Intrinsically disordered protein brushes
10196459 ยท 2019-02-05
Assignee
Inventors
- Sanjay Kumar (Moraga, CA, US)
- Nithya Srinivasan (Berkeley, CA, US)
- Maniraj Bhagawati (Hannover, DE)
- Badriprasad Ananthanarayanan (Albany, CA, US)
Cpc classification
C08L89/00
CHEMISTRY; METALLURGY
C08L89/00
CHEMISTRY; METALLURGY
C07K17/14
CHEMISTRY; METALLURGY
A61L2420/00
HUMAN NECESSITIES
International classification
C07K17/14
CHEMISTRY; METALLURGY
Abstract
The disclosure relates to molecular protein brushes and devices comprising regions of protein brushes.
Claims
1. A protein brush comprising: (a) a substrate, (b) a plurality of polypeptides, each polypeptide having a first end and second end, wherein the first end is linked to the substrate with an anchoring group selected from the group consisting of hydroxyl group, a thiol group, an azide group, a carboxylic acid group, an amide group, an amine group, an epoxide group, a vinyl group, peptide bond and a trichlorosilane group, wherein the polypeptides comprise a sequence of amino acids selected so as to not form secondary structure and having a desired primary sequence of charged amino acid residues so as to modulate bristle length and/or conformation, wherein the polypeptide comprises a sequence that is at least 95% identical to SEQ ID NO:3 having repeating units comprise tri-peptides containing lysine and proline, wherein the polypeptides change conformation with the ionic and/or pH of the environment.
2. The protein brush of claim 1, wherein the polypeptide contains approximately the same number of cationic and anionic amino acids to provide a net neutrally charged polypeptide.
3. The protein brush of claim 1, wherein the polypeptide comprises at least one or more phosphorylatable amino acids selected from serine, threonine and tyrosine.
4. The protein brush of claim 3, wherein the phosphorylatable amino acids can be phosphorylated or dephosphorylated to modulate the charge on the amino acid.
5. The protein brush of claim 1, wherein the polypeptide comprises repeating sequences of charged amino acids.
6. The protein brush of claim 1, wherein the polypeptide comprises a sequence of 30 to 100 amino acids in length that is at least 90-100% identical to SEQ ID NO:1 or SEQ ID NO:2.
7. The protein brush of claim 1, wherein the polypeptide further comprises a domain selected from the group consisting of (a) a protease cleavage site, (b) a purification domain, (c) a spacer sequence, (d) a second polypeptide domain of 30 to 100 amino acids in length that is at least 90-100% identical to SEQ ID NO:1 or SEQ ID NO:2 separated by (a), (b) and/or (c).
8. The protein brush of claim 7, wherein the polypeptide comprises a protease cleavage site.
9. The protein brush of claim 1, wherein the substrate is a polypeptide of interest.
10. The protein brush of claim 9, wherein the protein brush provides a cage around the polypeptide of interest.
11. The protein brush of claim 9, wherein the polypeptide can be cleaved from the polypeptide of interest.
12. The protein brush of claim 1, wherein the substrate is a metal, metalloid, polymer, ceramic, glass or plastic.
13. A device comprising the protein brush of claim 1, wherein the device is selected from the group consisting of catheters, balloons, catheter shafts, guide wires, filters, stents, stent grafts, cerebral aneurysm filler coils, vascular grafts, myocardial plugs, patches, pacemakers and pacemaker leads, heart valves, vascular valves and tissue engineering scaffolds.
14. A method of making the protein brush of claim 11, comprising linking a coding sequence for the polypeptide of interest to a sequence encoding the plurality of polypeptides using a sequence encoding a cleavable linker to provide a construct and expressing the construct, wherein the construct produces a protein brush having a structure: (a) a polypeptide of interest, (b) a cleavable linker, (c) a polypeptide, wherein the polypeptide comprise a sequence of amino acids selected so as to not form secondary structure and having a desired primary sequence of charged amino acid residues so as to modulate bristle length and/or conformation, and wherein the polypeptide change conformation with the ionic and/or pH of the environment, and (d) an anchoring group selected from the group consisting of hydroxyl group, a thiol group, an azide group, a carboxylic acid group, an amide group, an amine group, an epoxide group, a vinyl group, peptide bond and a trichlorosilane group.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The accompanying drawings, which are incorporated into and constitute a part of this specification, illustrate one or more embodiments of the disclosure and, together with the detailed description, serve to explain the principles and implementations of the invention.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
DETAILED DESCRIPTION
(24) As used herein and in the appended claims, the singular forms a, and, and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a probe includes a plurality of such cells and reference to the cell includes reference to one or more cells and equivalents thereof known to those skilled in the art, and so forth.
(25) Also, the use of or means and/or unless stated otherwise. Similarly, comprise, comprises, comprising include, includes, and including are interchangeable and not intended to be limiting.
(26) It is to be further understood that where descriptions of various embodiments use the term comprising, those skilled in the art would understand that in some specific instances, an embodiment can be alternatively described using language consisting essentially of or consisting of.
(27) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood to one of ordinary skill in the art to which this disclosure belongs. Although any methods and reagents similar or equivalent to those described herein can be used in the practice of the disclosed methods and compositions, the exemplary methods and materials are now described.
(28) All publications mentioned herein are incorporated herein by reference in full for the purpose of describing and disclosing the methodologies, which are described in the publications, which might be used in connection with the description herein. With respect to any term that is presented in one or more publications that is similar to, or identical with, a term that has been expressly defined in this disclosure, the definition of the term as expressly provided in this disclosure will control in all respects.
(29) Intrinsically disordered proteins (IDPs) are an emerging and important class of biomolecules with unique material properties that can be integrated into biological systems. The disclosure demonstrates that such IDPs can be engineered, expressed, purified and can be used to form monodisperse, oriented brushes on surfaces. Furthermore, these brushes are shown to collapse and swell in response to changes in solution ionic strength and pH, and that they can be enzymatically shaved to defined heights through the application of proteases directed to specific sequences within the chain.
(30) The amino acid sequence of IDPs endow them with extremely high structural flexibility, akin to synthetic polymers. This, coupled with the extensive biological applications of polymer-based materials, for example as drug delivery agents, cell culture matrices and surface-functionalization reagents for modulating interfacial properties, suggest a promising role of IDPs as bio-interfacial materials.
(31) A unique feature, as discussed further herein, of IDP-based materials relative to synthetic heteropolymers is the ability to precisely control monomeric sequence. IDP conformational properties and resulting interfacial behavior are controlled to a large extent by electrostatic interactions between charged residues. However, unlike synthetic polymers, where charged groups are either homogenously distributed over the polymer chain length or introduced as discrete blocks, IDPs allow precise control over the position of different charged residues. Phosphorylation represents an additional mechanism to reversibly control protein charge in a site-specific and dynamic manner. This precise control on position of charge over the polymer chain endows IDPs with superior potential as elements of responsive biomaterials. In recent years atomistic simulations for IDPs have been developed that highlight the importance of charge position, distribution, and resultant local conformational preferences within an IDP chain in controlling the overall conformations of the IDP. Furthermore, enzymatic control of charge on an IDP via phosphorylation, for example, provides a biologically relevant switch with which to control the interfacial characteristics of these molecules in vivo.
(32) The disclosure provides a protein-based polymer brush system whose conformational properties can be modulated by changes in pH and ionic strength. Notably, this material can be recombinantly expressed, forms brushes, and yields a about six- to tenfold dynamic range in brush thickness as ionic strength is varied and about a threefold range as pH is varied. This dynamic range is comparable to many existing synthetic polymer brush systems, thus providing an attractive complement or alternative to synthetic systems in specific settings. In addition, the dynamic range can be shifted, widened, or narrowed in interesting ways by exerting more control over the grafting density, such as by using cloud point grafting to achieve very dense brushes. Furthermore, proteases can be used to reduce the height of the brush in situ by cleaving the constituent chains at defined points. The extensive suite of proteases and protease recognition sitesany of which could be introduced into the sequence at one or more arbitrary positionsprovides a versatile toolbox for controlling intrinsically disordered protein (IDP) brush properties in a dynamic and specific manner. Analogous enzymatically addressable materials have been explored for a variety of applications such as payload delivery, diagnostic monitoring and ligand presentation.
