHLHEEGANLI VTDINKQSVQRAVEDFGARAVDPDDIYSQDCDIYAPCALGATINDDTIKQ LKAKVIAGAANNQLKETRHGDQIHEMGIVYAPDYVINAGGVINVADELYG YNAERALKKVEGIYGNIERVLEISQRDGIPAYLAADRLAEERIERMRRSR SQFLQNGHSVLSRR.
[0063] In some embodiments, the polypeptide is a variant of a LDH expressed by Bacillus lichenformis, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Bacillus licheniformis is as follows:
TABLE-US-00005 (UniProt ID No. Q65HK5) (SEQ ID NO: 10) MELFRYMEQYDYEQLVFCQDKQSGLKAIIAIHDTTLGPALGGTRMWTYES EEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFG RYIQGLNGRYITAEDVGTTVEDMDIIHDETDFVTGISPAFGSSGNPSPVT AYGVYKGMKAAAKAAFGTDSLEGKTVAVQGVGNVAYNLCRHLHEEGAKLI VTDINKEAVERAVAEFGARAVDPDDIYSQECDIYAPCALGATINDDTIPQ LKAKVIAGAANNQLKETRHGDQIHDMGIVYAPDYVINAGGVINVADELYG YNSERALKKVEGIYGNIERVLEISKRDRIPTYLAADRLAEERIERMRQSR SQFLQNGHHILSRR.
[0064] In some embodiments, the polypeptide is a valiant of a LDH expressed by Geobacillus stearothermophilus, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Geobacillus stearothermophilus is as follows:
TABLE-US-00006 (UniProt ID No. P13154) (SEQ ID NO: 11) MELFKYMETYDYEQVLFCQDKESGLKAIIAIHDTTLGPALGGTRMWMYNS EEEALEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEAMFRAFG RFIQGLNGRYITAEDVGTTVADMDIIYQETDYVTGISPEFGSSGNPSPAT AYGVYRGMKAAAKEAFGSDSLEGKVVAVQGVGNVAYHLCRHLHEEGAKLI VTDINKEVVARAVEEFGAKAVDPNDIYGVECDIFAPCALGGIINDQTIPQ LKAKVIAGSADNQLKEPRHGDIIHEMGIVYAPDYVINAGGVINVADELYG YNRERAMKKIEQIYDNIEKVFAIAKRDNIPTYVAADRMAEERIETMRKAR SPFLQNGHHILSRRRAR.
[0065] In some embodiments, the polypeptide is a variant of a LDH expressed by Bacillus sphaericus, or an enzymatically-active fragment of the variant. An exemplary amino acid sequence for the full-length, wild-type LDH polypeptide from Bacillus sphaericus is as follows:
TABLE-US-00007 (UniProt ID No. Q76GS2) (SEQ ID NO: 12) MEIFKYMEKYDYEQLVFCQDEASGLKAIIAIHDTTLGPALGGARMWTYAT EENAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPFKDKNEEMFRALG RFIQGLNGRYITAEDVGTTVTDMDLIHEETNYVTGISPAFGSSGNPSPVT AYGVYRGMKAAAKEAFGTDMLEGRTISVQGLGNVAYKLCEYLHNEGAKLV VTDINQAAIDRVVNDFGATAVAPDEIYSQEVDIFSPCALGAILNDETIPQ LKAKVIAGSANNQLQDSRHGDYLHELGIVYAPDYVINAGGVINVADELYG YNRERALKRVDGIYDSIEKIFEISKRDSIPTYVAANRLAEERIARVAKSR SQFLKNEKNILNGR.
