SURFACE, ANCHORED FC-BAIT ANTIBODY DISPLAY SYSTEM

20190040118 ยท 2019-02-07

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention provides, in part, an antibody display system that simultaneously uses a secretion and a display mode. A bait complexed with a monovalent antibody fragment can be expressed on the surface of the host cell wherein the fragment may be assayed for antigen binding while full antibody is simultaneously secreted from the host cell. Methods of using the system for identifying antibodies that bind specifically to an antigen of interest are also provided. Polypeptides, polynucleotides and host cells useful for making the antibody display system are also provided along with methods of use thereof.

Claims

1-20. (canceled)

21. A method for making an antibody display system comprising: (a) an isolated eukaryotic host cell; (b) a bait comprising a human Fc immunoglobulin domain fused to a surface anchor polypeptide; (c) one or more polynucleotides encoding an immunoglobulin light chain variable region; (d) one or more polynucleotides encoding an immunoglobulin heavy chain variable region; comprising introducing, into said eukaryotic host cell, a polynucleotide encoding said bait, said one or more polynucleotides encoding an immunoglobulin light chain variable region; and said one or more polynucleotides encoding an immunoglobulin heavy chain variable region.

22. A method for making an antibody or antigen-binding fragment thereof comprising introducing, into an isolated eukaryotic host cell comprising a bait that includes a human Fc immunoglobulin domain or functional fragment thereof fused to a surface anchor polypeptide or functional fragment thereof, one or more polynucleotides encoding an immunoglobulin light chain variable region; and/or one or more polynucleotides encoding an immunoglobulin heavy chain variable region; and culturing the host cell under condition whereby the polynucleotides encoding the immunoglobulin chains are expressed and an antibody or antigen-binding fragment thereof is formed from said chains; wherein said bait is operably associated with a regulatable promoter and bait expression is inhibited when said immunoglobulin chains are expressed.

23. A method for making an antibody or antigen binding fragment thereof comprising culturing an isolated eukaryotic host cell in a growth medium under conditions allowing expression of an immunoglobulin light chain and an immunoglobulin heavy chain of said antibody or fragment; wherein the eukaryotic host cell comprises: (i) a polynucleotide encoding said immunoglobulin light chain; and a polynucleotide encoding said immunoglobulin heavy chain of said antibody or fragment; and (ii) a bait comprising an Fc immunoglobulin domain or functional fragment thereof fused to a surface anchor polypeptide or functional fragment thereof on the surface of said eukaryotic host cell; wherein the Fc of said bait complexes with an Fc/antigen-binding fragment comprising said immunoglobulin heavy and immunoglobulin light chains on the surface of the host cell; and wherein the expression of the bait is optionally inhibited; wherein said antibody or fragment is optionally secreted from said eukaryotic host cell; optionally comprising isolating said antibody or fragment from said eukaryotic host cell and medium.

24. A method for determining the effect of a sugar on an antibody or antigen-binding fragment thereof which specifically binds to an antigen comprising contacting an antibody display system with said antigen; wherein the antibody display system comprises: (a) an isolated eukaryotic controlled glycosylation host cell comprising a polynucleotide encoding an immunoglobulin light chain; and a polynucleotide encoding an immunoglobulin heavy chain; and (b) a bait comprising an Fc immunoglobulin domain or functional fragment thereof fused to a surface anchor polypeptide or functional fragment thereof on the surface of said eukaryotic host cell; wherein the Fc of said bait complexes with an Fc/antigen-binding fragment comprising said immunoglobulin heavy and immunoglobulin light chains on the surface of the host cell; wherein said heavy or light chain comprises said sugar; determining if said Fc/antigen-binding fragment specifically binds to said antigen; determining the binding affinity of the antibody or antigen-binding fragment thereof comprising said sugar for the antigen; and comparing the affinity of the antibody or antigen-binding fragment thereof with affinity of an otherwise identical antibody or antigen-binding fragment thereof which lacks said sugar; wherein the sugar is determined to increase affinity for the antigen if the affinity of the antibody or antigen-binding fragment thereof comprising said sugar is higher than the affinity of the antibody or antigen-binding fragment thereof which lacks the sugar, and/or wherein the sugar is determined to decrease affinity for the antigen if the affinity of antibody or antigen-binding fragment thereof comprising said sugar is lower than the affinity of the antibody or antigen-binding fragment thereof which lacks the sugar.

Description

BRIEF DESCRIPTION OF THE FIGURES

[0022] FIG. 1 shows the antibody display system of the present invention and a method of use thereof. Polynucleotide encoding an antibody and bait are co-expressed in Pichia pastoris. The polynucleotide encoding one or both of the antibody immunoglobulin chains can be from a library or can be from a single clonal source. The Pichia cell expresses the bait on the cell surface, some of such baits are bound by a monovalent antibody fragment (comprising one heavy and one light chain) of the antibody that is also expressed. Some expressed antibody escapes bait binding and is, thus, soluble. Expression of the antibody on the cell can be confirmed by FACS analysis and a titer of the cellular antibody expression level can also be determined. The bait expression is turned off or the polynucleotide encoding the bait is evicted (or knocked-out) from the cell. The resulting cell expresses only the polynucleotide encoding the antibody heavy and light chains and produces only full soluble antibody. Cellular expression levels of the antibody can then be confirmed and a determination of the antibody affinity can also be performed.

[0023] FIG. 2 shows a map of plasmid pGLY9008. The Homo sapiens Fc fused to Saccharomyces cerevisiae SED1 is driven by a Pichia pastoris AOX1 promoter.

[0024] FIGS. 3a-3c. FIG. 3a shows an ELISA measuring the concentration of Kappa light chain was used to determine the concentration of secreted antibodies from the strains explained in Table 1. Lane 1 was serially diluted ELISA standard; Lanes 2-3 contained material generated by strains in Table 1 without the surface anchored Fc bait (SAFB); Lanes 5-10 contained the same strains plus SAFB. Y8316 did not express antibodies and was used as a negative control. FIG. 3b shows supernatants generated by the strains shown in FIG. 3a run on Protein A columns to capture secreted antibodies. In FIG. 3c eluted IgGs were run on (c) non-reducing SDS-PAGE.

[0025] FIGS. 4a-4c show FACS data demonstrating the different fluorescence intensities observed between various Pichia pastoris strains. FIG. 4a shows parental strains expressing anti-HER2 and anti-PCSK9 with no Fc-SEDT bait; FIG. 4b shows anti-Her2 displaying cells with and without the bait; FIG. 4c shows anti-PCSK9 displaying cells with and without bait

[0026] FIG. 5 shows FACS analysis of labeled Pichia pastoris yeast strains YGLY21610 and YGLY21614 displaying an Fc-Sed1p complexed with an anti-PCSK9 monovalent antibody fragment (H+L) or an anti-Her2 (H+L) monovalent antibody fragment. The cells were dually labeled with goat anti-human Fc Alexa 488, biotinylated PCSK9, and APC 635 labeled Streptavidin. The cells were analyzed separately (left and middle panels, respectively) and mixed together in a 1:00 ratio (right panel). The points representing the YGLY21610 cells in the right panel are circled.

[0027] FIG. 6 shows FACS analysis of Pichia pastoris cells expressing the Fc-SEDT bait and; (1) anti-PCSK9 antibody AX189 heavy and light chains (Anti-PCSK9; AX189-Fc-Sed1p); or (2) AX189 light chain and heavy chain from the BP550 library (BP550-Fc-Sed1p); or (3) AX189 heavy chain and light chain from the BP551 library (BP551-Fc-Sed1p). The left panel shows data relating to unsorted strains containing the library, and the right panel shows data relating to cells containing the library that were sorted once or twice. FACS data relating to the control AX189 expressing cells are also shown.

[0028] FIG. 7a and FIG. 7b show PCSK9 and Kappa ELISA analysis of presorted BP550 and BP551 library and round 2 sorted pools thereof, respectively.

[0029] FIG. 8 shows the use of Fc-Sed1p display to discover novel heterodimeric Fc fragments for use in bispecifics and other applications. In this approach, an Fc mutant that lost its ability to homodimerize with self or heterodimerize with wild-type Fc can be displayed on a cell surface (A) and co-expressed with a library of H+L mutations where Fab region remains constant but CH2 and/or CH3 domains are mutated (B). Using surface display binding to Fab, cells that are positive for antigen binding can be isolated using FACS (C). Those cells will contain novel Fc variants that restore dimerization to the displayed bait-Fc. The culture supernatants can be assayed by SDS-PAGE to ensure monomeric secretion H+L containing the novel Fc (D). This exercise will result in identification of novel heterodimeric Fc pairs or partners that can be subject to subsequent engineering using the same assay (E).

DETAILED DESCRIPTION OF THE INVENTION

[0030] The present invention provides a method and system for antibody surface display that simultaneously features a display mode and full antibody secretion mode. Host cells secrete full antibody and display Fc/antigen-binding fragments on the cell surface. This method utilizes an Fc fusion (e.g., fused at the N- or C-terminus) with a cell surface protein as bait that is covalently coupled to the cell surface (e.g., the cell wall) or embedded (partially or fully) in the cell membrane (e.g., as a transmembrane protein) and that is co-expressed with an antibody (e.g., a single specific antibody from a clonal source or an antibody from a library). In the endoplasmic reticulum, where antibody molecules normally dimerize to form the full antibody molecule, a surface anchored Fc fusion bait heterodimerizes with a monovalent antibody fragment creating a complex that is displayed on the cell surface. Monovalent antibody fragments on the cell surface can bind antigen.

[0031] The antibody system of the present invention can be employed in any host cell (e.g., yeast, mammalian cells, bacteria) wherein a bait can be expressed on the host cell surface and an Fc/antigen-binding fragment can bind to the bait.

[0032] Homodimerization of full antibody still occurs allowing secretion of full antibody molecules into the culture supernatant. The secreted full antibody can be used, e.g., for preclinical studies, e.g., after isolation.

[0033] If desired, bait can be knocked-out or mutated or its expression can be turned off to create a strain producing only the full antibody.

Molecular Biology

[0034] In accordance with the present invention there may be employed conventional molecular biology, microbiology, and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Sambrook, Fritsch & Maniatis, Molecular Cloning: A Laboratory Manual, Second Edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (herein Sambrook, et al., 1989); DNA Cloning: A Practical Approach, Volumes I and II (D. N. Glover ed. 1985); Oligonucleotide Synthesis (M. J. Gait ed. 1984); Nucleic Acid Hybridization (B. D. Hames & S. J. Higgins eds. (1985)); Transcription And Translation (B. D. Hames & S. J. Higgins, eds. (1984)); Animal Cell Culture (R. I. Freshney, ed. (1986)); Immobilized Cells And Enzymes (IRL Press, (1986)); B. Perbal, A Practical Guide To Molecular Cloning (1984); F. M. Ausubel, et al. (eds.), Current Protocols in Molecular Biology, John Wiley & Sons, Inc. (1994).

[0035] A library is, typically, a collection of related but diverse polynucleotides that are, in general, in a common vector backbone. For example, a light chain or heavy chain immunoglobulin library may contain polynucleotides, in a common vector backbone, that encode light and/or heavy chain immunoglobulins which are diverse but related in their nucleotide sequence; for example, which immunoglobulins are functionally diverse in their abilities to form complexes with other immunoglobulins, e.g., in an antibody display system of the present invention, and bind a particular antigen.

[0036] A coding sequence is under the control of, functionally associated with or operably associated with transcriptional and translational control sequences in a cell when the sequences direct RNA polymerase mediated transcription of the coding sequence into RNA, preferably mRNA, which then may be spliced (if it contains introns) and translated into a protein encoded by the coding sequence. Thus, a bait gene can be operably associated with a promoter, such as a regulatable promoter or a constitutive promoter.

[0037] Polynucleotides discussed herein form part of the present invention. A polynucleotide, nucleic acid or nucleic acid molecule include DNA and RNA, single or double stranded.

[0038] Polynucleotides e.g., encoding an immunoglobulin chain or component of the antibody display system of the present invention (e.g., a bait), may, in an embodiment of the invention, be flanked by natural regulatory (expression control) sequences, or may be associated with heterologous sequences, including promoters, internal ribosome entry sites (IRES) and other ribosome binding site sequences, enhancers, response elements, suppressors, signal sequences, polyadenylation sequences, introns, 5- and 3- non-coding regions, and the like.