(33) Polymer brushes form when macromolecular chains are end-tethered to surfaces at high grafting densities. The swelling and mutual steric repulsion of the polymers cause the chains to stretch and extend into the surrounding milieu, producing a molecular coating that can reduce non-specific interactions of the underlying surface with cells and biological macromolecules. Some polymer brushes are environment-sensitive, with specific changes in solvent conditions triggering their expansion or collapse. These materials can be used to exert dynamic control over the spatial presentation of regulatory peptides and are under investigation for many applications, including sensors, flow valves and controlled drug release systems. However, because these brushes are almost universally constructed from synthetic polymers, they are frequently somewhat heterogeneous and are challenging to modify at specific monomeric positions along the chain. While there have been notable successes integrating these materials with proteins to control biological function, such strategies require covalent conjugation of the protein to the polymer, which can be inefficient and can compromise biological function.
(34) These limitations are overcome by the present disclosure through the creation of a class of polymer brushes based on intrinsically disordered proteins (IDPs). As mentioned above, IDPs are attractive candidates for fabricating polymer/protein brushes primarily because they lack secondary structure and adopt an extended conformation. IDPs can also be designed and purified to near-perfect homogeneity, with the naturally occurring amino acids providing a chemically diverse palette for the control of chain properties such as charge distribution and hydrophobicity. In addition, the potential to synthesize proteins with either bioactive epitopes fused to IDP segments or sequences that can be enzymatically modified with high specificity provides an elegant way to create biofunctional interfaces.
(35) As is known, peptides and polypeptides are polymers of amino acids that contain multiple copies of the same or differing constitutional units. The number of constitutional units (e.g., amino acids) within a given peptide or polypeptide may vary widely, ranging, for example, from 5 to 10 to 25 to 50 to 100 to 1000 to 10,000 or more amino acid units. Polypeptides or peptides for use in the disclosure may have a variety of architectures, including linear and branched architectures. Branched architectures include architectures in which two or more chains emanate from a single branch point, comb architectures (e.g., architectures having a main chain and a plurality of side chains) and dendritic architectures (e.g., arborescent and hyperbranched polypeptides), among others.
(36) As used herein, the terms polypeptide and protein are used interchangeably, unless specified to the contrary, and according to conventional meaning, i.e., as a sequence of amino acids. Polypeptides are not limited to a specific length, e.g., they may comprise a full length protein sequence or a fragment of a full length protein, and may include post-translational modifications of the polypeptide, for example, glycosylations, acetylations, phosphorylations and the like, as well as other modifications known in the art, both naturally occurring and non-naturally occurring. Polypeptides of the disclosure may be prepared using any of a variety of well-known recombinant and/or synthetic techniques, illustrative examples of which are further discussed below.
(37) Protein brush or Protein brushes, as the name suggests, contain proteins, polypeptide or peptides, one end of which is directly or indirectly tethered to a surface and another end of which is free to extend from the surface, somewhat analogous to the bristles of a brush. In the devices of the disclosure, protein brushes are employed, which have one or more types of polymeric amino acid chains (e.g., polypeptide). pH and ionic strength as well as other external environmental factors can modify the form of the polypeptide due to the side-group characteristics of each amino acid. As a result of this ability to change properties, such protein brushes are stimulus responsive. IDPs are highly flexible molecules, which do not have a defined 3D structure but behave as random coils, akin to synthetic polymers. One of the major in vivo functions of IDPs is their activity as entropic bristles.
(38) As used herein, protein brush regions are surface regions comprising a protein brush. Protein brush regions may be created by various methods, including covalent and non-covalent (e.g., physical adsorption) attachment. In one example of non-covalent attachment, a polypeptide is adsorbed onto a substrate, with, for example, a chain of amino acids interacting strongly with the surface of a substrate and the other chains of amino acids forming the brushes. For example, a polypeptide can comprise a compatible end that contacts the device surface (e.g., a polymer surface modified to for attachment) such that it becomes adsorbed to the surface. A second polypeptide chain may then be linked to the first chain.
(39) While physical adsorption is relatively simple to carry out, covalent techniques may be used in some embodiments, due to the stability and enhanced control over the protein density, which may be afforded by such techniques. Covalent attachment of polypeptide to form protein brushes is commonly achieved by substrate modification. Such modification include providing anchoring groups on the substrate. Examples of anchoring groups include substituted or unsubstituted hydroxyl groups, thiol groups, azide groups, carboxylic acid groups, amide groups, epoxide groups, vinyl groups and trichlorosilane groups.
(40) Each of these techniques involves the attachment of a species (e.g., a polymer or an initiator) to a surface, which may be carried out using a number of techniques that are known in the art. For instance, covalent coupling of species to a substrate surface, each having reactive functional groups, may be carried out by direct reaction between the functional groups, or through the use of linking/coupling agents that contain reactive moieties capable of reaction with such functional groups. Specific examples of known linking agents include glutaraldehyde, diisocyanates, diiosothiocyanates, bis(hydroxysuccinimide)esters, maleimidehydroxysuccinimide esters, carbodiimides, N,N-carbonyldiimidazole imidoesters, and difluorobenzene derivatives, among others. One ordinarily skilled in the art will recognize that any number of other coupling agents may be used depending on the functional groups present.
(41) For many substrates, including polymer substrates, surface functional groups may be introduced by treating the substrate with a reactive plasma. For example, gas discharge techniques, in which surface modification is achieved by exposing the surface to a partially ionized gas (e.g., to a plasma). Because the plasma phase consists of a wide spectrum of reactive species (electrons, ions, etc.) these techniques have been used widely for functionalization of surfaces. Two types of processes are frequently described, depending on the operating pressure: corona discharge techniques (which are conducted at atmospheric pressure) and glow discharge techniques (which are conducted at reduced pressure). Glow discharge techniques may be preferred over corona discharge techniques in certain embodiments, because the shape of the object to be treated is of minor importance during glow discharge processes. Moreover, glow discharge techniques are usually either operated in an etching or in a depositing mode, depending on the gas used, whereas corona discharge techniques are usually operated in an etching mode. A commonly employed glow discharge technique is radio-frequency glow discharge (RFGD).
(42) Plasma treatment processes may be used to etch, crosslink and/or functionalize polymer surfaces, with these processes typically occurring simultaneously at a polymer surface that is exposed to a discharge of a non-polymerizable gas. The gas that is used primarily determines which of these processes is dominant.
(43) One of skill in the art will readily recognize the many known methods for modifying a surface for attachment of a protein, polypeptide or peptide.
(44) Polypeptides that can be used to form a bristle of a protein brush can comprise a number of different sequences. These sequences can be designed to include various amino acids with desired side groups to control the length, structure, interaction and responsiveness to the environment. The peptide/polypeptide bristles generally comprise amino acid residues linked and characterized such that do not have a tendency to form secondary structure.
(45) In one embodiment, the disclosure describes stimuli-responsive IDPs that can be assembled onto a surface of a substrate to form a protein brush. In one embodiment, the design is based on the disordered C-terminal sidearm domain of the heavy subunit of the neurofilament complex (NF-H) (see, SEQ ID NO:1 and GenBank Accession No. NP_066554.2, incorporated herein by reference), which functions as an entropic spring that facilitates the assembly, mechanics and transport of neurofilaments (NFs) in the neuronal cytoskeleton. This subunit has two notable features: first, it contains a large and nearly equal number of cationic (Lys, Arg) and anionic (Glu, Asp) residues, rendering it highly charged locally but nominally neutral globally. Second, it consists of a series of Lys-Ser-Pro (KSP) motifs, which allows for the modulation of protein charge in vivo via phosphorylation of the Ser residues.
(46) In another embodiment, the disclosure describes an engineered protein (rNFH-SA) comprising residues 426-1066 from the rat NF-H sidearm domain (see, e.g., SEQ ID NO:2), flanked by an N-terminal tetra-Cys tag and a C-terminal poly-His-Asn tag. The rNFH-SA adopts an extended, disordered conformation in solution and can be grafted in an oriented manner to solid supports to yield IDP brushes that swell and collapse in response to changes in solution pH and ionic strength. The heights of these brushes may be modulated through the application of proteases that recognize specific sequences within the brush.