[0066] The variant polypeptides described herein comprise one or more amino acid substitutions, insertions, or deletions, relative to the wild-type LDH polypeptides from which they were derived. In some embodiments, a variant polypeptide comprises at least two (e.g., at least three, four, five, six, seven, eight, nine, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, or more than 100) amino acid substitutions, deletions, or insertions, relative to the wild-type, full-length LDH polypeptide from which it was derived. In some embodiments, a variant polypeptide comprises no more than 150 (e.g., no more than 145, 140, 135, 130, 125, 120, 115, 110, 105, 100, 95, 90, 85, 80, 75, 70, 65, 60, 55, 50, 45, 40, 35, 30, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2) amino acid substitutions, deletions, or insertions, relative to the wild-type, full-length LDH polypeptide from which it was derived. In some embodiments, a variant polypeptide described herein, or a fragment thereof, includes an amino acid substitution at amino acid position 42 relative to SEQ ID NO:1, e.g., a substitution of leucine at position 42 with another amino acid. The amino acid at position 42, leucine, relative to SEQ ID NO:1 is one of several amino acids (GPAXGG (SEQ ID NO:3)) highly conserved among bacterial leucine dehydrogenase polypeptides (
[0067] In some embodiments, any of the variant polypeptides or fragments described herein comprise the amino acid sequence NVA (SEQ ID NO:19), which corresponds to amino acids 295 to 297 of SEQ ID NO:1. In some embodiments, a variant polypeptide or fragment thereof comprises the amino acid sequences depicted in SEQ ID NO:3 and SEQ ID NO:19.
[0068] As used herein, the term conservative substitution refers to the replacement of an amino acid present in the native sequence in a given polypeptide with a naturally or non-naturally occurring amino acid having similar steric properties. Where the side-chain of the native amino acid to be replaced is either polar or hydrophobic; the conservative substitution should be with a naturally occurring amino acid, a non-naturally occurring amino acid that is also polar or hydrophobic, and, optionally, with the same or similar steric properties as the side-chain of the replaced amino acid. Conservative substitutions typically include substitutions within the following groups: glycine and alanine; valine, isoleucine, and leucine; aspartic acid and glutamic acid; asparagine, glutamine, serine and threonine; lysine, histidine and arginine; and phenylalanine and tyrosine. One letter amino acid abbreviations are as follows: alanine (A); arginine (R); asparagine (N); aspartic acid (D); cysteine (C); glycine (G); glutamine (Q); glutamic acid (E); histidine (H); isoleucine (I); leucine (L); lysine (K); methionine (M); phenylalanine (F); proline (P); serine (S); threonine (T); tryptophan (W), tyrosine (Y); and valine (V).
[0069] The phrase non-conservative substitutions as used herein refers to replacement of the amino acid as present in the parent sequence by another naturally or non-naturally occurring amino acid, having different electrochemical and/or steric properties. Thus, the side chain of the substituting amino acid can be significantly larger (or smaller) than the side chain of the native amino acid being substituted and/or can have functional groups with significantly different electronic properties than the amino acid being substituted.
[0070] In some embodiments, the variant polypeptide, or fragment thereof, comprises the amino acid sequence GPAXGG (SEQ ID NO:3), wherein X is any amino acid except for leucine. In some embodiments, X is glycine. In some embodiments, X is valine. In some embodiments, X is isoleucine. In some embodiments, X is alanine. In some embodiments, X is serine. In some embodiments, X is threonine. In some embodiments, X can be, e.g., glycine, valine, isoleucine, alanine, serine, or threonine.
[0071] In some embodiments, the variant polypeptide is a variant of Bacillus cereus LDH comprising the following amino acid sequence: MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPAXGGTRMWTYDSEEAAIED ALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRALGRYIQGLNGRYITAED VGTTVDDMDIIHEETDFVTGISPSFGSSGNPSVTAYGVYRGMKAAAKEAFGTDNLEGK VIAVQGVGNVAYHLCKHLHAEGAKLIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDI YAPCALGATVNDETIPQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVI NVADELYGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKNSRST YLRNGHDIISRR (SEQ ID NO:2), wherein X is any amino acid except for leucine. In some embodiments, X is glycine. In some embodiments, X is valine. In some embodiments, X is isoleucine. In some embodiments, X is alanine. In some embodiments, X is serine. In some embodiments, X is threonine. In some embodiments, X can be, e.g., glycine, valine, isoleucine, alanine, serine, or threonine.