[0039] Polynucleotides e.g., encoding an immunoglobulin chain or component of the antibody display system of the present invention, may be operably associated with a promoter. A promoter or promoter sequence is, in an embodiment of the invention, a DNA regulatory region capable of binding an RNA polymerase in a cell (e.g., directly or through other promoter-bound proteins or substances) and initiating transcription of a coding sequence. A promoter sequence is, in general, bounded at its 3 terminus by the transcription initiation site and extends upstream (5 direction) to include the minimum number of bases or elements necessary to initiate transcription at any level. Within the promoter sequence may be found a transcription initiation site (conveniently defined, for example, by mapping with nuclease S1), as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase. The promoter may be operably associated with other expression control sequences, including enhancer and repressor sequences or with a nucleic acid of the invention. Promoters which may be used to control gene expression include, but are not limited to, cytomegalovirus (CMV) promoter (U.S. Pat. Nos. 5,385,839 and 5,168,062), the SV40 early promoter region (Benoist, et al., (1981) Nature 290:304-310), the promoter contained in the 3 long terminal repeat of Rous sarcoma virus (Yamamoto, et al., (1980) Cell 22:787-797), the herpes thymidine kinase promoter (Wagner, et al., (1981) Proc. Natl. Acad. Sci. USA 78:1441-1445), the regulatory sequences of the metallothionein gene (Brinster, et al., (1982) Nature 296:39-42); prokaryotic expression vectors such as the -lactamase promoter (Villa-Komaroff, et al., (1978) Proc. Natl. Acad. Sci. USA 75:3727-3731), or the tac promoter (DeBoer, et al., (1983) Proc. Natl. Acad. Sci. USA 80:21-25); see also Useful proteins from recombinant bacteria in Scientific American (1980) 242:74-94; and promoter elements from yeast or other fungi such as the Gal 4 promoter, the ADC (alcohol dehydrogenase) promoter, PGK (phosphoglycerol kinase) promoter or the alkaline phosphatase promoter.

[0040] The terms vector, cloning vector and expression vector include a vehicle (e.g., a plasmid) by which a DNA or RNA sequence can be introduced into a host cell, so as to transform the host and, optionally, promote expression and/or replication of the introduced sequence. Polynucleotides encoding an immunoglobulin chain or component of the antibody display system of the present invention (e.g., a bait) may, in an embodiment of the invention, be in a vector.

[0041] A host cell that may be used in a composition or method of the present invention, as is discussed herein, includes eukaryotes such a lower and higher eukaryotic cells as well as prokaryotics. Higher eukaryote cells include mammalian, insect (e.g., Spodoptera frugiperda cells), and plant cells (e.g., Protalix cells). In an embodiment of the invention, the host cell is a lower eukaryote such as a yeast or filamentous fungi cell, which, for example, is selected from the group consisting of any Pichia cell, Pichia pastoris, Pichia flnlandica, Pichia trehalophila, Pichia koclamae, Pichia membranaefaciens, Pichia minuta (Ogataea minuta, Pichia lindneri), Pichia opuntiae, Pichia thermotolerans, Pichia salictaria, Pichia guercuum, Pichia pijperi, Pichia stiptis, Pichia methanolica, Pichia, Saccharomyces cerevisiae, Saccharomyces, Hansnula polymorpha, Kluyveromyces, Kluyveromyces lactis, Candida albicans, Aspergillus nidulans, Aspergillus niger, Aspergillus oryzae, Trichoderma reesei, Chrysosporium lucknowense, Fusarium, Fusa{acute over ()}um gramineum, Fusarium venenatum and Neuraspora crassa. A higher eukaryotic host cell includes a mammalian host cell for example a Chinese hamster ovary (CHO) cell, a BHK cell, or an NSO cell. A prokaryotic host cell can be, for example, a bacterial cell such as Escherichia, Enterobacter, Azotobacter, Erwinia, Bacillus, Pseudomonas, Klebsiella, Proteus, Salmonella, Serratia, Shigella, Rhizobia, Vitreoscilla, and Paracoccus. E. coli host cells include DHB4, BL21 (which are deficient in both Lon (Phillips et al. (1984) J. Bacteriol. 159: 283) and OmpT proteases), HB101, BL21 DE3, E. coli AD494, E. coli W3110 (ATCC 27,325), E. coli 294 (ATCC 31,446), E. coli B, and E. coli X1776 (ATCC 31,537). Other strains include E. coli B834 which are methionine deficient (Leahy et al. (1992) Science 258, 987); other strains include the BLR strain, and the K-12 strains HMS174 and NovaBlue, which are recA-derivative that improve plasmid monomer yields and may help stabilize target plasmids containing repetitive sequences (these strains can be obtained from Novagen). See also U.S. Pat. Nos. 4,952,496, 5,693,489 and 5,869,320 and in Davanloo, P., et al., (1984) Proc. Natl. Acad. Sci. USA 81, 2035-2039; Studier, F. W., et al., (1986) J. Mol. Biol. 189: 113-130; Rosenberg, A. H., et al., (1987) Gene 56: 125-135; and Dunn, J. J., et al., (1988) Gene 68: 259. Prokaryotic cells can also be cultured, for example, in a medium under conditions allowing for recombinant expression of a polypeptide, such as an immunoglobulin polypeptide and/or a bait. Such methods and host cells comprising such genes and proteins are part of the present invention. A prokaryotic host cell can also be used as a host cell in the antibody display system of the present invention, as discussed herin.

[0042] As used herein, the terms N-glycan and glycoform are used interchangeably and refer to an N-linked oligosaccharide, e.g., one that is attached by an asparagine-N-acetylglucosamine linkage to an asparagine residue of a polypeptide. N-linked glycoproteins contain an N-acetylglucosamine residue linked to the amide nitrogen of an asparagine residue in the protein. Predominant sugars found on glycoproteins are glucose, galactose, mannose, fucose, N-acetylgalactosamine (GalNAc), N-acetylglucosamine (GlcNAc) and sialic acid (e.g., N-acetyl-neuraminic acid (NANA)).

[0043] N-glycans have a common pentasaccharide core of Man.sub.3GlcNAc.sub.2 (Man refers to mannose; Glc refers to glucose; and NAc refers to N-acetyl; GlcNAc refers to N- acetylglucosamine). N-glycans differ with respect to the number of branches (antennae) comprising peripheral sugars (e.g., GlcNAc, galactose, fucose and sialic acid) that are added to the Man.sub.3GlcNAc.sub.2 (Man.sub.3) core structure which is also referred to as the triammnose core, the pentasaccharide core or the paucimannose core. N-glycans are classified according to their branched constituents (e.g., high mannose, complex or hybrid). A high mannose type N-glycan has five or more mannose residues. A complex type N-glycan typically has at least one GlcNAc attached to the 1,3 mannose arm and at least one GlcNAc attached to the 1,6 mannose arm of a trimannose core. Complex N-glycans may also have galactose (Gal) or N- acetylgalactosamine (GalNAc) residues that are optionally modified with sialic acid or derivatives (e.g., NANA or NeuAc, where Neu refers to neuraminic acid and Ac refers to acetyl). Complex N-glycans may also have intrachain substitutions comprising bisecting GlcNAc and core fucose (Fuc). Complex N-glycans may also have multiple antennae on the trimannose core, often referred to as multiple antennary glycans. A hybrid N-glycan has at least one GlcNAc on the terminal of the 1,3 mannose arm of the trimannose core and zero or more mannoses on the 1,6 mannose arm of the trimannose core. The various N-glycans are also referred to as glycoforms. PNGase, or glycanase or glucosidase refer to peptide N-glycosidase F (EC 3.2.2.18).

[0044] In an embodiment of the invention, O-glycosylation of glycoproteins in a eukaryotic host cell is controlled. The scope of the present invention includes isolated eukaryotic host cells (e.g., Pichia pastoris) wherein O-glycosylation is controlled (as discussed herein) as well as antibody display systems comprising such eukaryotic host cells and methods of use thereof (as discussed herein). For example, wherein O-glycan occupancy and mannose chain length are reduced. In lower eukaryote host cells such as yeast, O-glycosylation can be controlled by deleting the genes encoding one or more protein O-mannosyltransferases (Dol-PMan: Protein (Ser/Thr) Mannosyl Transferase genes) (PMTs) or by growing the host in a medium containing one or more Pmtp inhibitors. Thus, the present invention includes isolated eukaryotic host cells, antibody display systems and methods of use thereof (as is discussed herein), e.g., comprising a deletion of one or more of the genes encoding PMTs, and/or, e.g., wherein the host cell can be cultivated in a medium that includes one or more Pmtp inhibitors. Pmtp inhibitors include but are not limited to a benzylidene thiazolidinedione. Examples of benzylidene thiazolidinediones are 5-[[3,4bis(phenylmethoxy) phenyl]methylene]-4-oxo-2-thioxo-3-thiazolidineacetic Acid; 5-[[3-(1-25 Phenylethoxy)-4-(2-phenylethoxy)]phenyl]methylene]-4-oxo-2-thioxo-3-thiazolidineacetic Acid; and 5-[ [3-(1-Phenyl-2-hydroxy)ethoxy)-4-(2-phenylethoxy)]phenyl]methylene]-4-oxo-2-thioxo3-thiazolidineacetic acid.

[0045] In an embodiment of the invention, a eukaryotic host cell includes a nucleic acid that encodes an alpha-1,2-mannosidase that has a signal peptide that directs it for secretion. For example, in an embodiment of the invention, the host cell is engineered to express an exogenous alpha-1,2-mannosidase enzyme having an optimal pH between 5.1 and 8.0, preferably between 5.9 and 7.5. In an embodiment of the invention, the exogenous enzyme is targeted to the endoplasmic reticulum or Golgi apparatus of the host cell, where it trims N-glycans such as Man.sub.8GlcNAc.sub.2 to yield Man.sub.5GlcNAc.sub.2. See U.S. Pat. No. 7,029,872.

[0046] The scope of the present invention includes such an isolated eukaryotic host cell (e.g., Pichia pastoris) as well as antibody display systems comprising such eukaryotic host cells and methods of use thereof (as discussed herein).

[0047] Eukaryotic host cells are, in an embodiment of the invention, lower eukaryote cells (e.g., yeast such as Pichia pastoris) that are genetically engineered to eliminate glycoproteins having alpha-mannosidase-resistant N-glycans by deleting or disrupting one or more of the beta-mannosyltransferasegenes (e.g., BMT1, BMT2, BMT3, and BMT4)(See, U.S. Published Patent Application No. 2006/0211085) or abrogating translation of RNAs encoding one or more of the beta-mannosyl transferases using interfering RNA, antisense RNA, or the like. The scope of the present invention includes such an isolated eukaryotic host cell (e.g., Pichia pastoris) as well as antibody display systems comprising such eukaryotic host cells and methods of use thereof (as discussed herein).

[0048] Eukaryotic host cells also include lower eukaryote cells (e.g., yeast and filamentous fungi such as Pichia pastoris) that are genetically engineered to eliminate glycoproteins having phosphomannose residues, e.g., by deleting or disrupting one or both of the phosphomannosyl transferase genes PNO1 and MNN4B (See for example, U.S. Pat. Nos. 7,198,921 and 7,259,007), which can include deleting or disrupting the MNN4A gene or abrogating translation of RNAs encoding one or more of the phosphomannosyltransferases using interfering RNA, antisense RNA, or the like. In an embodiment of the invention, a eukaryotic host cell has been genetically modified to produce glycoproteins that have predominantly an N-glycan selected from the group consisting of complex N-glycans, hybrid N-glycans, and high mannose N-glycans wherein complex N-glycans are, in an embodiment of the invention, selected from the group consisting of Man.sub.3GlcNAc.sub.2, GlcNAC.sub.(1-4)Man.sub.3GlcNAc.sub.2, NANA.sub.(1-4)GlcNAc.sub.(1-4)Man.sub.3GlcNAc.sub.2, and NANA.sub.(1-4)Gal.sub.(1-4)Man.sub.3GlcNAc.sub.2; hybrid N-glycans are, in an embodiment of the invention, selected from the group consisting of Man.sub.5GlcNAc.sub.2, GlcNAcMan.sub.5GlcNAc.sub.2, GalGlcNAcMan.sub.5GlcNAc.sub.2, and NANAGalGlcNAcMan.sub.5GlcNAc.sub.2; and high mannose N-glycans are, in an embodiment of the invention, selected from the group consisting of Man.sub.6GlcNAc.sub.2, Man.sub.7GlcNAc.sub.2, Mang.sub.81cNAc.sub.2, and Man.sub.9GlcNAc.sub.2. The scope of the present invention includes such an isolated eukaryotic host cell (e.g., Pichia pastoris) as well as antibody display systems comprising such eukaryotic host cells and methods of use thereof (as discussed herein).

[0049] As used herein, the term essentially free of as it relates to lack of a particular sugar residue, such as fucose, or galactose or the like, on a glycoprotein, is used to indicate that the glycoprotein composition is substantially devoid of N-glycans which contain such residues. Expressed in terms of purity, essentially free means that the amount of N-glycan structures containing such sugar residues does not exceed 10%, and preferably is below 5%, more preferably below 1%, most preferably below 0.5%, wherein the percentages are by weight or by mole percent.

[0050] As used herein, a glycoprotein composition lacks or is lacking a particular sugar residue, such as fucose or galactose, when no detectable amount of such sugar residue is present on the N-glycan structures. For example, in preferred embodiments of the present invention, the glycoprotein compositions are produced by lower eukaryotic organisms, as discussed herein, and will lack fucose, because the cells of these organisms do not have the enzymes needed to produce fucosylated N-glycan structures. Thus, the term essentially free of fucose encompasses the term lacking fucose. However, a composition may be essentially free of fucose even if the composition at one time contained fucosylated N-glycan structures or contains limited, but detectable amounts of fucosylated N-glycan structures as described above.

[0051] For example, a host cell which introduces, eliminates or modifies sugar residues on an immunoglobulin expressed in the host cell, e.g., as is discussed herein, may, in certain instances, be referred to herein as a controlled glycosylation host cell.