(47) SEQ ID NO:1 (homo sapiens NF-H):
(48) TABLE-US-00001 1 mmsfggadallgapfaplhgggslhyalarkggaggtrsaagsssgfhswtrtsvssvsa 61 spsrfrgagaasstdsldtlsngpegcmvavatsrsekeqlqalndrfagyidkvrqlea 121 hnrslegeaaalrqqqagrsamgelyerevremrgavlrlgaargqlrleqehllediah 181 vrqrlddearqreeaeaaaralarfaqeaeaarvdlqkkaqalqeecgylrrhhqeevge 241 llgqiqgsgaaqaqmqaetrdalkcdvtsalreiraqleghavqstlqseewfrvrldrl 301 seaakvntdamrsaqeeiteyrrqlqarttelealkstkdslerqrseledrhqadiasy 361 qeaiqqldaelrntkwemaaqlreyqdllnvkmaldieiaayrkllegeecrigfgpipf 421 slpeglpkipsvsthikvkseekikvvekseketviveeqteetqvteevteeeekeake 481 eegkeeeggeeeeaeggeeetksppaeeaaspekeakspvkeeakspaeakspekeeaks 541 paevkspekakspakeeaksppeakspekeeakspaevkspekakspakeeakspaeaks 601 pekakspvkeeakspaeakspvkeeakspaevkspekaksptkeeakspekakspekeea 661 kspekakspvkaeakspekakspvkaeakspekakspvkeeakspekakspvkeeakspe 721 kakspvkeeaktpekakspvkeeakspekakspekaktldvkspeaktpakeearspadk 781 fpekakspvkeevkspekaksplkedakapekeipkkeevkspvkeeekpqevkvkeppk 841 kaeeekapatpkteekkdskkeeapkkeapkpkveekkepavekpkeskveakkeeaedk 901 kkvptpekeapakvevkedakpkektevakkepddakakepskpaekkeaapekkdtkee 961 kakkpeekpkteakakeddktlskepskpkaekaekssstdqkdskppekatedkaakgk
(49) SEQ ID NO:2 (Rattus norvegicus NF-H):
(50) TABLE-US-00002 1 mmsfgsadallgapfaplhgggslhyalsrkagaggtrsaagsssgfhswartsvssvsa 61 spsrfrgaasstdsldtlsngpegcvaavaarsekeqlqalndrfagyidkvrqleahnr 121 tlegeaaalrqqkgraamgelyerevremrgavlrlgaarghvrleqehllediahvrqr 181 ldeearqreeaeaaaralarfaqeaeaarvelqkkaqalqeecgylrrhhqeevgellgq 241 iqgcgaaqaqaqaeardalkcdvtsalreiraqleghtvqstlqseewfrvrldrlseaa 301 kvntdamrsaqeeiteyrrqlqarttelealkstkeslerqrseledrhqvdmasyqdai 361 qqldnelrntkwemaaqlreyqdllnvkmaldieiaayrkllegeecrigfgpspfslte 421 glpkipsmsthikvkseekikvvekseketviveeqteeiqvteevteeedkeaggeeee 481 eaeeggeeaattsppaeeaaspeketkspvkeeakspaeakspaeakspaeakspaevks 541 paevkspaeakspaeakspaevkspatvkspaeakspaeakspaevkspatvkspgeaks 601 paeakspaevkspveakspaeakspasvkspgeakspaeakspaevkspatvkspveaks 661 paevkspvtvkspaeakspvevkspasvkspseakspagakspaeakspvvakspaeaks 721 paeakppaeakspaeakspaeakspaeakspaeakspvevkspekakspvkegakslaea 781 kspekakspvkeeikppaevkspekakspmkeeakspekaktldvkspeaktpakeeakr 841 padirspeqvkspakeeakspekeetrtekvapkkeevkspveevkakeppkkveeektp 901 atpktevkeskkdeapkeaqkpkaeekepltekpkdspgeakkeeakekkaaapeeetpa 961 klgvkeeakpkekaedakakepskpsekekpkkeevpaapekkdtkeektteskkpeekp 1021 kmqakakeedkglpqepskpktekaekssstdqkdsqpsekapedkaakgdk
(51) In one embodiment, the protein bristle can comprise a sequence that is at least 90-100% identical to SEQ ID NO:1 or 2. In another embodiment, the protein bristle comprises a sequence that is a fragment of SEQ ID NO:1 or 2 and comprises at least 90-100% identity to SEQ ID NO:1 or 2. In still another or further embodiment, the protein bristle can comprise one or more additional domains. For example, as set forth above, the bristle can comprise a sequence and/or fragment having identity to SEQ ID NO:1 or 2 and can include at least one additional domain selected from the group consisting of (a) a protease cleavage site, (b) a purification domain, (c) a spacer sequence, (d) a further domain having a sequence 90-100% identical to SEQ ID NO:1 or 2 separated by (a), (b) and/or (c), and any combination of the foregoing. In one embodiment, the polypeptide is charge neutral (e.g., the total charge of each amino acid in the polypeptide added up results in a net neutral polypeptide). In a further embodiment, the charge neutral polypeptide can comprise phosphorylatable amino acids that can be phosphorylated or de-phosphorylated in order to modulate the charge of the polypeptide. In another embodiment, a first end of the polypeptide can be linked or conjugated to a surface and the second end of the polypeptide is free. In a further embodiment, the second end extends substantially vertically from the surface (e.g., a planar surface) of the substrate under conditions that promote extension of the polypeptide. In another embodiment, the polypeptide can have a plurality of domains (e.g., a domain substantially identical to SEQ ID NO:1 or 2 and a second domain comprising a protease cleavage site). In another embodiment, the second end of the polypeptide (e.g., the free end) can comprise a domain or moiety that promotes binding or interaction with a device or biological factor.
(52)
(53) Using a solid-phase peptide synthesizer, various types of bristle polypeptides can be generated. For example, the disclosure demonstrates the generation of two 32-residue peptides based on the NF-H sidearm domain. The first peptide contained four KSP motifs (KSP peptide), while in the second the serine residues were replaced with aspartate residues (KDP peptide) (
(54) A variety of devices and portions thereof may be provided with protein brush regions including, for example, catheters (e.g., renal or vascular catheters), balloons, catheter shafts, guide wires, filters (e.g., vena cava filters), stents (including coronary vascular stents, cerebral, urethral, ureteral, biliary, tracheal, gastrointestinal and esophageal stents), stent grafts, cerebral aneurysm filler coils (including Guglilmi detachable coils and metal coils), vascular grafts, myocardial plugs, patches, pacemakers and pacemaker leads, heart valves, vascular valves, tissue engineering scaffolds for cartilage, bone, skin and other in vivo tissue regeneration, and so forth.
(55) The protein brushes may be provided over the entire surface of the medical device or over only a portion of the medical device surface. For example, with tubular devices such as stents, protein brushes may be provided over the entire surface of the stent, or they may be provided on the inner luminal surface of the stent, on the outer abluminal surface of the stent, and/or on the lateral surfaces between the luminal and abluminal surfaces (including the ends). The protein brushes may be provided in desired patterns, for instance, using appropriate masking techniques. As another example, protein brushes may be provided over some device components but not others (e.g., over the balloon of a balloon catheter, but not over the catheter shaft).
(56) For example, it is known that adhesion between a balloon and surrounding stent can lead to an increase in the force that is needed for balloon withdrawal. The use of the brushes of the disclosure can reduce the needed force by coating the balloon or lumen of the catheter/stent with the polypeptides described herein.
(57) An advantage of a protein brush surface having both hydrophilic and hydrophobic chains is that the surface will reorient once it is exposed to an aqueous environment, resulting in a surface that is primarily composed of hydrophilic chains such that a hydrophilic surface is presented to the surrounding environment. Therefore, the device biocompatibility will actually change after the device is deployed.
(58) Protein brush regions may be provided over a number of medical device substrates. Materials for use as underlying medical device substrates include (a) organic materials (e.g., materials containing 50 wt % or more organic species) such as polymeric materials and (b) inorganic materials (e.g., materials containing 50 wt % or more inorganic species), such as metallic materials (e.g., metals and metal alloys) and non-metallic materials (e.g., including carbon, semiconductors, glasses and ceramics, which may contain various metal- and non-metal-oxides, various metal- and non-metal-nitrides, various metal- and non-metal-carbides, various metal- and non-metal-borides, various metal- and non-metal-phosphates, and various metal- and non-metal-sulfides, among others).
(59) Specific examples of non-metallic inorganic materials may be selected, for example, from materials containing one or more of the following: metal oxides, including aluminum oxides and transition metal oxides (e.g., oxides of titanium, zirconium, hafnium, tantalum, molybdenum, tungsten, rhenium, and iridium); silicon; silicon-based ceramics, such as those containing silicon nitrides, silicon carbides and silicon oxides (sometimes referred to as glass ceramics); calcium phosphate ceramics (e.g., hydroxyapatite); carbon; and carbon-based, ceramic-like materials such as carbon nitrides.