[0072] In some embodiments, the variant polypeptide comprises, or consists of, one of the following amino acid sequences:
TABLE-US-00008 (1) (SEQ ID NO: 4) MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPAIGGTRMWTY DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK LIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDIYAPCALGATVNDETI PQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVINVADEL YGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKN SRSTYLRNGHDIISRR; (2) (SEQ ID NO: 5) MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPAVGGTRMWTY DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK LIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDIYAPCALGATVNDETI PQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVINVADEL YGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKN SRSTYLRNGHDIISRR; (3) (SEQ ID NO: 6) MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPAGGGTRMWTY DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK LIVTDINKEAVQRAVEEFGASAVEPNEIYGVECDIYAPCALGATVNDETI PQLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVINVADEL YGYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKN SRSTYLRNGHDIISRR, or (4) (SEQ ID NO: 20) MTLEIFEYLEKYDYEQVVFCQDKESGLKAIIAIHDTTLGPAAGGTRMWTY DSEEAAIEDALRLAKGMTYKNAAAGLNLGGAKTVIIGDPRKDKSEAMFRA LGRYIQGLNGRYITAEDVGTTVDDMDIIHEETDFVTGISPSFGSSGNPSP VTAYGVYRGMKAAAKEAFGTDNLEGKVIAVQGVGNVAYHLCKHLHAEGAK LIVTDINKEAVQRAVEEFGASAVEPNEIYGWCDIYAPCALGATVNDETIP QLKAKVIAGSANNQLKEDRHGDIIHEMGIVYAPDYVINAGGVINVADELY GYNRERALKRVESIYDTIAKVIEISKRDGIATYVAADRLAEERIASLKNS RSTYLRNGHDIISRR.
[0073] In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:2, inclusive of the amino acid at position 42, wherein X is not leucine.
[0074] In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:13, inclusive of the amino acid at position 43, wherein X is not leucine. The amino acid sequence of SEQ ID NO:13 is as follows:
TABLE-US-00009 MKYSLNFKEIKIDDYERVIEVTCSKVRLHAIIAIHQTAVGPAXGGVRASL YSSFEDACTDALRLARGMTYKAIISNTGTGGGKSVIILPQDAPSLTEDML RAFGQAVNALEGTYICAEDLGVSINDISIVAEETPYVCGIADVSGDPSIY TAHGGFLCIKETAKYLWGSSSLRGKKIAIQGIGSVGRRLLQSLFFEGAEL YVADVLERAVQDAARLYGATIVPTEEIHALECDIFSPCARGNVIRKDNLA DLNCKAIVGVANNQLEDSSAGMMLHERGILYGPDYLVNAGGLLNVAAAIE GRVYAPKEVLLKVEELPIVLSKLYNQSKTTGKDLVALSDSFVEDKLLAYT S.
[0075] In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:14, inclusive of the amino acid at position 40, wherein X is not leucine. The amino acid sequence of SEQ ID NO:14 is as follows:
TABLE-US-00010 MKIFDYMEKYDYEQLVMCQDKESGLKAIICIHVTTLGPAXGGMRMWTYAS EEEAIEDALRLGRGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEAMFRALG RFIQGLNGRYITAEDVGTTVEDMDIIHEETRYVTGVSPAFGSSGNPSPVT AYGVYRGMKAAAKEAFGDDSLEGKVVAVQGVGHVAYELCKHLHNEGAKLI VTDINKENADRAVQEFGAEFVHPDKIYDVECDIFAPCALGAIINDETIER LKCKVVAGSANNQLKEERHGKMLEEKGIVYAPDYVINAGGVINVADELLG YNRERAMKKVEGIYDKILKVFEIAKRDGIPSYLAADRMAEERIEMMRKTR STFLQDQRNLINFNNK.
[0076] In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:15, inclusive of the amino acid at position 40, wherein X is not leucine. The amino acid sequence of SEQ ID NO:15 is as follows:
TABLE-US-00011 MELFKYMEKYDYEQLVFCQDEQSGLKAIIAIHDTTLGPAXGGTRMWTYEN EEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFG RYIQGLNGRYITAEDVGTTVEDMDIIHDETDYVTGISPAFGSSGNPSPVT AYGVYRGMKAAAKAAFGTDSLEGKTIAVQGVGNVAYNLCRHLHEEGANLI VTDINKQSVQRAVEDFGARAVDPDDIYSQDCDIYAPCALGATINDDTIKQ LKAKVIAGAANNQLKETRHGDQIHEMGIVYAPDYVINAGGVINVADELYG YNAERALKKVEGIYGNIERVLEISQRDGIPAYLAADRLAEERIERMRRSR SQFLQNGHSVLSRR.