[0052] Fluorescence-activated cell sorting (FACS) is a specialized type of flow cytometry. It provides a method for sorting a heterogeneous mixture of biological cells into two or more containers, one cell at a time, based upon the specific light scattering and fluorescent characteristics of each cell. During the cell sorting process, the cell suspension is entrained in the center of a narrow, rapidly flowing stream of liquid. The flow is arranged so that there is a separation between cells relative to their diameter. A vibrating mechanism causes the stream of cells to break into individual droplets. The system is adjusted so that there is a low probability of more than one cell per droplet. Just before the stream breaks into droplets, the flow passes through a fluorescence measuring station where the fluorescent character of interest of each cell is measured. An electrical charging ring is placed just at the point where the stream breaks into droplets. A charge is placed on the ring based on the immediately-prior fluorescence intensity measurement, and the opposite charge is trapped on the droplet as it breaks from the stream. The charged droplets then fall through an electrostatic deflection system that diverts droplets into containers based upon their charge. In some systems, the charge is applied directly to the stream, and the droplet breaking off retains charge of the same sign as the stream. The stream is then returned to neutral after the droplet breaks off. The present invention encompasses methods of using the antibody display system of the present invention, e.g., as discussed herein, wherein the eukaryotic host cells that are bound to an antigen of interest (by the Fc/antigen-binding fragment) are sorted from unbound cells or cells without sufficient levels of binding, by FACS sorting, based on whether the cells are labeled with a detectable fluorescent label (e.g., wherein the antigen itself or a secondary antibody is labeled). Such sorted labeled host cells and compositions comprising such sorted labeled host cells are also part of the present invention.

[0053] A regulatable promoter is a promoter whose expression can be induced or inhibited. Embodiments of the invention include the antibody display system wherein expression of the bait is controlled by a regulatable promoter as well as methods of use thereof as discussed herein. Polynucleotides encoding the bait, operably associated with a regulatable promoter also form part of the present invention along with isolated eukaryotic host cells including the polynucleotides. Examples of regulatable promoters that occur in yeast include the GUT1 promoter, GADPH promoter and the PCK1 promoter.

[0054] In an embodiment of the invention, expression of a polynucleotide (e.g., the bait) in a eukaryotic host cell (e.g., a bait) is inhibited by exposing the cells to anti-sense RNA or by RNA interference (e.g., microRNA (miRNA) or small interfering RNA (siRNA)). Embodiments of the invention include methods of using antibody display system (e.g., as discussed herein) wherein expression of the bait is inhibited by RNA interference or anti-sense RNA. Isolated eukaryotic host cells of the present invention (e.g., as discussed herein) comprising bait and further comprising an anti-sense or RNA interference molecule that inhibits bait expression are part of the present invention.

Antibodies

[0055] Antibodies or antigen-binding fragments thereof identified in connection with use of the present invention (e.g., use of the antibody display system of the present invention) may be reformatted into any suitable form. For example, CDRs from a full antibody isolated using the antibody display system can be incorporated into a different framework (e.g., a human framework) to generate a distinct antibody or antigen-binding fragment comprising the CDRs isolated from the antibody display system of the present invention. Methods for producing chimeric, humanized and human antibodies are well known in the art. See, e.g., U.S. Pat. No. 5,530,101, issued to Queen et al., U.S. Pat. No. 5,225,539, issued to Winter et al., U.S. Pat. No. 4,816,397 issued to Boss et al. Such methods for reformatting an antibody or antigen-binding fragment or for relocating CDRs from one framework to another are conventional and well known in the art. For example, the CDRs of an antibody or antigen-binding fragment can be used to generate monoclonal antibodies, polyclonal antibodies, bispecific antibodies, chimeric antibodies, recombinant antibodies, anti-idiotypic antibodies, humanized antibodies and bispecific antibodies; or antigen-binding fragments thereof such as nanobodies, Fab, Fab, F(ab).sub.2, Fv fragments; dsFv; (dsFv).sub.2, ds diabodies; dsFv-dsFv; single-chain antibody molecules, e.g., sc-Fv, sc-Fv dimers (bivalent diabodies); and bispecific diabodies.

[0056] A full antibody comprises a tetramer of subunits. Each tetramer has two identical pairs of polypeptide chains, each pair having one light chain (LC) (about 25 kDa) and one heavy chain (HC) (about 50-70 kDa). The amino-terminal portion of each chain includes a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The carboxy-terminal portion of each chain defines a constant domain, in part, responsible for effector function. Light chains (LCs) are classified as either kappa or lambda based on the type of constant domain in the light chain. Heavy chains (HCs) are classified as gamma, mu, alpha, delta, or epsilon, based on the type of constant domain in the heavy chain, and define the antibody's isotype as IgG (e.g., IgG1, IgG2, IgG2a, IgG2b, IgG3 or IgG4), IgM, IgA (e.g., IgA1 or IgA2), IgD or IgE, respectively.

[0057] The present invention encompasses methods for making an antibody or antigen-binding fragment thereof comprising introducing, into an isolated host cell (e.g., a eukaryotic host cell such as Pichia, e.g., Pichia pastoris) comprising a bait that includes a human Fc immunoglobulin domain or functional fragment thereof (e.g., human; e.g., comprising a VH-CH1, CH2-CH3 or CH3 polypeptide) fused to a surface anchor polypeptide or functional fragment thereof, one or more polynucleotides encoding an immunoglobulin light chain variable region; and/or one or more polynucleotides encoding an immunoglobulin heavy chain variable region and culturing the host cell under condition whereby the polynucleotides encoding the immunoglobulin chains are expressed and an antibody or antigen-binding fragment thereof is formed from said chains.

[0058] In an embodiment of the invention, said bait is operably associated with a regulatable promoter and the bait expression is inhibited when said immunoglobulin chains are expressed. In an embodiment of the invention, bait expression is inhibited with anti-sense RNA or by RNA interference.

[0059] The present invention also provides a method for determining the quantity of an antibody or antigen-binding fragment thereof, e.g., by enzyme linked immunosorbent assay (ELISA). For example, in an embodiment of the invention, the method comprises culturing a eukaryotic host cell comprising an isolated polypeptide comprising a bait polypeptide (Fc immunoglobulin domain or functional fragment thereof (e.g., human; e.g., comprising a VH-CH1, CH2-CH3 or CH3 polypeptide) fused to a surface anchor polypeptide or functional fragment thereof); wherein the host cell secretes full antibody or antigen-binding fragment thereof (optionally, the antibody or fragment is isolated from the host cell and/or culture medium); and determining the quantity of the antibody or antigen-binding fragment thereof by ELISA. In an embodiment of the invention, expression of the bait is inhibited before quantitation such that the host cell expresses and secretes only full antibody. Bait polynucleotide can be operably associated with a regulatable promoter which is inhibited so as to inhibit bait expression. For example, in an embodiment of the invention, ELISA comprises coating the antigen on a solid substrate;

[0060] binding the antibody or antigen-binding fragment thereof to the antigen; binding a detectably labeled secondary antibody to the antibody or fragment; and detecting the secondary antibody. In an embodiment of the invention, the secondary antibody is labeled with alkaline phosphatase or horse radish peroxidase. In an embodiment of the invention, the label is detected by binding the alkaline phosphatase (AP) or horse radish peroxidase (HRP) with substrate and measuring absorbance of the plate (e.g., HRP substrate 3,3,5,5-tetramethylbenzidine (TMB); HRP substrate 3,3-diaminobenzidine (DAB); or HRP substrate 2,2-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) (ABTS); or AP substrate para-nitrophenylphosphate).

[0061] The present invention also provides a method for determining the affinity of an antibody or antigen-binding fragment thereof, that is secreted from a eukaryotic host cell in the antibody display system of the present invention, for an antigen. For example, the affinity can be determined by standard affinity ELISA, Biacore analysis or competition assays.

Antibody Display System

[0062] The present invention provides an antibody display system, composition or kit comprising (1) a eukaryotic host cell and (2) a bait comprising an Fc (e.g., a human Fc, e.g., comprising a VH-CH1, a CH3, or a CH2-CH3 polypeptide) fused, at the N- or C-terminus, (optionally, by a peptide linker such as GGG) to a surface anchor which bait is optionally linked to a signal sequence (e.g., an alpha mating factor signal sequence, e.g., from Saccharomyces cerevisiae); which system may be used, for example, in the identification of antibodies. Thus, in an embodiment of the invention, the host cell in the system expresses one or more immunoglobulin chains (e.g., light and heavy chains, e.g., wherein one or more of the chains are from a library source) of an antibody and/or of an Fc/antigen-binding fragment thereof. In an embodiment of the invention, the immunoglobulin chains of an antibody and/or of an Fc/antigen-binding fragment thereof comprises an identical or different CH2-CH3 polypeptide from that of the bait.

[0063] An Fc/antigen-binding fragment of an antibody (1) complexes with the Fc moiety of the bait (e.g., a human Fc, e.g., comprising a VH-CH1, CH3 or CH2-CH3 polypeptide) and (2) binds to an antigen when complexed with the bait on the surface of the host cell. An example of an Fc/antigen-binding fragment is a monovalent fragment of a full antibody (i.e., a monovalent antibody fragment). In an embodiment of the invention, the bait comprises a CH2-CH3 polypeptide or functional fragment thereof that differs at one or more residues from the CH2-CH3 of the Fc/antigen-binding fragment of an antibody. In such an embodiment of the invention, when the bait and the Fc/antigen-binding fragment of an antibody bind, a heterodimeric Fc domain is formed.

[0064] A monovalent antibody fragment comprises one half of an antibody, i.e., the antibody heavy chain (VH-CH1-CH2-CH3) bound to the antibody light chain (VL-CL) comprising three paired CDRs, e.g., wherein CH1 and CL are bound by a disulfide bridge, which monovalent antibody fragment is capable of detectably binding an antigen.

[0065] The bait comprises an Fc domain (e.g., human, rat, rabbit, goat or mouse Fc, e.g., any part of the heavy chain (e.g., human, rat, rabbit, goat or mouse) such as, for example, a CH3 polypeptide, a VH-CH1 polypeptide or a CH2-CH3 polypeptide) fused, e.g., at the amino-terminus or carboxy-terminus, to a surface anchor, which bait possesses functional properties described herein (e.g., as set forth below) that enable the bait to function in the antibody display system of the present invention. The Fc domain can, in an embodiment of the invention, be mutated so as to improve its ability to function in the antibody display system of the present invention, for example, cysteines or other residues may be added or moved to allow for more extensive disulfide bridges to form when complexed with a human IgG Fc or Fc/antigen-binding fragment. An Fc suitable for use in the bait comprises an Fc (i.e., comprising the CH1 and/or CH2 and/or CH3 domains) or functional fragment thereof (e.g., from an IgG1, IgG2, IgG3 or IgG4 or a mutant thereof) that is capable of dimerizing, when fused to a surface anchor protein, with, for example, a human IgG Fc or with the Fc/antigen-binding fragment on the surface of a eukaryotic host cell. In an embodiment of the invention, the term Fc refers to the fragment crystallized C-terminal region of an antibody containing the CH2 and CH3 domains. In an embodiment of the invention, dimerization between the bait Fc and the Fc/antigen-binding fragment occurs intracellularly, prior to routing to the cell surface, wherein the Fc and an Fc/antigen-binding fragment remain associated once at the cell surface. In general, in the absence of the Fc/antigen-binding fragment, the bait homodimerizes; thus comprising two surface anchors and two Fc domains. In an embodiment of the invention, a full antibody that is co-expressed with the bait comprises light and heavy chains capable of dimerizing with each other to form a monovalent antibody fragment, which monovalent antibody fragment dimerizes with the Fc of the bait.

[0066] An antigen can be any immunogenic molecule or substance, for example, a polypeptide (e.g., an oligopeptide), a cell membrane, cell extract or a whole cell. Polypeptide antigens include, for example, the following polypeptides: chemokines, cytokines (e.g., inflammatory cytokines or chemokines), receptors, PCSK9, granulocyte-CSF; coagulation factors such as factor VIII, factor IX, and human protein C; soluble IgE receptor alpha-chain; urokinase; chymase and urea trypsin inhibitor; IGF-binding protein; insulin-like growth factor-1 receptor, vascular epidermal growth factor, epidermal growth factor; growth hormone-releasing factor; GITR (glucocorticoid-induced TNFR-related protein), annexin V fusion protein; IL-23p19, IL-23p40, IL-23R, IL12R-beta 1, TNF alpha (tumor necrosis factor alpha), TGF beta (transforming growth factor beta), IL-10, IL-17, TSLP (Thymic stromal lymphopoietin), angiostatin; vascular endothelial growth factor-2; myeloid progenitor inhibitory factor-1; osteoprotegerin (OPG), RANK (receptor activator for nuclear factor kappa B) or RANKL (receptor activator for nuclear factor kappa B ligand); any of which can be, in an embodiment of the invention, human.