(60) Specific examples of metallic inorganic materials may be selected, for example, from metals (e.g., biostable metals such as gold, platinum, palladium, iridium, osmium, rhodium, titanium, tantalum, tungsten, and ruthenium, and bioresorbable metals such as magnesium) and metal alloys, including metal alloys comprising iron and chromium (e.g., stainless steels, including platinum-enriched radiopaque stainless steel), alloys comprising nickel and titanium (e.g., Nitinol), alloys comprising cobalt and chromium, including alloys that comprise cobalt, chromium and iron (e.g., elgiloy alloys), alloys comprising nickel, cobalt and chromium (e.g., MP 35N), alloys comprising cobalt, chromium, tungsten and nickel (e.g., L605), and alloys comprising nickel and chromium (e.g., inconel alloys).
(61) Specific examples of organic materials may be selected, for example, from the following: polycarboxylic acid polymers and copolymers including polyacrylic acids; acetal polymers and copolymers; acrylate and methacrylate polymers and copolymers (e.g., n-butyl methacrylate); cellulosic polymers and copolymers, including cellulose acetates, cellulose nitrates, cellulose propionates, cellulose acetate butyrates, cellophanes, rayons, rayon triacetates, and cellulose ethers such as carboxymethyl celluloses and hydroxyalkyl celluloses; polyoxymethylene polymers and copolymers; polyimide polymers and copolymers such as polyether block imides and polyether block amides, polyamidimides, polyesterimides, and polyetherimides; polysulfone polymers and copolymers including polyarylsulfones and polyethersulfones; polyamide polymers and copolymers including nylon 6,6, nylon 12, polycaprolactams and polyacrylamides; resins including alkyd resins, phenolic resins, urea resins, melamine resins, epoxy resins, allyl resins and epoxide resins; polycarbonates; polyacrylonitriles; polyvinylpyrrolidones (cross-linked and otherwise); polymers and copolymers of vinyl monomers including polyvinyl alcohols, polyvinyl halides such as polyvinyl chlorides, ethylene-vinyl acetate copolymers (EVA), polyvinylidene chlorides, polyvinyl ethers such as polyvinyl methyl ethers, polystyrenes, styrene-maleic anhydride copolymers, vinyl-aromatic-alkylene copolymers, including styrene-butadiene copolymers, styrene-ethylene-butylene copolymers (e.g., a polystyrene-polyethylene/butylene-polystyrene (SEBS) copolymer, available as Kraton. G series polymers), styrene-isoprene copolymers (e.g., polystyrene-polyisoprene-polystyrene), acrylonitrile-styrene copolymers, acrylonitrile-butadiene-styrene copolymers, styrene-butadiene copolymers and styrene-isobutylene copolymers (e.g., polyisobutylene-polystyrene and polystyrene-polyisobutylene-polystyrene block copolymers such as those disclosed in U.S. Pat. No. 6,545,097 to Pinchuk), polyvinyl ketones, polyvinylcarbazoles, and polyvinyl esters such as polyvinyl acetates; polybenzimidazoles; ethylene-methacrylic acid copolymers and ethylene-acrylic acid copolymers, where some of the acid groups can be neutralized with either zinc or sodium ions (commonly known as ionomers); polyalkyl oxide polymers and copolymers including polyethylene oxides (PEG); polyesters including polyethylene terephthalates and aliphatic polyesters such as polymers and copolymers of lactide (which includes lactic acid as well as d-, l- and meso lactide), epsilon-caprolactone, glycolide (including glycolic acid), hydroxybutyrate, hydroxyvalerate, para-dioxanone, trimethylene carbonate (and its alkyl derivatives), 1,4-dioxepan-2-one, 1,5-dioxepan-2-one, and 6,6-dimethyl-1,4-dioxan-2-one (a copolymer of poly(lactic acid) and poly(caprolactone) is one specific example); polyether polymers and copolymers including polyarylethers such as polyphenylene ethers, polyether ketones, polyether ether ketones; polyphenylene sulfides; polyisocyanates; polyolefin polymers and copolymers, including polyalkylenes such as polypropylenes, polyethylenes (low and high density, low and high molecular weight), polybutylenes (such as polybut-1-ene and polyisobutylene), polyolefin elastomers (e.g., santoprene), ethylene propylene diene monomer (EPDM) rubbers, poly-4-methyl-pen-1-enes, ethylene-alpha-olefin copolymers, ethylene-methyl methacrylate copolymers and ethylene-vinyl acetate copolymers; fluorinated polymers and copolymers, including polytetrafluoroethylenes (PTFE), poly(tetrafluoroethylene-co-hexafluoropropene) (FEP), modified ethylene-tetrafluoroethylene copolymers (ETFE), and polyvinylidene fluorides (PVDF); silicone polymers and copolymers; thermoplastic polyurethanes (TPU); elastomers such as elastomeric polyurethanes and polyurethane copolymers (including block and random copolymers that are polyether based, polyester based, polycarbonate based, aliphatic based, aromatic based and mixtures thereof; examples of commercially available polyurethane copolymers include Bionate, Carbothane, Tecoflex, Tecothane, Tecophilic, Tecoplast, Pellethane, Chronothane and Chronoflex); p-xylylene polymers; polyiminocarbonates; copoly(ether-esters) such as polyethylene oxide-polylactic acid copolymers; polyphosphazines; polyalkylene oxalates; polyoxaamides and polyoxaesters (including those containing amines and/or amido groups); polyorthoesters; biopolymers, such as polypeptides, proteins, polysaccharides and fatty acids (and esters thereof), including fibrin, fibrinogen, collagen, elastin, chitosan, gelatin, starch, glycosaminoglycans such as hyaluronic acid; as well as further copolymers and blends of the above.
(62) Where implantable or insertable medical devices are provided which contain protein brush regions that regulate the release of therapeutic agents, the release profile associated with such devices may be modified, for example, by changing the chemical composition, size, and/or number of the protein brush regions on the device, among other parameters. For example, the release profile may be affected by the concentration of therapeutic agent(s) within the protein brush region(s), by the amino acid composition of the protein brush region(s), by the surface area of the protein brush region(s), and so forth. Multiple protein brush region(s), having either the same content or different content (e.g., different protein and/or therapeutic agent content), may be provided on the medical device surfaces. Hence, protein brush region(s) may be adapted to release the same or different therapeutic agents, at the same or different rates, from different locations on the medical device. For instance, a tubular medical device (e.g., a vascular stent) may be provided which has a protein brush region that contains or is disposed over an antithrombotic agent at its inner, luminal surface and a second protein brush region which contains or is disposed over therapeutic agents at its outer, abluminal surface (as well as on the ends, if desired).
(63) As noted above, a medical devices of the disclosure can optionally contain one or more therapeutic agents. Therapeutic agents, drugs, pharmaceutically active agents, pharmaceutically active materials, and other related terms may be used interchangeably herein. These terms include genetic therapeutic agents, non-genetic therapeutic agents and cells.