[0077] In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:16, inclusive of the amino acid at position 40, wherein X is not leucine. The amino acid sequence of SEQ ID NO:16 is as follows:
TABLE-US-00012 MELFRYMEQYDYEQLVFCQDKQSGLKAIIAIHDTTLGPAXGGTRMWTYES EEAAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEEMFRAFG RYIQGLNGRYITAEDVGTTVEDMDIIHDETDFVTGISPAFGSSGNPSPVT AYGVYKGMKAAAKAAFGTDSLEGKTVAVQGVGNVAYNLCRHLHEEGAKLI VTDINKEAVERAVAEFGARAVDPDDIYSQECDIYAPCALGATINDDTIPQ LKAKVIAGAANNQLKETRHGDQIHDMGIVYAPDYVINAGGVINVADELYG YNSERALKKVEGIYGNIERVLEISKRDRIPTYLAADRLAEERIERMRQSR SQFLQNGHHILSRR.
[0078] In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least ten (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:17, inclusive of the amino acid at position 40, wherein X is not leucine. The amino acid sequence of SEQ ID NO:17 is as follows:
TABLE-US-00013 MELFKYMETYDYEQVLFCQDKESGLKAIIAIHDTTLGPAXGGTRMWMYNS EEEALEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPRKDKNEAMFRAFG RFIQGLNGRYITAEDVGTTVADMDIIYQETDYVTGISPEFGSSGNPSPAT AYGVYRGMKAAAKEAFGSDSLEGKVVAVQGVGNVAYHLCRHLHEEGAKLI VTDINKEVVARAVEEFGAKAVDPNDIYGVECDIFAPCALGGIINDQTIPQ LKAKVIAGSADNQLKEPRHGDIIHEMGIVYAPDYVINAGGVINVADELYG YNRERAMKKIEQIYDNIEKVFAIAKRDNIPTYVAADRMAEERIETMRKAR SPFLQNGHHILSRRRAR.
[0079] In some embodiments, a variant polypeptide described herein, or a fragment thereof, comprises at least 10 (e.g., at least 11, 12, 13, 14, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 or more) consecutive amino acids of SEQ ID NO:18, inclusive of the amino acid at position 40, wherein X is not leucine. The amino acid sequence of SEQ ID NO:18 is as follows:
TABLE-US-00014 MEIFKYMEKYDYEQLVFCQDEASGLKAIIAIHDTTLGPAXGGARMWTYAT EENAIEDALRLARGMTYKNAAAGLNLGGGKTVIIGDPFKDKNEEMFRALG RFIQGLNGRYITAEDVGTTVTDMDLIHEETNYVTGISPAFGSSGNPSPVT AYGVYRGMKAAAKEAFGTDMLEGRTISVQGLGNVAYKLCEYLHNEGAKLV VTDINQAAIDRVVNDFGATAVAPDEIYSQEVDIFSPCALGAILNDETIPQ LKAKVIAGSANNQLQDSRHGDYLHELGIVYAPDYVINAGGVINVADELYG YNRERALKRVDGIYDSIEKIFEISKRDSIPTYVAANRLAEERIARVAKSR SQFLKNEKNILNGR.
[0080] In some embodiments of any of the variants described herein, X is glycine, isoleucine, alanine, or valine. In some embodiments, X is serine. In some embodiments; X is threonine. In some embodiments, X can be, e.g., glycine, valine, isoleucine, alanine, serine, and threonine.