[0067] A surface anchor is any polypeptide that, when fused with an Fc or functional fragment thereof, is expressed and located to the cell surface where an Fc/antigen-binding fragment can complex with the Fc or functional fragment thereof. An example of a cell surface anchor is a protein such as, but not limited to, SED-1, -agglutinin, Cwpl, Cwp2, GasI, Yap3, FIoIp1 Crh2, Pirl, Pir4, Tipl, Wpi, Hpwpl, Als3, and Rbt5; for example, Saccharomyces cerevisiae CWP1, CWP2, SED1, or GAS1; Pichia pastoris SP1 or GAS1; or H. polymorpha TIP1. In an embodiment of the invention, the surface anchor is any glycosylphosphatidylinositol-anchored (GPI) protein. A functional fragment of a surface anchor comprises a fragment of a full surface anchor polypeptide that is capable of forming a functional bait when fused to an Fc or functional fragment thereof; e.g., wherein the fragment, when expressed in a eukaryotic host cell as a Fc fusion, is located on the cell surface wherein the Fc is capable of forming a complex with an Fc/antigen-binding fragment (e.g., a monovalent antibody fragment).

[0068] As discussed herein, a suitable eukaryotic host cell for use in the antibody display system of the present invention is a Pichia cell such as Pichia pastoris.

[0069] The scope of the present invention encompasses an isolated eukaryotic host cell (e.g., Pichia pastoris) comprising a bait (i.e., comprising the human Fc domain or functional fragment thereof fused, e.g., at the amino-terminus or carboxy-terminus, to the surface anchor or functional fragment thereof) on the cell surface wherein the bait is dimerized with an Fc/antigen-binding fragment, e.g., by binding between the bait Fc and the heavy chain of a monovalent antibody fragment (e.g., between the CH2-CH3 polypeptides in the bait and the Fc/antigen-binding fragment). The present invention also includes a composition comprising a eukaryotic host cell comprising a bait and secreted antibody or antigen-binding fragment thereof and/or Fc/antigen-binding fragment thereof, e.g., in a liquid culture medium.

[0070] The present invention provides, for example, a method for identifying (i) an antibody or Fc/antigen-binding fragment thereof that binds specifically to an antigen of interest and/or (ii) a polynucleotide encoding an immunoglobulin heavy chain of said antibody or fragment and/or a polynucleotide encoding an immunoglobulin light chain of said antibody or fragment. The method comprises, in an embodiment of the invention:

[0071] (a) co-expressing a bait (e.g., comprising a polypeptide comprising a CH3, VH-CH1 or CH2-CH3 polypeptide that is linked to a cell surface anchor, such as SEDT) and one or more heavy and light immunoglobulin chains (e.g., wherein one or more of such chains are encoded by a polynucleotide from a library source) in an isolated eukaryotic host cell (e.g., Pichia pastoris) such that a complex between the Fc moiety of the bait (e.g., comprising a VH-CH1, CH3 or CH2-CH3 polypeptide) and an Fc/antigen-binding fragment (e.g., a monovalent antibody fragment) comprising the immunoglobulin chains forms, and is located at the cell surface; for example, wherein the host cell is transformed with one or more polynucleotides encoding the bait and the immunoglobulin chains;

[0072] (b) identifying a eukaryotic host cell expressing the bait, dimerized with the Fc/antigen-binding fragment of the antibody (e.g., a monovalent antibody fragment), which has detectable affinity (e.g., acceptable affinity) for the antigen (e.g., which detectably binds to the antigen); for example, wherein the bait, and light and heavy chain immunoglobulins are encoded by the polynucleotides in the eukaryotic host cell;

[0073] In an embodiment of the invention, non-tethered, secreted full antibodies comprising light and heavy chain immunoglobulin variable domains identical to those complexed with the bait (e.g., immunoglobulins that are expressed from the host cell) are analyzed to determine if they possess detectable affinity.

[0074] In an embodiment of the invention, the full antibodies are secreted from the host cell into the medium. In an embodiment of the invention, the full antibodies are isolated from the host cell.

[0075] In an embodiment of the invention, after step (b), expression of the bait in the host cell is inhibited, but expression of the full antibodies is not inhibited. In this embodiment of the invention, the host cell expresses only the full antibody but does not express the bait at any significant quantity. Once expression of the bait is inhibited, in an embodiment of the invention, the full antibody produced from the host cell is analyzed to determine if it possesses detectable affinity (e.g., acceptable affinity); and,

[0076] (c) identifying said antibodies or antigen-binding fragments or polynucleotides if detectable binding of the Fc/antigen-binding fragment is observed, e.g., wherein one or more of the polynucleotides encoding the light and/or heavy chain immunoglobulin are optionally isolated from the host cell. In an embodiment of the invention, the nucleotide sequence of the polynucleotide is determined.

[0077] In an embodiment of the invention, a population of host cells express a common bait and a common immunoglobulin heavy chain as well a variety of different light chain immunoglobulins, e.g., from a library source, wherein individual light chain immunoglobulins that form Fc/antigen-binding fragments and full antibodies that are tethered to the bait and which exhibit antigen binding can be identified. Similarly, in an embodiment of the invention, a population of host cells express a common bait and a common immunoglobulin light chain as well a variety of different heavy chain immunoglobulins, e.g., from a library source, wherein individual heavy chain immunoglobulins that form Fc/antigen-binding fragments and full antibodies that are tethered to the bait and which exhibit antigen binding can be identified.

[0078] In an embodiment of the invention, the host cell possessing polynucleotides encoding the heavy and light chain immunoglobulins can be further used to express the secreted non-tethered antibody (e.g., full antibody) or an antigen-binding fragment thereof in culture. For example, in this embodiment of the invention, expression of the bait is optionally inhibited so that bait expression at significant quantities does not occur. The host cell is then cultured in a culture medium under conditions whereby secreted, non-tethered antibody (e.g., full antibody) or antigen-binding fragment thereof is expressed and secreted from the host cell. The non-tethered antibody or antigen-binding fragment thereof can optionally be isolated from the host cell and culture medium. In an embodiment of the invention, the immunoglobulin chains are transferred to a separate host cell (e.g., lacking the antibody display system components) for recombinant expression.

[0079] The present invention provides, for example, a method for identifying (i) an antibody or Fc/antigen-binding fragment thereof that binds specifically to an antigen of interest which comprises a second CH2-CH3 that differs from a first CH2-CH3 of a bait at one or more residues or (ii) a polynucleotide encoding an immunoglobulin heavy chain of said antibody or fragment and/or a polynucleotide encoding an immunoglobulin light chain of said antibody or fragment. The method comprises, in an embodiment of the invention:

[0080] (a) co-expressing a bait comprising a first CH2-CH3 polypeptide; along with a heavy immunoglobulin chain comprising said second CH2-CH3 polypeptide (e.g., wherein said heavy immunoglobulin chain is from a library source) and a light immunoglobulin chain (e.g., VL-CL), in an isolated eukaryotic host cell (e.g., Pichia pastoris) such that a complex between the first CH2-CH3 polypeptide of the bait and the second CH2-CH3 polypeptide of a Fc/antigen-binding fragment binds and is located at the cell surface; for example, wherein the host cell is transformed with one or more polynucleotides encoding the bait and the immunoglobulin chains;

[0081] (b) identifying a eukaryotic host cell expressing the bait, dimerized with the Fc/antigen-binding fragment which has detectable affinity (e.g., acceptable affinity) for the antigen; for example, wherein the bait, and light and heavy chain immunoglobulins are encoded by the polynucleotides in the eukaryotic host cell; and, optionally,

[0082] (c) identifying said antibodies or antigen-binding fragments or polynucleotides if detectable binding of the Fc/antigen-binding fragment is observed, e.g., wherein one or more of the polynucleotides encoding the light and/or heavy chain immunoglobulin are optionally isolated from the host cell. In an embodiment of the invention, the nucleotide sequence of the polynucleotide is determined.

[0083] The antibody display system of the present invention may be use to evaluate the effects of a given glycosylation pattern on the affinity of an antibody or antigen-binding fragment thereof for an antigen. In general, the ability of the Fc/antigen-binding fragment comprising an altered glyosylation pattern may be evaluated for binding to the antigen, after which affinity of the full antibody or antigen-binding fragment thereof can be evaluated. Glycosylation patterns can be modified on the immunoglobulin chains expressed in the antibody display system, for example, by using a host cell, e.g., as is discussed herein, that modifies the glycosylation patterns when the chains are expressed and/or by culturing a host under conditions whereby the glycosylation pattern is modified, e.g., as discussed herein. For example, in an embodiment of the invention, the method comprise contacting an antibody display system with said antigen; wherein the antibody display system comprises: (a) an isolated eukaryotic controlled glycosylation host cell comprising a polynucleotide encoding an immunoglobulin light chain; and a polynucleotide encoding an immunoglobulin heavy chain; and (b) a bait comprising an Fc immunoglobulin domain or functional fragment thereof fused to a surface anchor polypeptide or functional fragment thereof on the surface of said eukaryotic host cell; wherein the Fc of said bait complexes with an Fc/antigen-binding fragment comprising said immunoglobulin heavy and immunoglobulin light chains on the surface of the host cell; wherein said heavy or light chain comprises said sugar; determining if said Fc/antigen-binding fragment specifically binds to said antigen; determining the binding affinity of the antibody or antigen-binding fragment thereof comprising said sugar for the antigen; and comparing the affinity of the antibody or antigen-binding fragment thereof with affinity of an otherwise identical antibody or antigen-binding fragment thereof which lacks said sugar; wherein the sugar is determined to increase affinity for the antigen if the affinity of the antibody or antigen-binding fragment thereof comprising said sugar is higher than the affinity of the antibody or antigen-binding fragment thereof which lacks the sugar, and/or wherein the sugar is determined to decrease affinity for the antigen if the affinity of antibody or antigen-binding fragment thereof comprising said sugar is lower than the affinity of the antibody or antigen-binding fragment thereof which lacks the sugar. For example, the affinity of the antibody or antigen-binding fragment thereof lacking the sugar can be determined in a similar manner in the antibody display system of the present invention or the affinity or it can be determined directly by measuring affinity by a known method such as ELISA, biacore assay or a competition assay.

[0084] Bait expression can be inhibited by any of several acceptable means. For example, the polynucleotides encoding the bait (e.g., the surface anchor and/or Fc) can be expressed by a regulatable promoter whose expression can be inhibited in the host cell. In an embodiment of the invention, bait expression is inhibited by RNA interference, anti-sense RNA, mutation or removal of the polynucleotide encoding the bait (e.g., surface anchor and/or Fc) from the host cell or genetic mutation of the polynucleotide so that the host cell does not express a functional bait.

[0085] Acceptable affinity refers to antibody or antigen-binding fragment affinity for the antigen which is at least 10.sup.3 M or a greater affinity (lower number), e.g., 10.sup.3 M, 10.sup.4 M, 10.sup.5 M, 10.sup.6 M, 10.sup.7 M, 10.sup.8 M, 10.sup.9 M, 10.sup.10 M, 10.sup.11 M or 10.sup.12 M.

[0086] In an embodiment of the present invention, polynucleotides encoding the antibody or Fc/antigen-binding fragment (e.g., monovalent antibody fragment) heavy and light chain are in one or more libraries of polynucleotides that encode light and/or heavy chain immunoglobulins (e.g., one library encoding light chains and one library encoding heavy chains). The particular immunoglobulin chains of interest are, in this embodiment, distinguished from the other chains in the library when the surface-anchored Fc/antigen-binding fragment on the host cell surface is observed to bind to an antigen of interest.

[0087] In an embodiment of the invention, the heavy or light chain immunoglobulin expressed in the antibody display system is from a library source and the other immunoglobulin chain is known (i.e., a single chain from a clonal source). In this embodiment of the invention, the antibody display system can be used, as discussed herein, to identify a new library chain that forms desirable antibodies or antigen-binding fragments thereof when coupled with the known chain. Alternatively, the antibody display system can be used to analyze expression and binding characteristics of an antibody or antigen-binding fragment thereof comprising two known immunoglobulin chains.

[0088] In an embodiment of the invention, cells expressing Fc/antigen-binding fragments tethered to the cell by an anchor such as SEDT that bind to an antigen can be detected by incubating the cells with fluorescently labeled antigen (e.g., biotin label) and sorting/selecting cells that specifically bind the antigen by fluorescence-activated cell sorting (FACS).