(64) Therapeutic agents include, for example, adrenergic agents, adrenocortical steroids, adrenocortical suppressants, alcohol deterrents, aldosterone antagonists, amino acids and proteins, ammonia detoxicants, anabolic agents, analeptic agents, analgesic agents, androgenic agents, anesthetic agents, anorectic compounds, anorexic agents, antagonists, anterior pituitary activators and suppressants, anthelmintic agents, anti-adrenergic agents, anti-allergic agents, anti-amebic agents, anti-androgen agents, anti-anemic agents, anti-anginal agents, anti-anxiety agents, anti-arthritic agents, anti-asthmatic agents, anti-atherosclerotic agents, antibacterial agents, anticholelithic agents, anticholelithogenic agents, anticholinergic agents, anticoagulants, anticoccidal agents, anticonvulsants, antidepressants, antidiabetic agents, antidiuretics, antidotes, antidyskinetics agents, anti-emetic agents, anti-epileptic agents, anti-estrogen agents, antifibrinolytic agents, antifungal agents, antiglaucoma agents, antihemophilic agents, antihemophilic Factor, antihemorrhagic agents, antihistaminic agents, antihyperlipidemic agents, antihyperlipoproteinemic agents, antihypertensives, antihypotensives, anti-infective agents, anti-inflammatory agents, antikeratinizing agents, antimicrobial agents, antimigraine agents, antimitotic agents, antimycotic agents, antineoplastic agents, anti-cancer supplementary potentiating agents, antineutropenic agents, antiobsessional agents, antiparasitic agents, antiparkinsonian drugs, antipneumocystic agents, antiproliferative agents, antiprostatic hypertrophy drugs, antiprotozoal agents, antipruritics, antipsoriatic agents, antipsychotics, antirheumatic agents, antischistosomal agents, antiseborrheic agents, antispasmodic agents, antithrombotic agents, antitussive agents, anti-ulcerative agents, anti-urolithic agents, antiviral agents, benign prostatic hyperplasia therapy agents, blood glucose regulators, bone resorption inhibitors, bronchodilators, carbonic anhydrase inhibitors, cardiac depressants, cardioprotectants, cardiotonic agents, cardiovascular agents, choleretic agents, cholinergic agents, cholinergic agonists, cholinesterase deactivators, coccidiostat agents, cognition adjuvants and cognition enhancers, depressants, diagnostic aids, diuretics, dopaminergic agents, ectoparasiticides, emetic agents, enzyme inhibitors, estrogens, fibrinolytic agents, free oxygen radical scavengers, gastrointestinal motility agents, glucocorticoids, gonad-stimulating principles, hemostatic agents, histamine H2 receptor antagonists, hormones, hypocholesterolemic agents, hypoglycemic agents, hypolipidemic agents, hypotensive agents, HMGCoA reductase inhibitors, immunizing agents, immunomodulators, immunoregulators, immunostimulants, immunosuppressants, impotence therapy adjuncts, keratolytic agents, LHRH agonists, luteolysin agents, mucolytics, mucosal protective agents, mydriatic agents, nasal decongestants, neuroleptic agents, neuromuscular blocking agents, neuroprotective agents, NMDA antagonists, non-hormonal sterol derivatives, oxytocic agents, plasminogen activators, platelet activating factor antagonists, platelet aggregation inhibitors, post-stroke and post-head trauma treatments, progestins, prostaglandins, prostate growth inhibitors, prothyrotropin agents, psychotropic agents, radioactive agents, repartitioning agents, scabicides, sclerosing agents, sedatives, sedative-hypnotic agents, selective adenosine Al antagonists, serotonin antagonists, serotonin inhibitors, serotonin receptor antagonists, steroids, stimulants, thyroid hormones, thyroid inhibitors, thyromimetic agents, tranquilizers, unstable angina agents, uricosuric agents, vasoconstrictors, vasodilators, vulnerary agents, wound healing agents, xanthine oxidase inhibitors, and the like.
(65) In addition, the protein brush technology described herein can be used to coat a biological molecule or drug. For example, protein brushes comprising intrinsically disordered proteins (IDP) can be used to interfer/modulate protein-protein interactions (PPI). In this model, an intrinsically disordered domain of a folded protein, or an IDP fused to a folded functional protein of interest (POI), by virtue of its flexibility, can cover a large space around its attachment point, and thus create a region of exclusion around its partner. This restricts larger molecules such as proteins from the proximity, while salts and cofactors should not be excluded. Thus, the IDP creates an entropic cage which impedes the POI from interacting with its partner thereby preventing protein-protein interaction. Naturally occurring examples of such systems are the intrinsically disordered domains of neurofilament proteins that control neurofilament-spacing, and the projection domains of tau protein that control the distance between microtubules. Another example is the C-terminal disordered domain of Knr4 (a yeast hub protein interacting with more than 30 distinct proteins), which strongly attenuates the interaction of Knr4 with its interaction partners. Thus, intrinsically disordered regions as entropically-driven perturbers of PPIs have been established for some isolated cases.
(66) Based on these observations, IDPs can be used to control PPIs. In one embodiment, one or more IDPs for a bristle or brush on a protein of interest via a cleavable linker (protease cleavage site, photocleavable amino acid etc.) so as to cage the POI and completely abrogate its interaction with native interaction partners (
(67) Although much effort has focused on understanding the biological function of endogenous IDPs, the disclosure demonstrates that IDPs represent an untapped resource for biomaterial design. IDPs can be used as biosynthetic coatings, fusion proteins whose functions may be sterically gated, and novel cell surface engineering strategies. As described herein, IDPs can be designed de novo, synthesized at high purity, and chemically tailored at specific positions along the chain through mutagenesis. IDP sequences can be optimized for specific applications through directed-evolution approaches and synthesized to include bio-orthogonal chemical moieties via the use of unnatural amino acids. Indeed, IDPs based on nucleoporin proteins have recently been incorporated into synthetic gated pores and surface-grafted layers, supporting the idea that IDPs can be manipulated in ways that are analogous to synthetic polymers. Together with these efforts, our work hints at the value of exploring IDPs as a new class of smart biomaterial building blocks.
(68) The disclosure is illustrated in the following examples, which are provided by way of illustration and are not intended to be limiting.
EXAMPLES
Example 1
(69) Cloning and expression of rNFH-SA. Expression vectors were constructed by modifying the multiple cloning site of pET6HN-C (Clontech Inc.) to include the EcoR1 and HindIII restriction enzyme recognition sequences. The modified expression vector was digested with EcoR1 and HindIII and subsequently purified. A HindIII restriction enzyme site was introduced at the end of NFH-SA gene cloned in pCIneo by site-directed mutagenesis. The modified NFH-SA gene was excised from the pCIneo vector by EcoR1 and HindIII digestion, ligated to the linearized, modified pET6HN-C vector, and transformed into competent Escherichia coli cells. Plasmids isolated from the resulting transformants were screened by a diagnostic restriction enzyme digestion and sequenced.
(70) The expression vector was transformed into the E. coli Rosetta strain (Novagen) for expression. Confluent starter cultures (grown overnight) were transferred to expression cultures and incubated with shaking at 37 C. Expression was induced by the addition of isopropyl b-D-1-thiogalactopyranoside to a final concentration of 0.75 mM. The cells were typically harvested 3 h after induction by centrifugation at 3,000 g for 20 min at 4 C.
(71) Purification of rNFH-SA. The cell pellet was resuspended in 20 mM Tris pH 8.0, 300 mM NaCl, 1 mM tris(2-carboxyethyl)phosphine hydrochloride (TCEP), 1 mM phenylmethanesulfonylfluoride and lysed by sonic disruption at 4 C. The cell lysate was centrifuged at 20,000 g for 15 min at 4 C. to remove insoluble cellular matter and then applied to a nickel-nitrilotriacetic acid affinity column. After subsequent washes with increasing concentration of imidazole, the purified protein was eluted using 200 mM imidazole. Ion exchange chromatography using a linear elution gradient of increasing ionic strength over a diethylaminoethyl cellulose anion exchange resin was used as a polishing step to improve purity when needed.
(72) Circular dichroism. CD spectra were recorded from 250 to 190 nm on a Jasco-720 spectropolarimeter. Spectra were obtained using a cuvette with a 1-mm path length at 25 C. at a bandwidth of 1 nm with a scanning rate of 10 nm s.sup.1 in continuous scanning mode and a response time of 5 s. The collected raw spectra were buffer subtracted and converted from millidegrees to molar ellipticity. To study the protein under different solution conditions, the protein was desalted into distilled water, lyophilized and then re-dissolved in the appropriate pH/ionic strength solution. Appropriate controls were included to ensure that desalting and lyophilization did not introduce conformational changes.
(73) The solutions used in this study include water at pH 2.4, 6.3 and 10.9, and water with 50 mM NaCl at pH 2.4 and 10.9.
(74) Dynamic light scattering. Dynamic light scattering experiments were performed on a Dynapro Nanostar (Wyatt Technology, Santa Barbara, Calif., USA) operating at 658 nm. Measurements were performed at room temperature (25 C.) in triplicates, in 20 mM Tris pH 8.0, 1 mM TCEP. All data were analyzed using a dedicated software package (Dynamics, version 7.1, Wyatt Technology). To study the effect of different solution conditions, the protein solution was prepared as described for circular dichroism.