[0081] In some embodiments, a variant polypeptide described herein, or a fragment thereof, has an amino acid sequence that is at least 80 (e.g., at least 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99)% identical to: (i) amino acids 6 to 238 of SEQ ID NO:2; (ii) amino acids 7 to 237 of SEQ ID NO:13; (iii) amino acids 4 to 236 of SEQ ID NO:14; (iv) amino acids 4 to 236 of SEQ ID NO:15; (v) amino acids 4 to 236 of SEQ ID NO:16; (vi) amino acids 4 to 236 of SEQ ID NO:17; or (vii) amino acids 4 to 236 of SEQ ID NO:18, with the proviso that the variant polypeptide or fragment thereof comprises the amino acid sequence at position X, and X is not leucine. In some embodiments, the variant polypeptide or fragment thereof comprises the amino acid sequence depicted in SEQ ID NO:3, wherein X is not leucine.
[0082] In some embodiments, a variant polypeptide described herein, or a fragment thereof, has an amino acid sequence that is at least 80 (e.g., at least 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99)% identical to: (i) amino acids 6 to 298 of SEQ ID NO:2; (ii) amino acids 7 to 297 of SEQ ID NO:13; (iii) amino acids 4 to 296 of SEQ. ID NO:14; (iv) amino acids 4 to 296 of SEQ ID NO:15; (v) amino acids 4 to 296 of SEQ ID NO:16; (vi) amino acids 4 to 296 of SEQ ID NO:17; or (vii) amino acids 4 to 296 of SEQ ID NO:18, with the proviso that the variant polypeptide or fragment thereof comprises the amino acid sequence at position X; and X is not leucine. In some embodiments, the variant polypeptide or fragment thereof comprises the amino acid sequence depicted in SEQ ID NO:3, wherein X is not leucine.
[0083] Percent (%) amino acid sequence identity is defined as the percentage of amino acids in a candidate sequence that are identical to the amino acids in a reference sequence, after aligning the sequences and introducing gaps, if necessary; to achieve the maximum percent sequence identity. Alignment for purposes of determining percent sequence identity can be achieved in various ways that are within the skill in the art; for instance, using publicly available computer software, such as BLAST software or ClustalW2 (above). Appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared can be determined by known methods.
[0084] Leucine dehydrogenase from B. cereus exists in solution as a homo-octomer, with each subunit folding into two domains, and separated by a deep cleft. See Baker et al. (1995) Current Biol 3:693-705, which describes the crystal structure of leucine dehydrogenase from B. sphaericus (SEQ ID NO:12). The quaternary structure of the complex adopts the shape of a hollow cylinder. Leucine dehydrogenase comprises both a dehydrogenase superfamily domain (e.g., amino acids 10 to 130) and a nicotinamide adenine dinucleotide-cofactor binding domain (e.g., amino acids 150 to 350). In some embodiments, a variant polypeptide or enzymatically-active fragment described herein retains at least 5 (e.g., at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100)% of the ability of the corresponding full-length, wild-type LDH polypeptide from which the variant or fragment was derived to bind to a nucleotide cofactor (e.g., NAD or NADH). Methods for detecting or measuring the interaction between NAD and NAD-dependent enzymes are known in the art and described in, e.g., Kovar and Klukanova (1984) Biochim Biophys Acta 788(1):98-109, and Lesk (1995) Curr Opin Struct Biol 5(6): 775-783.
[0085] As described above, the variant polypeptides described herein, as well as enzymatically-active fragments thereof, possess an enzymatic activity capable of reductive amination of an aliphatic keto acid (e.g., aliphatic 2-keto acids). For example, such polypeptides can convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA, e.g., (S)-LCAA. In some embodiments, a variant polypeptide, or enzymatically-active fragment thereof, retains at least 5 (e.g., at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100)% of the ability of the corresponding full-length, wild-type LDH polypeptide from which the variant or fragment was derived to convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA. In some embodiments, a variant polypeptide, or enzymatically-active fragment thereof, retains at least 5 (e.g., at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100)% of the ability of full-length, wild-type Bacillus cereus LDH octomer complex to convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA, e.g., under the assay conditions described and exemplified in the working examples.