[0089] In an embodiment of the invention, the eukaryotic host cells expressing the bait dimerized with the Fc/antigen-binding fragment are identified and sorted using fluorescence-activated cell sorting (FACS). For example, in an embodiment of the invention, cells expressing the bait dimerized with the Fc/antigen-binding fragment on the cell surface are labeled with a fluorescent antigen or fluorescent secondary antibody that also binds to the antigen. The fluorescent label is detected during the FACS sorting and used as the signal for sorting. Labeled cells indicate the presence of a cell surface expressed bait/Fc/antigen-binding fragment/antigen complex and are collected in one vessel whereas cells not expressing signal are collected in a separate vessel. The present invention, accordingly, includes the a method comprising the following steps for determining if an antibody or antigen-binding fragment thereof from a library specifically binds to an antigen: [0090] (1) Transform: [0091] (i) one or more immunoglobulin libraries, containing polynucleotides encoding light and heavy chain immunoglobulins; [0092] (ii) one or more immunoglobulin libraries, containing polynucleotides encoding light chain immunoglobulins and a single clonal heavy chain immunoglobulin; or [0093] (iii) one or more immunoglobulin libraries, containing polynucleotides encoding heavy chain immunoglobulins and a single clonal light chain immunoglobulin; [0094] wherein, said chains are capable of forming an antibody or antigen-binding fragment thereof, into a eukaryotic host cell comprising polynucleotides encoding the bait (e.g., Pichia pastoris); [0095] (2) Grow transformed cells in a liquid culture medium; [0096] (3) Allow expression of the bait on the surface of the cells; [0097] (4) Label the cells with fluorescently labeled antigen or antigen bound to a fluorescently labeled secondary antibody; [0098] (5) Sort and isolate fluorescently labeled cells using FACS for one round; [0099] (6) Regrow the labeled, sorted cells; [0100] (7) Allow expression of the bait in the cells; [0101] (8) Label the cells with fluorescently labeled antigen or antigen bound to a fluorescently labeled secondary antibody; [0102] (9) Sort and isolate fluorescently labeled cells using FACS for a second round; [0103] (10) Regrow the labeled, sorted cells on solid culture medium so that individual cellular clones grow into discrete cellular colonies; [0104] (11) Identify colonies with affinity for the antigen; [0105] (12) Grow cells from identified colonies in a liquid culture medium and isolate supernatant containing full, non-tethered antibody or antigen-binding fragment thereof comprising the immunoglobulin light and heavy chains; wherein, expression of the bait is optionally inhibited; [0106] (13) Determine affinity of non-tethered antibodies or antigen-binding fragments thereof, from the supernatant, for the antigen and identify clones with acceptable affinity (e.g., by Biacore analysis); [0107] (14) Determine the nucleotide sequence of polynucleotides in the identified clones encoding the heavy and light chain immunoglobulins.

[0108] The scope of the present invention also includes a method for identifying polynucleotides encoding a heavy chain and light chain immunoglobulin of an antibody or for identifying an antibody which exhibits high stability. Such a method comprises the following steps: (a) co-expressing the bait and the polynucleotides encoding the heavy and light chains in a eukaryotic host cell (e.g., Pichia pastoris) while subjecting antibodies comprising said chains to a denaturant; In an embodiment of the invention, a denaturant is present in a concentration or amount or magnitude (e.g., at a sufficiently high temperature) that a practitioner of ordinary skill in the art would expect to, at least partially, denature an antibody and, thus, inhibit its ability to bind to an antigen. For example, possible denaturants include urea (e.g., 2, 3, 4, 5 or 6 M or more), detergent such as triton X-100 (e.g., 1% or more), dithiothreitol (DTT) (e.g., 250 mM or 500 mM or more), guanidine hydrochloride, light (e.g., ultraviolet or visible), extreme pH (e.g., 1, 2, 3, 14, 13 or 12) or a temperature above about 4 C., such as 37 C. (e.g., 42 C., 48 C. or 50 C.) or any combination thereof (e.g., 500 mM DTT/6 M urea).

[0109] (b) identifying a eukaryotic host cell expressing the bait, dimerized with the Fc/antigen-binding fragment (e.g., a monovalent antibody fragment), which fragment has detectable affinity (e.g., acceptable affinity) for the antigen;

[0110] In an embodiment of the invention, full antibodies comprising light and heavy chain variable regions identical to those complexed with the bait are also analyzed to determine if they possess detectable affinity.

[0111] In an embodiment of the invention, the full antibodies are secreted from the host cell. In an embodiment of the invention, the full antibodies are isolated from the host cell.

[0112] In an embodiment of the invention, expression of the bait in the host cell is inhibited, but expression of the full antibodies is not inhibited. In this embodiment of the invention, the host cell expresses only the full antibody but does not express the bait at any significant quantity. Once expression of the bait is inhibited, in an embodiment of the invention, the full antibody produced from the host cell is analyzed to determine if it possesses detectable affinity (e.g., acceptable affinity).

[0113] ; and,

[0114] (c) identifying said antibodies or polynucleotides encoding the heavy and light chains from the cell wherein one or more of the polynucleotides are optionally isolated from the host cell; wherein antibodies exhibiting affinity for the antigen in the presence of denaturant are determined to exhibit high stability. In an embodiment of the invention, the nucleotide sequence of the polynucleotide is determined.

[0115] In an embodiment of the invention, a human Fc immunoglobulin domain for use in a bait comprises the following amino acid sequence:

TABLE-US-00001 (SEQIDNO:1) DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYK CKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQG NVFSCSVMHEALHNHYTQKSLSLSPG

[0116] In an embodiment of the invention, SED1 comprises the following amino acid sequence:

TABLE-US-00002 (SEQIDNO:2) VDQFSNSTSASSTDVTSSSSISTSSGSVTITSSEAPESDNGTSTAAPTET STEAPTTAIPTNGTSTEAPTTAIPTNGTSTEAPTDTTTEAPTTALPTNGT STEAPTDTTTEAPTTGLPTNGTTSAFPPTTSLPPSNTTTTPPYNPSTDYT TDYTVVTEYTTYCPEPTTFTTNGKTYTVTEPTTLTITDCPCTIEKPTTTS TTEYTVVTEYTTYCPEPTTFTTNGKTYTVTEPTTLTITDCPCTIEKSEAP ESSVPVTESKGTTTKETGVTTKQTTANPSLTVSTVVPVSSSASSHSVVIN SNGANVVVPGALGLAGVAMLFL

[0117] In an embodiment of the invention, the human Fc immunoglobulin fused to the SED1 polypeptide is linked to a signal sequence such as an alpha mating factor signal sequence (e.g., MRFPSIFTAVLFAASSALA (SEQ ID NO: 3))

[0118] In an embodiment of the invention, the bait comprising the human Fc immunoglobulin domain fused to a SED1 polypeptide comprise the amino acid sequence:

TABLE-US-00003 (SEQIDNO:4) MRFPSIFTAVLFAASSALADKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVICVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTL PPSREEMTKNQVSLICLVKGFYPSDIAVEWESNGQPENNYKTIPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGGGGVD QFSNSTSASSTDVISSSSISTSSGSVTITSSEAPESDNGTSTAAPTETST EAPTTAIPTNGTSTEAPTTAIPTNGTSTEAPTDTTTEAPTTALPTNGTST EAPTDTTTEAPTTGLPTNGTTSAFPPTTSLPPSNTTTTPPYNPSTDYTTD YTVVTEYTTYCPEPTTFTTNGKTYTVTEPTTLTITDCPCTIEKPTTTSTT EYTVVTEYTTYCPEPTTFTTNGKTYTVTEPTTLTITDCPCTIEKSEAPES SVPVTESKGTTTKETGVTTKQTTANPSLTVSTVVPVSSSASSHSVVINSN GANVVVPGALGLAGVAMLFL.

[0119] The Fc immunoglobulin domain is underscored and the linked is in bold face font. The SEDT polypeptide follows the linker and an alpha mating factor signal peptide is before the Fc.

EXAMPLES

[0120] The present invention is intended to exemplify the present invention and not to be a limitation thereof. The methods and compositions (e.g., polypeptides, polynucleotides, plasmids, yeast cells) disclosed below fall within the scope of the present invention.

Example 1

Construction and Use of Antibody Display System

Construction of Antibody Display Bait

[0121] Expression cassettes were constructed as follows. A polynucleotide encoding the N-terminus of a cell surface anchoring protein that inherently contains an attached glycophosphotidylinositol (GPI) post-translational modification that anchors the protein on the yeast cell wall was linked to a nucleic acid sequence that encodes the human IgG1 Fc region. The specific cell surface anchoring protein we used was S.cerevisiae Sed1 protein, which had been identified by screening a panel of cell wall of plasma membrane proteins that had been identified using GPI protein prediction software (described in international publication no. WO09/111183).

[0122] To create the plasmid containing bait cassette, a codon optimized sequence of human IgG1 Fc fragment was synthesized using an EcoRI forward PCR primer containing the nucleic acid sequence of S. cerevisiae a-mating factor signal sequence fused upstream of the sequence encoding the IgG1 Fc N-terminus, and a SalI reverse primer encoding the C-terminus of IgG1 Fc that terminates in a sequence encoding a GGGG linker. A plasmid containing the anti-Her2 gene sequence was used as a PCR template for amplification of an EcoRI--mating factor signal sequence-Fc-GGGG-SalI fragment. Both PCR product and pGLY3033 (described in international publication no. WO09/111183) were digested using EcoRI and SalI endonucleases. The EcoRI-SalI fragment encoding the Fc was ligated in frame to EcoRI-SalI pGLY3033 backbone to generate plasmid pGLY9008 (FIG. 2). This plasmid enables delivery of the Fc-SEDT cassette under the control of the Pichia pastoris AOX1 promoter sequence. Like the parent plasmid it contains, the Pichia pastoris URA6 gene sequence, which serves as an integration locus in the genome, and the arsenite resistance gene, to allow selection on media containing sodium aresnite.

[0123] The pGLY3033 plasmid sequence comprises the nucleotide sequence:

TABLE-US-00004 (SEQIDNO:5) TCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACGGTCACAGCTTGTCT GTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGCGTCAGCGGGTGTTGGCGGGTGTCGGGGCTGG CTTAACTATGCGGCATCAGAGCAGATTGTACTGAGAGTGCACCATATGCGGTGTGAAATACCGCACAGAT GCGTAAGGAGAAAATACCGCATCAGGCGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATC GGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTA ACGCCAGGGTTTTCCCAGTCACGACGTTGTAAAACGACGGCCAGTGAATTGAGATCTAACATCCAAAGAC GAAAGGTTGAATGAAACCTTTTTGCCATCCGACATCCACAGGTCCATTCTCACACATAAGTGCCAAACGC AACAGGAGGGGATACACTAGCAGCAGACCGTTGCAAACGCAGGACCTCCACTCCTCTTCTCCTCAACACC CACTTTTGCCATCGAAAAACCAGCCCAGTTATTGGGCTTGATTGGAGCTCGCTCATTCCAATTCCTTCTA TTAGGCTACTAACACCATGACTTTATTAGCCTGTCTATCCTGGCCCCCCTGGCGAGGTTCATGTTTGTTT ATTTCCGAATGCAACAAGCTCCGCATTACACCCGAACATCACTCCAGATGAGGGCTTTCTGAGTGTGGGG TCAAATAGTTTCATGTTCCCCAAATGGCCCAAAACTGACAGTTTAAACGCTGTCTTGGAACCTAATATGA CAAAAGCGTGATCTCATCCAAGATGAACTAAGTTTGGTTCGTTGAAATGCTAACGGCCAGTTGGTCAAAA AGAAACTTCCAAAAGTCGGCATACCGTTTGTCTTGTTTGGTATTGATTGACGAATGCTCAAAAATAATCT CATTAATGCTTAGCGCAGTCTCTCTATCGCTTCTGAACCCCGGTGCACCTGTGCCGAAACGCAAATGGGG AAACACCCGCTTTTTGGATGATTATGCATTGTCTCCACATTGTATGCTTCCAAGATTCTGGTGGGAATAC TGCTGATAGCCTAACGTTCATGATCAAAATTTAACTGTTCTAACCCCTACTTGACAGCAATATATAAACA GAAGGAAGCTGCCCTGTCTTAAACCTTTTTTTTTATCATCATTATTAGCTTACTTTCATAATTGCGACTG GTTCCTATTGACTAGCTTTTGATTTTAACGACTTTTTACGACAACTTGAGAAGATCAAAAAACAACTAAT TATTCGAAACGGAATTCacgatggtcgcttggtggtctttgtttctgtacggtcttcaggtcgctgcacc tgctttggctACTTCCAGATTGGAGGGATTGCAATCCGAAAACCACAGATTGAGAATGAAGATCACTGAG TTGGACAAGGACTTGGAGGAAGTTACTATGCAGTTGCAGGATGTTGGTGGTTGTGAGCAGAAGTTGATCT CCGAAGAGGATTTGGTCGACCAATTCTCTAACTCTACTTCCGCTTCCTCTACTGACGTTACTTCCTCCTC CTCTATTTCTACTTCCTCCGGTTCCGTTACTATTACTTCCTCTGAGGCTCCAGAATCTGACAACGGTACT TCTACTGCTGCTCCAACTGAAACTTCTACTGAGGCTCCTACTACTGCTATTCCAACTAACGGAACTTCCA CAGAGGCTCCAACAACAGCTATCCCTACAAACGGTACATCCACTGAAGCTCCTACTGACACTACTACAGA AGCTCCAACTACTGCTTTGCCTACTAATGGTACATCAACAGAGGCTCCTACAGATACAACAACTGAAGCT CCAACAACTGGATTGCCAACAAACGGTACTACTTCTGCTTTCCCACCAACTACTTCCTTGCCACCATCCA ACACTACTACTACTCCACCATACAACCCATCCACTGACTACACTACTGACTACACAGTTGTTACTGAGTA CACTACTTACTGTCCAGAGCCAACTACTTTCACAACAAACGGAAAGACTTACACTGTTACTGAGCCTACT ACTTTGACTATCACTGACTGTCCATGTACTATCGAGAAGCCAACTACTACTTCCACTACAGAGTATACTG TTGTTACAGAATACACAACATATTGTCCTGAGCCAACAACATTCACTACTAATGGAAAAACATACACAGT TACAGAACCAACTACATTGACAATTACAGATTGTCCTTGTACAATTGAGAAGTCCGAGGCTCCTGAATCT TCTGTTCCAGTTACTGAATCCAAGGGTACTACTACTAAAGAAACTGGTGTTACTACTAAGCAGACTACTG CTAACCCATCCTTGACTGTTTCCACTGTTGTTCCAGTTTCTTCCTCTGCTTCTTCCCACTCCGTTGTTAT CAACTCCAACGGTGCTAACGTTGTTGTTCCTGGTGCTTTGGGATTGGCTGGTGTTGCTATGTTGTTCTTG TTATAGGGCCGGCCATTTAAATACAGGCCCCTTTTCCTTTGTCGATATCATGTAATTAGTTATGTCACGC TTACATTCACGCCCTCCTCCCACATCCGCTCTAACCGAAAAGGAAGGAGTTAGACAACCTGAAGTCTAGG TCCCTATTTATTTTTTTTAATAGTTATGTTAGTATTAAGAACGTTATTTATATTTCAAATTTTTCTTTTT TTTCTGTACAAACGCGTGTACGCATGTAACATTATACTGAAAACCTTGCTTGAGAAGGTTTTGGGACGCT CGAAGGCTTTAATTTGCAAGCTGGATCCGCGGCCGCTTACGCGCCGTTCTTCGCTTGGTCTTGTATCTCC TTACACTGTATCTTCCCATTTGCGTTTAGGTGGTTATCAAAAACTAAAAGGAAAAATTTCAGATGTTTAT CTCTAAGGTTTTTTCTTTTTACAGTATAACACGTGATGCGTCACGTGGTACTAGATTACGTAAGTTATTT TGGTCCGGTGGGTAAGTGGGTAAGTATAGAAAGCATGTAGGTTTACAAAAACGCAGTCACGAATTATTGC TACTTCGAGCTTGGAACCACCCCAAAGATTATATTGTACTGATGCACTACCTTCTCGATTTTGCTCCTCC AAGAACCTACGAAAAACATTTCTTGAGCCTTTTCAACCTAGACTACACATCAAGTTATTTAAGGTATGTT CCGTTAACATGTAAGAAAAGGAGAGGATAGATCGTTTATGGGGTACGTCGCCTGATTCAAGCGTGACCAT TCGAAGAATAGGCCTTCGAAAGCTGAATAAAGCAAATGTCAGTTGCGATTGGTATGCTGACAAATTAGCA TAAAAAGCAATAGACTTTCTAACCACCTGTTTTTTTCCTTTTACTTTATTTATATTTTGCCACCGTACTA ACAAGTTCAGACAAATTAATTAACACCATGTCAGAAGATCAAAAAAGTGAAAATTCCGTACCTTCTAAGG TTAATATGGTGAATCGCACCGATATACTGACTACGATCAAGTCATTGTCATGGCTTGACTTGATGTTGCC ATTTACTATAATTCTCTCCATAATCATTGCAGTAATAATTTCTGTCTATGTGCCTTCTTCCCGTCACACT TTTGACGCTGAAGGTCATCCCAATCTAATGGGAGTGTCCATTCCTTTGACTGTTGGTATGATTGTAATGA TGATTCCCCCGATCTGCAAAGTTTCCTGGGAGTCTATTCACAAGTACTTCTACAGGAGCTATATAAGGAA GCAACTAGCCCTCTCGTTATTTTTGAATTGGGTCATCGGTCCTTTGTTGATGACAGCATTGGCGTGGATG GCGCTATTCGATTATAAGGAATACCGTCAAGGCATTATTATGATCGGAGTAGCTAGATGCATTGCCATGG TGCTAATTTGGAATCAGATTGCTGGAGGAGACAATGATCTCTGCGTCGTGCTTGTTATTACAAACTCGCT TTTACAGATGGTATTATATGCACCATTGCAGATATTTTACTGTTATGTTATTTCTCATGACCACCTGAAT ACTTCAAATAGGGTATTATTCGAAGAGGTTGCAAAGTCTGTCGGAGTTTTTCTCGGCATACCACTGGGAA TTGGCATTATCATACGTTTGGGAAGTCTTACCATAGCTGGTAAAAGTAATTATGAAAAATACATTTTGAG ATTTATTTCTCCATGGGCAATGATCGGATTTCATTACACTTTATTTGTTATTTTTATTAGTAGAGGTTAT CAATTTATCCACGAAATTGGTTCTGCAATATTGTGCTTTGTCCCATTGGTGCTTTACTTCTTTATTGCAT GGTTTTTGACCTTCGCATTAATGAGGTACTTATCAATATCTAGGAGTGATACACAAAGAGAATGTAGCTG TGACCAAGAACTACTTTTAAAGAGGGTCTGGGGAAGAAAGTCTTGTGAAGCTAGCTTTTCTATTACGATG ACGCAATGTTTCACTATGGCTTCAAATAATTTTGAACTATCCCTGGCAATTGCTATTTCCTTATATGGTA ACAATAGCAAGCAAGCAATAGCTGCAACATTTGGGCCGTTGCTAGAAGTTCCAATTTTATTGATTTTGGC AATAGTCGCGAGAATCCTTAAACCATATTATATATGGAACAATAGAAATTAATTAACAGGCCCCTTTTCC TTTGTCGATATCATGTAATTAGTTATGTCACGCTTACATTCACGCCCTCCTCCCACATCCGCTCTAACCG AAAAGGAAGGAGTTAGACAACCTGAAGTCTAGGTCCCTATTTATTTTTTTTAATAGTTATGTTAGTATTA AGAACGTTATTTATATTTCAAATTTTTCTTTTTTTTCTGTACAAACGCGTGTACGCATGTAACATTATAC TGAAAACCTTGCTTGAGTAGGTTTTGGGACGCTCGTAGGCTTTTATTTGCAAGCTGCGGCCTAAGGCGCG CCAGGCCATAATGGCCCAAATGCAAGAGGACATTAGAAATGTGTTTGGTAAGAACATGAAGCCGGAGGCA TACAAACGATTCACAGATTTGAAGGAGGAAAACAAACTGCATCCACCGGAAGTGCCAGCAGCCGTGTATG CCAACCTTGCTCTCAAAGGCATTCCTACGGATCTGAGTGGGAAATATCTGAGATTCACAGACCCACTATT GGAACAGTACCAAACCTAGTTTGGCCGATCCATGATTATGTAATGCATATAGTTTTTGTCGATGCTCACC CGTTTCGAGTCTGTCTCGTATCGTCTTACGTATAAGTTCAAGCATGTTTACCAGGTCTGTTAGAAACTCC TTTGTGAGGGCAGGACCTATTCGTCTCGGTCCCGTTGTTTCTAAGAGACTGTACAGCCAAGCGCAGAATG GTGGCATTAACCATAAGAGGATTCTGATCGGACTTGGTCTATTGGCTATTGGAACCACCCTTTACGGGAC AACCAACCCTACCAAGACTCCTATTGCATTTGTGGAACCAGCCACGGAAAGAGCGTTTAAGGACGGAGAC GTCTCTGTGATTTTTGTTCTCGGAGGTCCAGGAGCTGGAAAAGGTACCCAATGTGCCAAACTAGTGAGTA ATTACGGATTTGTTCACCTGTCAGCTGGAGACTTGTTACGTGCAGAACAGAAGAGGGAGGGGTCTAAGTA TGGAGAGATGATTTCCCAGTATATCAGAGATGGACTGATAGTACCTCAAGAGGTCACCATTGCGCTCTTG GAGCAGGCCATGTAGGAAAACTTCGAGAAAGGGAAGACACGGTTCTTGATTGATGGATTCCCTCGTAAGA TGGACCAGGCCAAAACTTTTGAGGAAAAAGTCGCAAAGTCCAAGGTGACACTTTTCTTTGATTGTCCCGA ATCAGTGCTCCTTGAGAGATTACTTAAAAGAGGACAGACAAGCGGAAGAGAGGATGATAATGCGGAGAGT ATCAAAAAAAGATTCAAAACATTCGTGGTAACTTCGATGCCTGTGGTGGACTATTTCGGGAAGCAAGGAC GCGTTTTGAAGGTATCTTGTGACCACCCTGTGGATCAAGTGTATTCACAGGTTGTGTCGGTGCTAAAAGA GAAGGGGATCTTTGCCGATAACGAGACGGAGAATAAATAAACATTGTAATAAGATTTAGACTGTGAATGT TCTATGTAATATTTTTCGAGATACTGTATCTATCTGGTGTACCGTATCACTCTGGACTTGCAAACTCATT GATTACTTGTGCAATGGGCAAGAAGGATAGCTCTAGAAAGAAGAAGAAAAAGGAGCCGCCTGAAGAGCTG GATCTTTCCGAGGTTGTTCCAACTTTTGGTTATGAGGAATTTCATGTTGAGCAAGAGGAGAATCCGGTCG ATCAAGACGAACTTGACGGCCATAATGGCCTAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGA AATTGTTATCCGCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCT AATGAGTGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTG CCAGCTGCATTAATGAATCGGCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCC TCGCTCACTGACTCGCTGCGCTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAA TACGGTTATCCACAGAATCAGGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAG GAACCGTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAAT CGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCT CCCTCGTGCGCTCTCCTGTTCCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAG CGTGGCGCTTTCTCATAGCTCACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGC TGTGTGCACGAACCCCCCGTTCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACC CGGTAAGACACGACTTATCGCCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGG CGGTGCTACAGAGTTCTTGAAGTGGTGGCCTAACTACGGCTACACTAGAAGGACAGTATTTGGTATCTGC GCTCTGCTGAAGCCAGTTACCTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTG GTAGCGGTGGTTTTTTTGTTTGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTT GATCTTTTCTACGGGGTCTGACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTA TCAAAAAGGATCTTCACCTAGATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATG AGTAAACTTGGTCTGACAGTTACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCG TTCATCCATAGTTGCCTGACTCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCC AGTGCTGCAATGATACCGCGAGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCG GAAGGGCCGAGCGCAGAAGTGGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGA AGCTAGAGTAAGTAGTTCGCCAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTG TCACGCTCGTCGTTTGGTATGGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCC CCATGTTGTGCAAAAAAGCGGTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGT GTTATCACTCATGGTTATGGCAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCT GTGACTGGTGAGTACTCAACCAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGG CGTCAATACGGGATAATACCGCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTC GGGGCGAAAACTCTCAAGGATCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAAC TGATCTTCAGCATCTTTTACTTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAA AAAAGGGAATAAGGGCGACACGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCAT TTATCAGGGTTATTGTCTCATGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTT CCGCGCACATTTCCCCGAAAAGTGCCACCTGACGTCTAAGAAACCATTATTATCATGACATTAACCTATA AAAATAGGCGTATCACGAGGCCCTTTCGTC

[0124] The pGLY9008 plasmid sequence comprises the nucleotide sequence:

TABLE-US-00005 (SEQIDNO:6) TCGCGCGTTTCGGTGATGACGGTGAAAACCTCTGACACATGCAGCTCCCGGAGACGGTCACAGCTTGTCT GTAAGCGGATGCCGGGAGCAGACAAGCCCGTCAGGGCGCGTCAGCGGGTGTTGGCGGGTGTCGGGGCTGG CTTAACTATGCGGCATCAGAGCAGATTGTACTGAGAGTGCACCATATGCGGTGTGAAATACCGCACAGAT GCGTAAGGAGAAAATACCGCATCAGGCGCCATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATC GGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCGATTAAGTTGGGTA ACGCCAGGGTTTTCCCAGTCACGACGTTGTAAAACGACGGCCAGTGAATTGAGATCTAACATCCAAAGAC GAAAGGTTGAATGAAACCTTTTTGCCATCCGACATCCACAGGTCCATTCTCACACATAAGTGCCAAACGC AACAGGAGGGGATACACTAGCAGCAGACCGTTGCAAACGCAGGACCTCCACTCCTCTTCTCCTCAACACC CACTTTTGCCATCGAAAAACCAGCCCAGTTATTGGGCTTGATTGGAGCTCGCTCATTCCAATTCCTTCTA TTAGGCTACTAACACCATGACTTTATTAGCCTGTCTATCCTGGCCCCCCTGGCGAGGTTCATGTTTGTTT ATTTCCGAATGCAACAAGCTCCGCATTACACCCGAACATCACTCCAGATGAGGGCTTTCTGAGTGTGGGG TCAAATAGTTTCATGTTCCCCAAATGGCCCAAAACTGACAGTTTAAACGCTGTCTTGGAACCTAATATGA CAAAAGCGTGATCTCATCCAAGATGAACTAAGTTTGGTTCGTTGAAATGCTAACGGCCAGTTGGTCAAAA AGAAACTTCCAAAAGTCGGCATACCGTTTGTCTTGTTTGGTATTGATTGACGAATGCTCAAAAATAATCT CATTAATGCTTAGCGCAGTCTCTCTATCGCTTCTGAACCCCGGTGCACCTGTGCCGAAACGCAAATGGGG AAACACCCGCTTTTTGGATGATTATGCATTGTCTCCACATTGTATGCTTCCAAGATTCTGGTGGGAATAC TGCTGATAGCCTAACGTTCATGATCAAAATTTAACTGTTCTAACCCCTACTTGACAGCAATATATAAACA GAAGGAAGCTGCCCTGTCTTAAACCTTTTTTTTTATCATCATTATTAGCTTACTTTCATAATTGCGACTG GTTCCTATTGACTAGCTTTTGATTTTAACGACTTTTAACGACAACTTGAGAAGATCAAAAAACAACTAAT TATTCGAAACGGAATTCACGATGAGATTTCCTTCAATTTTTACTGCTGTTTTATTCGCAGCATCCTCCGC ATTAGCTGACAAGACACATACTTGTCCACCATGTCCAGCTCCAGAATTGTTGGGTGGTCCATCCGTTTTC TTGTTCCCACCAAAGCCAAAGGACACTTTGATGATCTCCAGAACTCCAGAGGTTACATGTGTTGTTGTTG ACGTTTCTCACGAGGACCCAGAGGTTAAGTTCAACTGGTACGTTGACGGTGTTGAAGTTCACAACGCTAA GACTAAGCCAAGAGAAGAGCAGTACAACTCCACTTACAGAGTTGTTTCCGTTTTGACTGTTTTGCACCAG GACTGGTTGAACGGTAAAGAATACAAGTGTAAGGTTTCCAACAAGGCTTTGCCAGCTCCAATCGAAAAGA CTATCTCCAAGGCTAAGGGTCAACCAAGAGAGCCACAGGTTTACACTTTGCCACCATCCAGAGAAGAGAT GACTAAGAACCAGGTTTCCTTGACTTGTTTGGTTAAAGGATTCTACCCATCCGACATTGCTGTTGAGTGG GAATCTAACGGTCAACCAGAGAACAACTACAAGACTACTCCACCAGTTTTGGATTCTGATGGTTCCTTCT TCTTGTACTCCAAGTTGACTGTTGACAAGTCCAGATGGCAACAGGGTAACGTTTTCTCCTGTTCCGTTAT GCATGAGGCTTTGCACAACCACTACACTCAAAAGTCCTTGTCTTTGTCCCCTGGTGGTGGTGGTGTCGAC CAATTCTCTAACTCTACTTCCGCTTCCTCTACTGACGTTACTTCCTCCTCCTCTATTTCTACTTCCTCCG GTTCCGTTACTATTACTTCCTCTGAGGCTCCAGAATCTGACAACGGTACTTCTACTGCTGCTCCAACTGA AACTTCTACTGAGGCTCCTACTACTGCTATTCCAACTAACGGAACTTCCACAGAGGCTCCAACAACAGCT ATCCCTACAAACGGTACATCCACTGAAGCTCCTACTGACACTACTACAGAAGCTCCAACTACTGCTTTGC CTACTAATGGTACATCAACAGAGGCTCCTACAGATACAACAACTGAAGCTCCAACAACTGGATTGCCAAC AAACGGTACTACTTCTGCTTTCCCACCAACTACTTCCTTGCCACCATCCAACACTACTACTACTCCACCA TACAACCCATCCACTGACTACACTACTGACTACACAGTTGTTACTGAGTACACTACTTACTGTCCAGAGC CAACTACTTTCACAACAAACGGAAAGACTTACACTGTTACTGAGCCTACTACTTTGACTATCACTGACTG TCCATGTACTATCGAGAAGCCAACTACTACTTCCACTACAGAGTATACTGTTGTTACAGAATACACAACA TATTGTCCTGAGCCAACAACATTCACTACTAATGGAAAAACATACACAGTTACAGAACCAACTACATTGA CAATTACAGATTGTCCTTGTACAATTGAGAAGTCCGAGGCTCCTGAATCTTCTGTTCCAGTTACTGAATC CAAGGGTACTACTACTAAAGAAACTGGTGTTACTACTAAGCAGACTACTGCTAACCCATCCTTGACTGTT TCCACTGTTGTTCCAGTTTCTTCCTCTGCTTCTTCCCACTCCGTTGTTATCAACTCCAACGGTGCTAACG TTGTTGTTCCTGGTGCTTTGGGATTGGCTGGTGTTGCTATGTTGTTCTTGTAATAGGGCCGGCCATTTAA ATACAGGCCCCTTTTCCTTTGTCGATATCATGTAATTAGTTATGTCACGCTTACATTCACGCCCTCCTCC CACATCCGCTCTTACCGAAAAGGAAGGAGTTAGACAACCTGAAGTCTAGGTCCCTATTTATTTTTTTTAA TAGTTATGTTAGTATTAAGTACGTTATTTATATTTCAAATTTTTCTTTTTTTTCTGTACAAACGCGTGTA CGCATGTAACATTATACTGAAAACCTTGCTTGAGAAGGTTTTGGGACGCTCGAAGGCTTTAATTTGCAAG CTGGATCCGCGGCCGCTTACGCGCCGTTCTTCGCTTGGTCTTGTATCTCCTTACACTGTATCTTCCCATT TGCGTTTAGGTGGTTATCAAAAACTAAAAGGAAAAATTTCAGATGTTTATCTCTAAGGTTTTTTCTTTTT ACAGTATAACACGTGATGCGTCACGTGGTACTAGATTACGTAAGTTATTTTGGTCCGGTGGGTAAGTGGG TAAGTATAGAAAGCATGTAGGTTTACAAAAACGCAGTCACGAATTATTGCTACTTCGAGCTTGGAACCAC CCCAAAGATTATATTGTACTGATGCACTACCTTCTCGATTTTGCTCCTCCAAGTACCTACGAAAAACATT TCTTGAGCCTTTTCAACCTAGACTACACATCTAGTTATTTTAGGTATGTTCCGTTTACATGTAAGAAAAG GAGAGGATAGATCGTTTATGGGGTACGTCGCCTGATTCAAGCGTGACCATTCGAAGAATAGGCCTTCGAA AGCTGTATAAAGCAAATGTCAGTTGCGATTGGTATGCTGACAAATTAGCATAAAAAGCAATAGACTTTCT AACCACCTGTTTTTTTCCTTTTACTTTATTTATATTTTGCCACCGTACTAACAAGTTCAGACAAATTAAT TAACACCATGTCAGAAGATCAAAAAAGTGAAAATTCCGTACCTTCTAAGGTTAATATGGTGAATCGCACC GATATACTGACTACGATCAAGTCATTGTCATGGCTTGACTTGATGTTGCCATTTACTATAATTCTCTCCA TAATCATTGCAGTAATAATTTCTGTCTATGTGCCTTCTTCCCGTCACACTTTTGACGCTGAAGGTCATCC CAATCTAATGGGAGTGTCCATTCCTTTGACTGTTGGTATGATTGTAATGATGATTCCCCCGATCTGCAAA GTTTCCTGGGAGTCTATTCACAAGTACTTCTACAGGAGCTATATAAGGAAGCAACTAGCCCTCTCGTTAT TTTTGAATTGGGTCATCGGTCCTTTGTTGATGACAGCATTGGCGTGGATGGCGCTATTCGATTATAAGGA ATACCGTCAAGGCATTATTATGATCGGAGTAGCTAGATGCATTGCCATGGTGCTAATTTGGAATCAGATT GCTGGAGGAGACAATGATCTCTGCGTCGTGCTTGTTATTACAAACTCGCTTTTACAGATGGTATTATATG CACCATTGCAGATATTTTACTGTTATGTTATTTCTCATGACCACCTGAATACTTCAAATAGGGTATTATT CGAAGAGGTTGCAAAGTCTGTCGGAGTTTTTCTCGGCATACCACTGGGAATTGGCATTATCATACGTTTG GGAAGTCTTACCATAGCTGGTAAAAGTAATTATGAAAAATACATTTTGAGATTTATTTCTCCATGGGCAA TGATCGGATTTCATTACACTTTATTTGTTATTTTTATTAGTAGAGGTTATCAATTTATCCACGAAATTGG TTCTGCAATATTGTGCTTTGTCCCATTGGTGCTTTACTTCTTTATTGCATGGTTTTTGACCTTCGCATTA ATGAGGTACTTATCAATATCTAGGAGTGATACACAAAGAGAATGTAGCTGTGACCAAGAACTACTTTTAA AGAGGGTCTGGGGAAGAAAGTCTTGTGAAGCTAGCTTTTCTATTACGATGACGCAATGTTTCACTATGGC TTCAAATAATTTTGAACTATCCCTGGCAATTGCTATTTCCTTATATGGTAACAATAGCAAGCAAGCAATA GCTGCAACATTTGGGCCGTTGCTAGAAGTTCCAATTTTATTGATTTTGGCAATAGTCGCGAGAATCCTTA AACCATATTATATATGGAACAATAGAAATTAATTAACAGGCCCCTTTTCCTTTGTCGATATCATGTAATT AGTTATGTCACGCTTACATTCACGCCCTCCTCCCACATCCGCTCTAACCGAAAAGGAAGGAGTTAGACAA CCTGAAGTCTAGGTCCCTATTTATTTTTTTTAATAGTTATGTTAGTATTAAGAACGTTATTTATATTTCA TATTTTTCTTTTTTTTCTGTACAAACGCGTGTACGCATGTAACATTATACTGAAAACCTTGCTTGAGAAG GTTTTGGGACGCTCGAAGGCTTTAATTTGCAAGCTGCGGCCTAAGGCGCGCCAGGCCATAATGGCCCAAA TGCAAGAGGACATTAGAAATGTGTTTGGTAAGAACATGAAGCCGGAGGCATACAAACGATTCACAGATTT GTAGGAGGAAAACAAACTGCATCCACCGGAAGTGCCAGCAGCCGTGTATGCCAACCTTGCTCTCAAAGGC ATTCCTACGGATCTGAGTGGGAAATATCTGAGATTCACAGACCCACTATTGGAACAGTACCAAACCTAGT TTGGCCGATCCATGATTATGTAATGCATATAGTTTTTGTCGATGCTCACCCGTTTCGAGTCTGTCTCGTA TCGTCTTACGTATAAGTTCAAGCATGTTTACCAGGTCTGTTAGAAACTCCTTTGTGAGGGCAGGACCTAT TCGTCTCGGTCCCGTTGTTTCTAAGAGACTGTACAGCCAAGCGCAGAATGGTGGCATTAACCATAAGAGG ATTCTGATCGGACTTGGTCTATTGGCTATTGGAACCACCCTTTACGGGACAACCAACCCTACCAAGACTC CTATTGCATTTGTGGAACCAGCCACGGAAAGAGCGTTTAAGGACGGAGACGTCTCTGTGATTTTTGTTCT CGGAGGTCCAGGAGCTGGAAAAGGTACCCAATGTGCCAAACTAGTGAGTAATTACGGATTTGTTCACCTG TCAGCTGGAGACTTGTTACGTGCAGAACAGAAGAGGGAGGGGTCTAAGTATGGAGAGATGATTTCCCAGT ATATCAGAGATGGACTGATAGTACCTCAAGAGGTCACCATTGCGCTCTTGGAGCAGGCCATGAAGGAAAA CTTCGAGAAAGGGAAGACACGGTTCTTGATTGATGGATTCCCTCGTAAGATGGACCAGGCCAAAACTTTT GAGGAAAAAGTCGCAAAGTCCAAGGTGACACTTTTCTTTGATTGTCCCGAATCAGTGCTCCTTGAGAGAT TACTTAAAAGAGGACAGACAAGCGGAAGAGAGGATGATAATGCGGAGAGTATCAAAAAAAGATTCAAAAC ATTCGTGGAAACTTCGATGCCTGTGGTGGACTATTTCGGGAAGCAAGGACGCGTTTTGAAGGTATCTTGT GACCACCCTGTGGATCAAGTGTATTCACAGGTTGTGTCGGTGCTAAAAGAGAAGGGGATCTTTGCCGATA ACGAGACGGAGAATAAATAAACATTGTAATAAGATTTAGACTGTGAATGTTCTATGTAATATTTTTCGAG ATACTGTATCTATCTGGTGTACCGTATCACTCTGGACTTGCAAACTCATTGATTACTTGTGCAATGGGCA AGAAGGATAGCTCTAGAAAGAAGTAGAAAAAGGAGCCGCCTGAAGAGCTGGATCTTTCCGAGGTTGTTCC AACTTTTGGTTATGAGGAATTTCATGTTGAGCAAGAGGAGAATCCGGTCGATCAAGACGAACTTGACGGC CATAATGGCCTAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAAT TCCACACAACATACGAGCCGGAAGCATAAAGTGTAAAGCCTGGGGTGCCTAATGAGTGAGCTAACTCACA TTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCATTAATGAATCG GCCAACGCGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCGCTGCG CTCGGTCGTTCGGCTGCGGCGAGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCA GGGGATAACGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCGTAAAAAGGCCGCGT TGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCGACGCTCAAGTCAGAGGTG GCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCGCTCTCCTGTT CCGACCCTGCCGCTTACCGGATACCTGTCCGCCTTTCTCCCTTCGGGAAGCGTGGCGCTTTCTCATAGCT CACGCTGTAGGTATCTCAGTTCGGTGTAGGTCGTTCGCTCCAAGCTGGGCTGTGTGCACGAACCCCCCGT TCAGCCCGACCGCTGCGCCTTATCCGGTAACTATCGTCTTGAGTCCAACCCGGTAAGACACGACTTATCG CCACTGGCAGCAGCCACTGGTAACAGGATTAGCAGAGCGAGGTATGTAGGCGGTGCTACAGAGTTCTTGA AGTGGTGGCCTAACTACGGCTACACTAGAAGGACAGTATTTGGTATCTGCGCTCTGCTGAAGCCAGTTAC CTTCGGAAAAAGAGTTGGTAGCTCTTGATCCGGCAAACAAACCACCGCTGGTAGCGGTGGTTTTTTTGTT TGCAAGCAGCAGATTACGCGCAGAAAAAAAGGATCTCAAGAAGATCCTTTGATCTTTTCTACGGGGTCTG ACGCTCAGTGGAACGAAAACTCACGTTAAGGGATTTTGGTCATGAGATTATCAAAAAGGATCTTCACCTA GATCCTTTTAAATTAAAAATGAAGTTTTAAATCAATCTAAAGTATATATGAGTAAACTTGGTCTGACAGT TACCAATGCTTAATCAGTGAGGCACCTATCTCAGCGATCTGTCTATTTCGTTCATCCATAGTTGCCTGAC TCCCCGTCGTGTAGATAACTACGATACGGGAGGGCTTACCATCTGGCCCCAGTGCTGCAATGATACCGCG AGACCCACGCTCACCGGCTCCAGATTTATCAGCAATAAACCAGCCAGCCGGAAGGGCCGAGCGCAGAAGT GGTCCTGCAACTTTATCCGCCTCCATCCAGTCTATTAATTGTTGCCGGGAAGCTAGAGTAAGTAGTTCGC CAGTTAATAGTTTGCGCAACGTTGTTGCCATTGCTACAGGCATCGTGGTGTCACGCTCGTCGTTTGGTAT GGCTTCATTCAGCTCCGGTTCCCAACGATCAAGGCGAGTTACATGATCCCCCATGTTGTGCAAAAAAGCG GTTAGCTCCTTCGGTCCTCCGATCGTTGTCAGAAGTAAGTTGGCCGCAGTGTTATCACTCATGGTTATGG CAGCACTGCATAATTCTCTTACTGTCATGCCATCCGTAAGATGCTTTTCTGTGACTGGTGAGTACTCAAC CAAGTCATTCTGAGAATAGTGTATGCGGCGACCGAGTTGCTCTTGCCCGGCGTCAATACGGGATAATACC GCGCCACATAGCAGAACTTTAAAAGTGCTCATCATTGGAAAACGTTCTTCGGGGCGAAAACTCTCAAGGA TCTTACCGCTGTTGAGATCCAGTTCGATGTAACCCACTCGTGCACCCAACTGATCTTCAGCATCTTTTAC TTTCACCAGCGTTTCTGGGTGAGCAAAAACAGGAAGGCAAAATGCCGCAAAAAAGGGAATAAGGGCGACA CGGAAATGTTGAATACTCATACTCTTCCTTTTTCAATATTATTGAAGCATTTATCAGGGTTATTGTCTCA TGAGCGGATACATATTTGAATGTATTTAGAAAAATAAACAAATAGGGGTTCCGCGCACATTTCCCCGAAA AGTGCCACCTGACGTCTAAGAAACCATTATTATCATGACATTAACCTATAAAAATAGGCGTATCACGAGG CCCTTTCGTC