(75) Functionalization of silica and quartz surfaces. Functionalization of silica coverslips for AFM, quartz substrates for QCM-D experiments and silicon substrates for ellipsometry were carried out as described by Waichman et al. (Anal. Chem. 82, 1478-1485 (2010)). Substrates were activated via plasma cleaning prior to functionalization. After rinsing with water and drying in a nitrogen stream, the surfaces were subsequently silanized with glycidyloxypropyltrimethoxysilane (GOPTS) for 45 min at 75 C. The surfaces were then rinsed with acetone and reacted with diamino-polyethylene glycol (molecular weight of 400 Da) for 4 h at 75 C. After rinsing with water and drying in a nitrogen stream, the surface amines were reacted with a saturated solution of 3-(Maleimido)propionic acid N-hydroxysuccinimide ester (NHS-maleimide) in dry dimethylformamide for 45 min at room temperature to yield maleimide-functionalized surfaces. This sequence of reactions is shown in
(76) Quartz crystal microbalance with dissipation. QCM-D measurements were performed with a Q-Sense E4 system. Quartz crystals with fundamental frequencies of B5 MHz were functionalized as described in the previous section and used for immobilization of rNFH-SA. Either 0.5 or 5 mg ml.sup.1 of the rNFH-SA solution was prepared in PBS at pH 7.5 and injected into the flow cell with a rate of typically 50 ml min.sup.1, using a syringe pump. Change in frequency (Df) and dissipation (DD) were measured at five overtones (n 3, 5 y 11) simultaneously. After an initial binding was observed, the pump was turned off and the protein was incubated on the surface for either 4 h (0.5 mg ml.sup.1) or 20 h (5 mg ml.sup.1) depending on the protein concentration. The adsorbed protein on the crystal was then washed with buffer to remove any non-specifically bound material. The data were fit using the Voight-Voinova model for viscoelastic films to obtain the mass of the hydrated protein layer bound to the surface.
(77) Spectroscopic ellipsometry. Silicon wafers (UniversityWafer, Inc.) were cut into 1 cm.sup.2 pieces for use as SE substrates. The substrates were functionalized as described herein. SE measurements were conducted on an alpha-SE system (J.A. Woollam Co., Inc.) at an angle of incidence of 70 in the spectral range of 380 to 890 nm under air at room temperature. Data was collected on surfaces functionalized with the NHS-maleimide cross-linker to model the underlying surface chemistry consisting of GOPTS, diamino-polyethylene glycol and the cross-linker. The height and refractive index obtained from this analysis was then used to model the data collected on surfaces functionalized with the rNFH-SA. Ellipsometric data were modelled using the CompleteEASE software.
(78) Modeling of SE data and calculation of surface density. All spectroscopic ellipsometry (SE) data were modeled using the CompleteEASE software (J.A. Woollam Co., Inc). The refractive indices, of the surface layers were described using the Cauchy dispersion model as:
(79)
where A, B and C are fitting parameters and is the wavelength. SE data from substrates functionalized with glycidyloxypropyltrimethoxysilane (GOPTS), diamino-polyethylene glycol (DAPEG) and 3-(Maleimido)propionic acid N-hydroxysuccinimide ester crosslinker were first analyzed using an optical model consisting of one Cauchy layer on top of a silicon substrate. Note that the layer of SiO2 formed on the substrate is also included within this Cauchy layer. The optical parameters (A, B and C) as well as the thickness derived from this fitting were subsequently used for analyzing the data from substrates functionalized with rNFH-SA. For these data, the optical model consisted of two Cauchy layers on top of a silicon substrate. The parameters for the lower layer were fixed at the values obtained from the previous exercise. This analysis gave us the refractive index (n=1.38 at 632.8 nm) and thickness (t=2.29 nm) of the rNFH-SA layer. This refractive index was used to calculate the volume fraction of rNFH-SA (f.sub.p) in the layer using the Brugemann effective medium approximation, which is described for this composite system by:
(80)
Here, n.sub.p, n.sub.a and n.sub.eff refer to the refractive indices of pure protein, air and the composite layer respectively. Using n.sub.p=1.55, n.sub.a=1 and n.sub.eff=1.38, f.sub.p was calculated to be 0.71.
(81) Having obtained the volumetric density, the surface density () could be calculated as
(82)
where t=2.29 nm is the thickness of the rNFH-SA layer as calculated above, .sub.p=1.41 g ml.sup.1 is the density of pure protein, N.sub.A is Avogadro's number and M.sub.W=70 kDa is the molecular weight of rNFH-SA. The inter-chain distance, S was calculated to be 7.75 nm from the surface density (=0.02 nm.sup.2) using the relation
(83)
For hexagonal close packed surface layers.
(84) Atomic force microscopy. Force measurements were made using a Molecular Force Probe three-dimensional instrument (MFP, Asylum Research, Inc.). The experimental setup uses an open cell arrangement with a wetted tip brought into contact with the wetted sample surface. Silicon nitride cantilevers (OTR4-10) calibrated using the thermal method built into the MFP with a nominal spring constant of 0.02 N m.sup.1 were used. The tips had a radius of curvature of o20 nm. Force curves were typically collected over 500 nm with at least 2,048 data points per curve, at a rate of 1 Hz. Relative triggers of up to 4 nN were used to prevent the tip from damaging the surface. When exchanging solutions of different ionic strength, both the sample and tip were rinsed with several millilitres of the new solution prior to a measurement. At least 400 force curves were recorded for each sample at different points on the surface. The brush height was measured as the tip-sample separation at which the force began to increase from zero. Briefly, the raw AFM data (deflection error versus sensor displacement) was converted to force-distance curves (force versus tip-sample separation) as described by Cappella et al. The contact region was fit to a straight line and the point of hard contact was identified. The force profile at large separation was averaged to a baseline value, and the tip-sample separation at the first point where the force deviated significantly (at least three times the s.d. of the baseline fit) from the baseline value was denoted as the brush height. All of the above procedures were performed in MATLAB.
(85) Protease digestion. The protein brush was incubated either with thrombin (1 U ml.sup.1, GE Healthcare) or clostripain (43 U ml.sup.1, Worthington Biochemicals). Thrombin was prepared in PBS pH 7.4 and clostripain was prepared in its activation buffer containing 25 mM phosphate, 1 mM calcium acetate and 2.5 mM dithiothreitol. The surface was spotted in triplicates with both 1 and 0.5 ml of enzyme and allowed to incubate overnight at room temperature. A 1 ml spot of both buffer and bovine serum albumin (1 mg ml.sup.1) were included as controls. The surface was stained with a primary antibody targeted towards the HN tag on rNFH-SA and the appropriate fluorescent secondary antibody. The surface was imaged using a Typhoon scanner to obtain fluorescence images. For AFM experiments, the surface was prepared with 3 ml spots each of the enzyme, corresponding buffer and water at pH 10.9. The surface was washed after overnight incubation and all subsequent measurements were performed in water at pH 10.9. The height measured on the water-incubated spot functioned as a control to ensure that incubation in the buffer did not affect the brush height.
(86) Purification and characterization of rNFH-SA. The disclosure is exemplified with a protein construct, rNFH-SA, containing residues 426-1066 from the rat NF-H sidearm domain, flanked by an N-terminal tetra-Cys tag to permit oriented assembly onto thiol-reactive surfaces and a C-terminal poly-His-Asn tag (HN-tag) to facilitate purification (
(87) TABLE-US-00003 TABLE 1 Comparison of hydrodynamic radii (rH). The rH of a hypothetical protein with a molecular mass of ~70 kDa in different conformational states is compared to that of rNFH-SA (rH = 10 nm). Conformational state r.sub.H, nm Native 3.7 1.9 Molten globule 3.9 1.4 Pre-molten globule 5.9 4.1 Urea denatured 7.6 1.3 Guanidinium chloride denatured 8.2 1.0 Native unfolded coil 7.0 0.93 Native unfolded pre-molten globule 5.3 1.1
(88) Brush Formation by Surface Immobilized rNFH-SA. To determine if rNFH-SA could be assembled into a protein brush, the immobilization of the protein on maleimide-functionalized substrates was monitored (see
(89) To further quantify and characterize the bound layer of rNFH-SA, atomic force microscopy (AFM) was used to measure forces exerted by the immobilized IDP layer (
(90) Influence of Ionic Strength on the Brush Height. To explore the properties of the IDP brush, AFM measurements were repeated over a range of ionic strengths (I) and the brush height was estimated as the tip-sample separation at which the force began to increase from zero (
(91) At pH 10.9, below a critical ionic strength (2 mM), the system enters an osmotic brush regime in which the brush height increases with ionic strength. This phenomenon is based on a shift in the protonation/deprotonation equilibrium at low ionic strengths. The local concentration of protons within the brush in the absence of salt is governed by the requirement of charge neutrality. However, when a small amount of salt is added, some of these cations can be exchanged with the protons inside the brush without affecting charge neutrality. As a consequence, the pH within the brush increases, thereby increasing the degree of deprotonation of the protein chains. This results in greater chain stretching due to counterion-induced osmotic swelling and increased inter- and intra-molecular electrostatic repulsion associated with chain ionization, as has been observed with synthetic polyelectrolyte and polyampholyte brush systems. Above a critical ionic strength, this exchange mechanism saturates and the system enters the salted brush regime, in which further addition of salt collapses the brush due to electrostatic screening (
(92) Influence of pH on the Brush Height. The possibility of pH-induced conformational changes were analyzed in the rNFH-SA brushes (
(93) In Situ Protease Digestion of rNFH-SA Brushes. An additional and relatively unique feature of a protein-based brush is the ability to incorporate proteolytic cleavage sites into the polymer chain, which enable shortening or shaving of the protein brush with high precision upon addition of the cognate protease. To explore this concept, rNFH-SA brushes were assembled and one of two proteases were applied: thrombin, a serine protease that cleaves rNFH-SA at a recognition site (LVPR|GS) located just ahead of the HN-tag on the C-terminus of the protein, and clostripain, an ArgC endoproteinase that cleaves at five sites along the length of the protein, the deepest of which is 253 residues from the top edge of the brush (
(94) The disclosure provides a protein-based polymer brush system whose conformational properties can be strongly modulated by changes in pH and ionic strength. Notably, this material is recombinantly expressed, forms brushes, and yields a nearly six- to tenfold dynamic range in brush thickness as ionic strength is varied and a threefold range as pH is varied. This dynamic range is comparable to many existing synthetic polymer brush systems, thus providing an attractive complement or alternative to synthetic systems in specific settings. In addition, the dynamic range can be shifted, widened, or narrowed in interesting ways by exerting more control over the grafting density, such as by using cloud point grafting to achieve very dense brushes. Furthermore, proteases can be used to reduce the height of the brush in situ by cleaving the constituent chains at well-defined points. The extensive suite of proteases and protease recognition sitesany of which could be introduced into the sequence at one or more arbitrary positionsprovides a versatile toolbox for controlling IDP brush properties in a dynamic and specific manner. Analogous enzymatically addressable materials have been explored for a variety of applications such as payload delivery, diagnostic monitoring and ligand presentation.