[0086] In some embodiments, a variant polypeptide, or enzymatically-active fragment thereof, possesses enhanced ability to convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA, relative to the activity of full-length, wild-type Bacillus cereus LDH. For example, the variant polypeptide or enzymatically-active fragment thereof can have at least a 5 (e.g., 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100)% greater activity (e.g., reaction rate) than hill-length, wild-type Bacillus cereus LDH to convert 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA. In some embodiments, the activity (e.g., the reaction rate) of the variant polypeptide or enzymatically-active fragment thereof is at least 1.5 (e.g., at least 2, 2.5, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 100, 150, 200, 500, or even 1000) times greater than that of full-length, wild-type Bacillus cereus LDH, e.g., under the conditions described and exemplified in the working examples. Exemplary variant polypeptides exhibiting enhanced activity relative to full-length, wild-type B. cereus LDH include the L42I, L42V, L42G, and L32A variant polypeptides having amino acid sequences: SEQ ID NOs:4, 5, 6, and 20, respectively (see Example 2).
Recombinant Protein Expression and Purification
[0087] The variant polypeptides (or fragments) described herein can be produced using a variety of techniques known in the art of molecular biology and protein chemistry. (See, e.g., Current Protocols in Molecular Biology, Wiley & Sons, and Molecular CloningA Laboratory Manual3rd Ed., Cold Spring Harbor Laboratory Press, New York (2001)). For example, a nucleic acid encoding the variant polypeptide or fragment can be inserted into an expression vector that contains transcriptional and translational regulatory sequences, which include, e.g., promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, transcription terminator signals, polyadenylation signals, and enhancer or activator sequences. The regulatory sequences include a promoter and transcriptional start and stop sequences. In addition, the expression vector can include more than one replication system such that it can be maintained in two different organisms, for example in mammalian or insect cells for expression and in a prokaryotic host for cloning and amplification. In addition, the choice of codons, suitable expression vectors and suitable host cells will vary depending on a number of factors, and may be easily optimized as needed.
[0088] The variant polypeptides or fragments thereof can be produced from the cells by culturing a host cell transformed with the expression vector containing nucleic acid encoding the proteins or fragments, under conditions, and for an amount of time, sufficient to allow expression of the proteins. Such conditions for protein expression will vary with the choice of the expression vector and the host cell, and will be easily ascertained by one skilled in the art through routine experimentation. For example, proteins expressed in E. coli can be refolded from inclusion bodies (see, e.g., Hou et al. (1998) Cytokine 10:319-30). Bacterial expression systems and methods for their use are well known in the art (see Current Protocols in Molecular Biology, Wiley & Sons, and Molecular CloningA Laboratory Manual3rd Ed., Cold Spring Harbor Laboratory Press, New York (2001), supra).
[0089] A number of expression systems for use in prokaryotic host cells have been described, e.g., Terpe et al. (2006) Appl Microbiol Biotechnol 72:211-222. Commonly used expression systems for bacterial host cells (e.g., E. coli) include: the lac promoter, trc and tac promoter systems, T7 systems, phage promoter Pt., tetA promoter/operator, araBAD promoter, and rhaPBAD promoter systems. See, e.g., Polisky et al. (1976) Proc Natl Acad Sci USA 73:3900-3904; De Boer et al. (1983) Proc Natl Acad Sci USA 80:21-25; Brosius et al. (1985) J Biol Chem 260:3539-3541; Amann et al. (1983) Gene 25:167-178; and Quick and Wright (2002) Proc Natl Acad Sci USA 99:8597-8601. Another widely-used bacterial expression system is the pET vector expression system. Studier et al. (1986) J Mol Biol 189:113-130; Dietrich et al. (1991) Eur J Biochem 201:399-407; Lathrop et al. (1992) Protein Expr Purif 3:512-517; and Aukhil et al. (1993) J Biol Chem 268:2542-2553.
[0090] Several possible vector systems are available for the expression of recombinant polypeptides from nucleic acids in mammalian cells. One class of vectors relies upon the integration of the desired gene sequences into the host cell genome. Cells which have stably integrated DNA can be selected by simultaneously introducing drug resistance genes such as E. coli gpt (Mulligan and Berg (1981) Proc Natl Acad Sci USA 78:2072) or Tn5 neo (Southern and Berg (1982) Mol Appl Genet 1:327). The selectable marker gene can be either linked to the DNA gene sequences to be expressed, or introduced into the same cell by co-transfection (Wigler et al. (1979) Cell 16:77). A second class of vectors utilizes DNA elements which confer autonomously replicating capabilities to an extrachromosomal plasmid. These vectors can be derived from animal viruses, such as bovine papillomavirus (Sarver et al. (1982) Proc Natl Acad Sci USA, 79:7147), cytomegalovirus, polyoma virus (Deans et al. (1984) Proc Natl Acad Sci USA 81:1292), or SV40 virus (Lusky and Botchan (1981) Nature 293:79).