[0125] To test the capacity of this configuration for displaying monovalent antibody fragments (comprising human IgGs) (1 heavy chain immunoglobulin and 1 light chain immunoglobulin (H+L)) on the yeast cell wall, pGLY9008 was introduced into GFI 5.0 strains that have been selected previously as expression hosts of human anti-Her2 or anti-PCSK9 IgGs. An empty strain was included as a control (Table 1).

TABLE-US-00006 TABLE 1 Yeast Strains Strain mAb YGLY8316 Empty YGLY18483 Anti-PCSK9 (AX189) YGLY18281 Anti-PCSK9 (AX132) YGLY14755 Anti-PCSK9 (1DG) YGLY13979 Anti-Her2 YGLY14836 Anti-Her2 *These Pichia pastoris strains form part of the present invention

[0126] The glycoengineered Pichia pastoris monoclonal antibody production strains in Table 1 were grown in 50 mL BMGY media until the culture optical density, at 600 nm, was 2. The cells were washed three times with 1 M sorbitol and resuspended in 1 mL 1 M sorbitol. About 1-2 micrograms of Spel linearized pGLY9008 was mixed with these competent cells. Transformation was performed with a BioRad electroporation apparatus using the manufacturer's program specific for electroporation of nucleic acids into Pichia pastoris. One mL recovery media was added to the cells, which were then plated out on yeast-soytone-dextrose (YSD) media with 50 g/mL arsenite.

[0127] Growth and induction of Fc-monovalent antibody fragment (H+L) displaying yeast. Glycoengineered yeast expressing human IgGs and the Fc-SED1 bait expression cassette were inoculated using 600 L BMGY in a 96 deep well plate or 50 mL BMGY in a 250 mL shake flasks for two days. The cells were collected by centrifugation and the supernatant was discarded. The cells were induced by incubation in 300 L or 25 mL BMMY with PMTi inhibitor overnight following the methods described in international application publication no. WO2007/061631. Following induction, culture supernatants were assayed for antibody expression using Kappa ELISA, according to the manufacturer's protocol, and Protein A capture SDS-PAGE analysis. The data in FIGS. 3a and b, respectively, describe the results of both of these assays. As outlined in FIG. 3, supernatants of cultures containing the Fc-Sed1 protein bait were found to contain similar levels of secreted full antibody molecules (2 heavy chain immunoglobulins and 2 light chain immunoglobulins ((H2+L2)) compared to their parent strains (containing no Fc-Sed1p). This indicated that the presence of the Fc-Sed1p bait did not interfere with the yeast ability to secret full IgG antibodies (H2+L2).

[0128] To determine the efficiency of surface displaying antibodies using this method, cells were labeled with APC 635 labeled mouse anti-Human Kappa, which detects the light chain of human antibody molecules, and were processed by flow cytometry. Briefly, each culture, after growth to an optical density, at 600 nm, of 2, was pelleted by centrifugation and washed in 100 L PBS. Cells were incubated for 30 minutes at room temperature (RT) in 100 L phosphate buffer saline (PBS) containing fluorescently labeled (APC635) mouse anti-human Kappa light chain and washed in 100 l PBS. One hundred microliters of PBS was used to resuspend pellets before analyzing in a flow cytometer.

[0129] Flow cytometry analysis was conducted using the cells co-expressing Fc-Sed1p bait and anti-Her2, or Fc-Sed1p bait and anti-PCSK9. Controls were prepared in which an empty strain expressing Fc-Sed1p bait only or a strain that expressed full length antibody (H2+L2) without the Fc-Sed1p. Strains co-expressing anti-Her2 or anti-PCSK9 with the Fc-Sed1p bait were found to display significant levels of anti-Kappa binding while strains lacking the Fc-Sed1p bait showed background signal levels. In FIG. 4a-c, the fluorescent intensities from these experiments were compared. The Figure shows these different fluorescence intensities between the anti-Her2 displaying cells and the anti-PCSK9 displaying cells, and the parent strains that did not contain the Fc-Sed1p bait. It is noteworthy to mention that anti-Her2 displaying cells showed higher fluorescence intensity than the anti-PCSK9 displaying cells. These results were in congruence with what was known regarding expression levels of these two antibodies.

[0130] To establish the utility of this method for separating antibody mixtures, fluorescence-activated cell sorting (FACS) of a mixture of cells displaying Fc-Sed1p anti-PCSK9 monovalent antibody fragment (H+L) (strain YGLY21610) and Fc-Sed1p anti-Her2 (H+L) (strain YGLY21614) was performed as follows. The cells displaying anti-PCSK9 (H+L) and cells displaying anti-Her2 (H+L) were mixed together in the following ratio 1:0; 0:1; and 1:100. Cells were dually labeled with goat anti-human Fc Alexa 488 and 100 nM biotinylated PCSK9 and APC 635 labeled Streptavidin. FIG. 5 shows that Fc-Sed1p/anti-PCSK9 (H+L) was able to bind biotinylated PCSK9 while Fc-Sed1p/anti-Her2 (H+L) was not. Both strains reacted with anti-human Fc Alexa 488 antibody. Two separate populations of cells were visible when cells from both cultures were mixed at a 1:100 ratio of Fc-Sed1p anti-PCSK9 displaying cells (circled) to Fc-Sed1p anti-Her2 displaying cells. The number of PCSK9 binders in this mixture was in agreement with the 1:100 ratio, thus lending further support for the robustness of this method in screening antibodies with desired antigen-binding.

[0131] The above experiments demonstrated that the Fc-Sed1p antibody display system can be used to display IgG monovalent antibody fragments (H+L) that retain specific antigen binding of their corresponding full antibody molecules (H2+L2) dimers. The next goal was to use this method to isolate and enrich for novel antibody molecules that can bind to any antigen of interest. To this end we took advantage of two recently constructed libraries. Library one was constructed by changing the sequence of the heavy chain of anti-PCSK9 antibody AX189 while marinating the original light chain sequence. This library had a diversity of about 2500 unique sequences and will be referred to as BP550. The second library was generated by maintaining the original AX189 heavy chain sequence and changing the light chain sequence. This library contained about 4000 unique sequences and will be referred to as BP551.

[0132] BP550 and BP551 were transformed as described previously into strain YGLY21605 (empty 5.0 strain carrying pGLY9008-expressing Fc-Sed1p) and plated out on YSD containing 300 micrograms per milliliter zeocin. Approximately, 50,000 colonies were obtained for each transformation, thus providing ample statistical coverage of all possible sequences in the libraries. The colonies resulting from transforming the two libraries were scraped off the solid media and inoculated separately in 250 mL shake flasks containing 50 mL of YSG liquid medium with 300/mL zeocin. The cultures were passaged 3 times by re-inoculating 1 mL of each culture into the fresh selective liquid media (YSG+zeocin). The third passages were allowed to grow to saturation in YSG media and induced in 25 mL BMMY with PMTi inhibitor (PMTi4: L000001772; at a concentration of 1 micrograms/ml) overnight following the methods described in international patent publication no. WO2007/061631. Strains YGLY21610 (Fc-Sed1p anti-PCSK9 (AX189)) and YGLY21614 (Fc-Sed1p anti-Her2) were included as positive and negative controls, respectively.

[0133] After 24 hours of induction, each of the four cultures were grown to an optical density, at 600 nm, of 2. Pellets were collected by centrifugation and washed with 100 L 1 PBS then labeled in 100 L PBS containing anti-Kappa Alexa 488 and 100 nM of biotin-PCSK9. Mixtures were incubated at room temperature for 30 minutes then washed with 100 L PBS solution. Cells were incubated at room temperature with APC 635 labeled Streptavidin in 100 L PBS for 10 minutes and washed 2 in PBS and submitted for FACS.

[0134] Using the flow cytometer dot plots generated with YGLY21610 and YGLY21614 as boundaries to gate potential binders, clones from 100,000 cells of populations of both libraries, BP550 and BP551, were sorted in a FACS sorter and collected in 5 mL YSG media. Cultures were allowed to recover by shaking at room temperature for 5 days. Sorting round 1 pools were re-inoculated in 50 mL YSG liquid media and the same process was repeated to induce and label the cultures. Another round of sorting (round 2) was conducted on the round 1 pool and cells were collected as above and induced. To obtain single colonies, 1000 cells of both two-round sorted populations (BP550 and BP551) were plated out of solid media and were analyzed by Kappa ELISA and PCSK9 affinity ELISA to determine protein titer and binding affinities for PCSK9, respectively. Additionally, a yeast colony PCR amplification reaction was performed to amplify heavy chain and light chain genes of the round 2 clones which were submitted for DNA sequence analysis.

[0135] As shown in FIG. 6, two rounds of sorting using biotinylated PCSK9 antigen resulted in significant enrichment of specific PCSK9 binders. The PCSK9 ELISA compared presorted library to round 2 sorted pools for both BP550 and BP551 (FIG. 7). Round 2 sorted pools from both libraries contained a high percentage of binders over the presorted populations. DNA sequencing confirmed the enrichment for new anti-PCSK9 binding sequences.

[0136] The present invention is not to be limited in scope by the specific embodiments described herein. Indeed, the scope of the present invention includes embodiments specifically set forth herein and other embodiments not specifically set forth herein; the embodiments specifically set forth herein are not necessarily intended to be exhaustive. Various modifications of the invention in addition to those described herein will become apparent to those skilled in the art from the foregoing description. Such modifications are intended to fall within the scope of the claims.

[0137] Patents, patent applications, publications, product descriptions, and protocols are cited throughout this application, the disclosures of which are incorporated herein by reference in their entireties for all purposes.