(95) Although much effort has focused on understanding the biological function of endogenous IDPs, the disclosure demonstrates that proteins represent an untapped resource for biomaterial design. IDPs could contribute to the development of new biosynthetic coatings, fusion proteins whose functions may be sterically gated, and novel cell surface engineering strategies. As described. earlier, IDPs may be designed. de novo, synthesized at high purity, and chemically tailored at specific positions along the chain through mutagenesis. IDP sequences can be optimized. for specific applications through. directed-evolution approaches and synthesized to include bio-orthogonal chemical moieties via the use of unnatural amino acids. Indeed, IDPs based on nucleoporin proteins have recently been incorporated into synthetic gated pores and surface-grafted layers, supporting the idea that IDPs can be manipulated in ways that are analogous to synthetic polymers. Together with these efforts, our work hints at the value of exploring IDPs as a new class of smart biomaterial building blocks.
Example 2
(96) Materials. Fluorescein-labeled, as well as unlabeled polyethylene glycol derivatives were purchased from Nanocs, 5-((2-(and-3)-S-(acetylmercapto) succinoyl) amino) Fluorescein (SAMSA fluorescein) from Thermo Fisher Scientific and tri(ethylene glycol)-undecanethiol from Dojindo Molecular Technologies. All other chemicals were purchased from Sigma Aldrich. Quartz chips for Quartz Crystal Microbalance were purchased from Biolin Scientific, and gold substrates for Surface Plasmon Resonance were purchased from XanTec Bioanalytics.
(97) Peptide synthesis and purification. The peptides were synthesized on solid phase using standard fluorenylmethyloxycarbonyl (FMOC)-based chemistry, cleaved from the resin, and purified by HPLC. All peptides were cleaved from resin with a cocktail of 95% trifluoroacetic acid (TFA), 2.5% H2O and 2.5% triisopropylsilane for 2 hrs, and precipitated in cold diethyl ether. After evaporating the TFA, crude peptides were purified using semi-preparative reversed-phase HPLC and subsequently lyophilized before use. HPLC was performed on an Agilent 1100 series HPLC system (Agilent Technologies, USA). Sample analysis for all HPLC experiments was achieved with an in-line diode array detector (DAD) and an in-line fluorescence detector (FLD). Semi-preparative HPLC was performed using a C18 Gemini 5 m 110 reverse-phase column (250 mm10 mm) (Phenomenex, USA). A MeCN/ddH2O gradient containing 0.1% TFA at a flow rate of 3.0 mL/min was used as the mobile phase. Matrix assisted laser desorption-ionization time of flight (MALDI-TOF) mass spectra were obtained on Voyager DE-PRO (Applied Biosystems, USA). R-cyano-4-hydroxycinnamic acid (CHCA) in 3:2 MeCN/H.sub.2O (0.1% TFA) was used as the matrix. 5(6)-carboxyfluorescein was used to fluorescently label the N-termini of peptides. The final FMOC deprotection was performed on 25 mg resin in 20% v/v 4-methyl piperidine in dimethylformamide (DMF) for 30 min at room temperature. After the resin was rinsed with DMF, 1 mL solution of 0.4 M 1-Hydroxybenzotriazole hydrate (HOBt) and 0.4 M carboxyfluorescein in DMF was added. The amide coupling reaction was then initiated by the addition of 140 L of 50% v/v N,N-Diisopropylcarbodiimide (DIC) in DMF and incubated at room temperature for 2 hours with gentle agitation. The resin was rinsed with DMF, MeOH, dichloromethane, and then dried under vacuum. The fluorescently labeled peptides were then cleaved from the resin and purified with HPLC.
(98) Small angle x-ray scattering (SAXS). SAXS measurements were conducted using the SIBYLS beamline at the Advanced Light Source facility of the Lawrence Berkeley National Laboratory. Peptides at a concentration of 1 mg/ml in HEPES buffers of different ionic strengths were analyzed over a scattering vector (q) range of 0.03-0.3/ with an exposure time of 1 second in triplicate. Similar measurements were also carried out for the different buffer preparations (blank measurements) and the resultant spectra were subtracted from the experimental peptide spectra to obtain the final data. Guinier plots were used to verify that the peptides did not aggregate. The SAXS spectra were then subjected to ensemble-optimized modeling using the ATSAS software package ([http://www.]embl-hamburg.de/biosaxs/eom.html). This analysis is based on the generation of a large pool of theoretical structures (typically 10,000) based on side-chain interaction constraints from the primary sequence of the peptides. The theoretical X-ray scattering profiles calculated from these structures are then matched for fit with the experimental scattering profile to create an ensemble of best-fit structures.
(99) Surface plasmon resonance (SPR) measurements. All SPR measurements were performed at 25 C. in a four flow cell Biacore 3000 instrument (GE Healthcare) on bare gold SPR transducers. KDP peptide and KSP peptides were immobilized on flow channels 1 and 2 respectively via their N-terminal cysteine residues. Tri(ethylene glycol)-undecanethiol, which forms a reference layer was immobilized on flow channel 3. Immobilization was carried out by injecting 1 mM of the appropriate molecule in HEPES buffer (HBS, pH 7.5, ionic strength 150 mM) into the channels for 40 minutes at a flow rate of 5 l/min. All flow channels were subsequently rinsed with the buffer for 30 minutes to remove any non-specifically adsorbed material. Following this, injections of BSA in HEPES buffers of various ionic strengths and pH were carried out to measure the heights of the surface layers. Prior to the BSA injections, all flow channels were equilibrated with the appropriate buffer for 15 minutes. 3 injections of BSA (each lasting 1 minute, followed by a rinse for 1 minute) at a concentration of 1 mg/ml in the corresponding buffer was carried out into all flow channels at a rate of 10 L/min, with each injection passing all flow channels sequentially. Average response units for each BSA injection was measured relative to the buffer baseline.
(100) Analysis of SPR data. Immobilization densities () of the peptides was calculated from the change in the resonance units (RU) by using the relationship 1300 RU=1 ng/mm.sup.2. The grafting distance (g) could then be calculated from the density using the relationship
(101)
where M.sub.w is the molecular weight of peptide and N.sub.A is Avogadro's number.