[0091] The expression vectors can be introduced into cells in a manner suitable for subsequent expression of the nucleic acid. The method of introduction is largely dictated by the targeted cell type. Exemplary methods include CaPO.sub.4 precipitation, liposome fusion, cationic liposomes, electroporation, viral infection, dextran-mediated transfection, polybrene-mediated transfection, protoplast fusion, and direct microinjection.
[0092] Appropriate host cells for the expression of recombinant proteins include yeast, bacteria, insect, plant, and mammalian cells. Of particular interest are bacteria such as E. coli, fungi such as Saccharomyces cerevisiae and Pichia pastoris, insect cells such as SF9, mammalian cell lines (e.g., human cell lines), as well as primary cell lines. In addition to E. coli, other commonly-used prokaryotic host cells include bacilli strains B. megaterium, B. subtilis, B. brevis, and Caulohacter crescentus.
[0093] A variant polypeptide or fragment thereof described herein can be expressed in mammalian cells or in other expression systems including but not limited to yeast, baculovirus, and even in vitro expression systems (see, e.g., Kaszubska et al. (2000) Protein Expression and Purification 18:213-220).
[0094] Following expression, the recombinant proteins can be isolated. The term purified or isolated as applied to any of the proteins described herein refers to a polypeptide that has been separated or purified from components (e.g., proteins or other naturally-occurring biological or organic molecules) which naturally accompany it, e.g., other proteins, lipids, and nucleic acid in a prokaryotic or eukaryotic cell expressing the proteins. Typically, a polypeptide is purified when it constitutes at least 60 (e.g., at least 65, 70, 75, 80, 85, 90, 92, 95, 97, or 99)%, by weight, of the total protein in a sample.
[0095] The recombinant proteins can be isolated or purified in a variety of ways known to those skilled in the art depending on what other components are present in the sample. Standard purification methods include electrophoretic, molecular, immunological, and chromatographic techniques, including ion exchange, hydrophobic, affinity, and reverse-phase HPLC chromatography. Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. See, e.g., Scopes (1994) Protein Purification, 3.sup.rd edition, Springer-Verlag, New York City, N.Y. The degree of purification necessary will vary depending on the desired use. In some instances, no purification of the expressed proteins will be necessary.
[0096] Methods for determining the yield or purity of a purified protein are known in the art and include, e.g., Bradford assay, UV spectroscopy, Biuret protein assay, Lowry protein assay, amido black protein assay, high performance liquid chromatography (HPLC), mass spectrometry (MS), and gel electrophoretic methods (e.g., using a protein stain such as Coomassie Blue or colloidal silver stain).
[0097] Exemplary methods for producing, expressing, and isolating a LDH from E. coli are exemplified in the working examples. Additional methods for producing a recombinant LDH (e.g., recombinant LDH from B. sphaericus) are described in, e.g., Li et al. (2009) Appl Biochem Biotechnol 158:343-351.
Applications
[0098] The variant polypeptides and enzymatically-active fragments thereof are useful in a number of applications. For example, the polypeptides and fragments can be used as control enzymes in screening methods designed to identify additional variant polypeptides and fragments capable of converting 2-oxonon-8-enoic acid, in the presence of an ammonia source, to LCAA, e.g., (S)-LCAA. Such methods would include, optionally, generating one or more (e.g., a library of) test variant leucine dehydrogenase polypeptides (e.g., substitution, insertion, or deletion variants of any one of SEQ ID NOs:1, 2, or 4-18). Methods for generating test variant polypeptides are described herein (supra) and exemplified in the working examples. The test variant polypeptides can be screened, e.g., using the LCAA production reaction described in Examples 1 and 2 below.
[0099] In addition, the variant polypeptides and enzymatically-active fragments thereof described herein are useful as enzyme catalysts for the conversion of 2-oxonon-8-enoic acid to (S)-LCAA. Such methods are described herein and exemplified in the working examples.
Kits
[0100] Also provided herein are kits containing one or more of the variant polypeptides or enzymatically-active fragments thereof and, optionally, instructions for carrying out a reaction to aminate an aliphatic keto acid. The variant polypeptides or fragments can be provided in solution, e.g., aqueous solution, or in lyophilized form. In the latter case, the kit can optionally include one or more buffers for reconstituting the lyophilized protein.
[0101] In some embodiments, the kits can include nicotinamide adenine dinucleotide (NAD), e.g., a reduced form of NAD and, optionally, appropriate reaction buffers. In some embodiments, the kits can include glucose. In some embodiments, the kits can further include a glucose dehydrogenase.
EXAMPLES
[0102] The following examples are intended to illustrate, not limit, the disclosure.
Example 1. Production of 2-aminonon-8-enoic Acid (LCAA) Using Leucine Dehydrogenase
[0103] E. coli cells were transformed with an expression vector encoding wild-type, B. cereus leucine dehydrogenase (LDH; having the amino acid sequence depicted in SEQ ID NO:1). LDH protein was expressed at 37 C. using standard molecular biology techniques. Briefly, seed cultures of 10 mL of LB media with 50 g/mL ampicillin were inoculated with frozen cell stocks of E. coli containing the expression vector. The cultures were incubated at 37 C. and 250 rpm overnight. Expression cultures were inoculated with the seed culture at a 1:200 dilution and grown at 37 C. and 250 rotations per minute (rpm) until the culture reached an OD.sub.600 of 0.5, at which time they were induced with 0.5 L of 0.2 M IPTG. After induction, cultures were incubated at 37 C. for 18-24 hours.
[0104] Following expression, cultures were harvested by centrifugation (14,000 rpm for 3 min) and resuspended with 1/10th the original culture volume in B-PER Protein Extraction Reagent (Thermo Scientific, Rockford, Ill.). Alternatively, cell cultures could also be lysed by resuspension in buffer (i.e. 0.1 M phosphate buffer pH 7) followed by sonication. The resulting cell lysate was clarified by centrifugation at 14,000 rpm for 3 min. The supernatant was reserved as the cell-free extract LDH enzyme solution.
[0105] To produce (S)-LCAA from 2-oxonon-8-enoic acid, a reaction was performed under the following conditions. In 200 mL total volume and a buffered pH of 9.5, the aqueous reaction mixture contained 10 mM 2-oxonon-8-enoic acid, 12 mM glucose, 1 mM NAD.sup.+, 50 mg of purified glucose dehydrogenase (GDH-105; Codexis, Redwood City, Calif.), 2 M NH.sub.4Cl/OH, and approximately 60 mL/L of purified leucine dehydrogenase cell-free extract.
[0106] To determine what percentage of the LCAA reaction product of the reaction was (S)-LCAA, aliquots of the reaction mixture were analyzed using high performance liquid chromatography (HPLC). As shown in
Example 2. Exemplary Variant B. cereus LDH Polypeptides
[0107] To increase the affinity of LDH for the 2-oxonon-8-enoic acid substrate and, thus, enhance the enzyme's activity for producing (S)-LCAA, amino acid substitutions were made within the region of LDH that binds to the substrate. Specifically, amino acid substitutions were introduced at position 42 of B. cereus leucine dehydrogenase (SEQ ID NO:1) using standard mutagenesis techniques. Wild-type B. cereus LDH, along with 19 variants (one for each amino acid substitution at position 42) were expressed and isolated as described in Example 1. The enzymatic activity of the variant proteins was evaluated alongside wild-type B. cereus LDH in the reaction described in Example 1. As shown in
[0108] While the present disclosure has been described with reference to the specific embodiments thereof, it should be understood by those skilled in the art that various changes may be made and equivalents may be substituted without departing from the true spirit and scope of the disclosure. In addition, many modifications may be made to adapt a particular situation, material, composition of matter, process, process step or steps, to the objective, spirit and scope of the present disclosure. All such modifications are intended to be within the scope of the disclosure.