(102) Heights of the layers were calculated from the response of the BSA injections by using the relation:
(103)
where H.sub.B and H.sub.RL are the heights of the peptide brush and the reference layer (2 nm) respectively, R.sub.B and R.sub.RL are the SPR signals during the injection of BSA on the brush and reference layer respectively, and l.sub.d is the decay length of the surface plasmon. Calculation of optimal l.sub.d for each layer under the various buffer conditions was carried out using the iterative procedure. Modeling of the SPR reflectivity spectrum necessary for the evaluation was done via Fresnel equations using a transfer matrix formalism.
(104) Quartz Crystal Microbalance with Dissipation. QCM-D measurements were performed with a Q-Sense E4 system (Biolin Scientific). Quartz crystals with fundamental frequencies of 5 MHz were functionalized with maleimide moieties as described below and used for immobilization of the peptides. 1 mM of the peptides in HBS were injected into the flow cell at a flow rate of 100 l/min for 2 minutes, using a syringe pump. Change in frequency (f) and dissipation (D) were measured at 5 overtones (n=3, 5 . . . 11) simultaneously. The data were fit using the Voight-Voinova model for viscoelastic films to obtain the surface density of the hydrated peptide layer bound to the surface.
(105) Functionalization of Silica and Quartz Surfaces. Substrates were activated via plasma cleaning prior to functionalization. After rinsing with water and drying in a nitrogen stream, the surfaces were subsequently silanized with glycidyloxypropyltrimethoxysilane for 45 minutes at 75 C. The surfaces were then rinsed with acetone and reacted with diaminopropane for 4 hours at 75 C. After rinsing with water and drying in a nitrogen stream, the surface amines were reacted with a saturated solution of 3-(Maleimido)propionic acid N-hydroxysuccinimide ester in dry dimethylformamide (DMF) for 45 minutes at room-temperature to yield maleimide-functionalized surfaces. Functionalization of SAIM substrates with KDP and KSP peptides was carried out by incubating the maleimide-functionalized substrates with a solution of 100 M fluorescein-labeled peptide and 1 mM unlabeled peptide in HEPES buffered saline (HBS, 150 mM NaCl, pH 7.5) for 30 minutes at room temperature. Functionalization with PEG was similarly carried out by reacting the maleimide-functionalized substrates with a solution of 100 M fluorescein-labeled PEG and 1 mM unlabeled PEG in HBS. For functionalization with fluorescein, the maleimide-functionalized SAIM substrates were incubated with a solution containing 100 M activated SAMSA-fluorescein (Thermo Fisher Scientific) and 1 mM acetic acid in HBS.
(106) Scanning angle interference microscopy (SAIM) imaging. N-type [100]-orientation silicon wafers with 1933 nm silicon oxide (Addison Engineering) were cut into 0.5 cm.sup.2 chips using a diamond pen. The substrates were functionalized with the peptides, PEG and fluorescein as described was used. SAIM calibration wafers were prepared by sonicating carboxylate-modified red fluorescent spheres (100 nm; Invitrogen), following by bead deposition (510.sup.8 beads per mL) in PBS. Imaging was performed on an inverted Ti-E Perfect Focus System (Nikon) controlled by Metamorph software, equipped with 488 nm, 561 nm, and 640 nm lasers, a motorized laser Ti-TIRF-E unit, a 1.49 NA 100TIRF objective, an electron-multiplying charged-coupled device (emCCD) camera (QuantEM 512; Photometrics), and with a linear glass polarizing filter (Edmunds Optics) in the excitation laser path. Imaging and analysis was performed.
(107) As described solid-phase peptide synthesis was used to generate two 32-residue peptides based on the NF-H sidearm domain. The first peptide contained four KSP motifs (KSP peptide), while in the second the serine residues were replaced with aspartate residues (KDP peptide) (
(108) Conformational dynamics of peptides in solution. The conformational properties of each peptide in solution were characterized using small angle X-ray scattering (SAXS), which has been extensively applied to capture solution dimensions of both structured and disordered proteins and peptides. Kratky plots of the SAXS data for the two peptides in HEPES buffered saline (HBS, ionic strength 150 mM, pH 7.5) reveal a plateau at high value of the scattering vector, q, which is the signature characteristic of random coils (
(109) The lower Rg of the KSP peptide is consistent with recent molecular dynamics (MD) simulations of the C-terminal tails of the NF-H protein, which found that the non-phosphorylated sidearm domain is stabilized by salt bridges between glutamate and lysine residues; these attractive electrostatic interactions would presumably be destabilized by the electrostatic repulsions associated with added negative charge upon phosphorylation. To investigate these electrostatic effects in a more detailed manner, SAXS experiments were conducted on the peptides as a function of ionic strength. Interestingly, the dependence of Rg on ionic strength for the KSP and KDP peptides (also calculated using EOM,
(110) Conformational dynamics of peptide brushes. Having verified the stimulus-responsive properties of these peptides in solution, their behavior in the form of surface-anchored brushes was studied. This geometry is broadly reminiscent of the in vivo arrangement of NF-H sidearm domains within the axon, which project from the NF core to form cylindrical brushes. Moreover, as discussed earlier, the potential technological application of surface-grafted IDPs as biologically encoded interfacial materials makes this a very useful paradigm to study. KSP and KDP peptides were immobilized via their N-terminal cysteine residues on gold substrates and followed the grafting kinetics using surface plasmon resonance (SPR) (
(111) The responsiveness of these peptide brushes was then measured with changes in pH. To do this BSA was injected in HBS of ionic strength 150 mM at different pH (pH 5 and 10), and analyzed the BSA signals following the procedure described herein. This showed that the brushes underwent significant collapse at pH 5, shrinking to around half of their previous thickness (
(112) Subsequently, the responsiveness of these brushes to changes in ambient ionic strength at pH 7.5 were measured. Again, taking the approach described earlier, BSA was injected in HBS at pH 7.5 of varying ionic strengths and analyzed the SPR signal. A significant adsorption of BSA at ionic strengths below 100 mM was observed, possibly due to electrostatic attractive forces between BSA and the brushes, and so the study was confined to ionic strengths>100 mM. In the ionic strength range of 100 mM-500 mM, the brushes demonstrated very interesting and distinct responses to ionic strength (
(113) A possible criticism of this SPR-based technique for measuring brush height is that it can be affected by adsorption of BSA to the brushes. While no significant adsorption of BSA onto peptide-functionalized surfaces were observed in the ionic strengths presented here further experiments were performed. To verify these findings with a completely independent methodology, the heights of the peptide brushes was measured using scanning angle interference microscopy (SAIM). SAIM measures the optical distance (product of physical distance and the refractive index of the intervening medium) of fluorescent species immobilized on special transducers composed of a thin film of silicon dioxide deposited on a reflective silicon wafer. The intensity of the fluorescence excitation light is axially modulated by varying the angle of incidence. Thus, the fluorescence intensity is a function of the incident angle of excitation light and the distance of the fluorophore from the silicon oxide layer (
(114) Having established SAIM as a suitable method to measure polymer brushes, the heights of KSP and KDP peptide brushes were measured using this technique. Towards this end, synthesized KSP and KDP peptides containing a cysteine on the C-terminus and labeled with fluorescein on the N-terminus were used. For SAIM studies, sequence-reversed retropeptides (PSK rather than KSP repeats;
(115) SAIM measurements were then conducted on the peptide brushes under varying ionic strengths. Again observed trends that closely follow the ones observed using the SPR experiments were identified (
(116) The measurements presented here are consistent with a hypothesis in which electrostatic effects associated with introduction of very few charged residues in an IDP can strongly modulate conformational and brush properties, as well as the dependence of these properties on ionic strength. These results may also have implications for how IDP phosphorylation influences conformational properties and motivates further exploration of phosphorylation (or introduction of phosphomimetic residues) as a useful design tool for engineering material properties of IDPs in solution and at solid-liquid interfaces.
Example 3
(117) Protein-protein interactions studies utilizing the IDPs and brushes of the disclosure were also performed. Experiments using the Rho GTPase Cdc42 and its effector protein PAK1 were performed. The IDP from the soya bean (Glycine max) late embryogenesis abundant protein Em (Uniprot link: [http://www].uniprot.org/uniprot/I1JLC8) was used and linked to Cdc42. This IDP, which has been previously shown to act as an entropic shield, helps in preventing protein aggregation when expressed in mammalian cells. A plasmid constructs in which 1, 2 and 3 copies of Em have been recombinantly fused to the C-terminus of Cdc42 has been generated. An example of a construct is shown in
(118) A number of embodiments of the invention have been described. Nevertheless, it will be understood that various modifications may be made without departing from the spirit and scope of the invention. Accordingly, other embodiments are within the scope of the following claims.