USP10 MODULATION OF AMPK AND MTOR

Abstract

Materials and methods for modulating activity of kinases such as AMPK and mTOR via the deubiquitinase, USP10, are provided herein. Also provided are materials and methods for treating clinical conditions mediated at least in part by such kinases, including obesity, diabetes, metabolic syndrome, and some cancers.

Claims

1. A method for increasing the activity of AMP-activated protein kinase (AMPK) in a cell, comprising contacting the cell with an agent effective to increase the level or deubiquitinase activity of USP10 in the cell.

2. The method of claim 1, wherein the agent is a USP10 polypeptide.

3. The method of claim 2, wherein the USP10 polypeptide comprises the amino acid sequence set forth in SEQ ID NO:2.

4-5. (canceled)

6. The method of claim 2, wherein the USP10 polypeptide is a biologically active fragment of the USP10 polypeptide having the sequence set forth in SEQ ID NO:2.

7. (canceled)

8. The method of claim 1, wherein the agent is a nucleic acid encoding a USP10 polypeptide.

9. The method of claim 8, wherein the nucleic acid comprises the sequence set forth in nucleotides 143-2536 of SEQ ID NO:1.

10-11. (canceled)

12. The method of claim 8, wherein the nucleic acid encodes a biologically active fragment of a USP10 polypeptide having the sequence set forth in SEQ ID NO:2.

13-14. (canceled)

15. The method of claim 1, wherein the cell is in a subject identified as having a clinical condition selected from the group consisting of obesity, type 2 diabetes, insulin resistance, or metabolic syndrome.

16. The method of claim 1, wherein the cell is in a subject identified as having cancer.

17-18. (canceled)

19. A method for reducing the activity of mammalian target of rapamycin (mTOR) in a cell, comprising contacting the cell with an agent effective to increase the level or deubiquitinase activity of USP10 in the cell.

20. The method of claim 19, wherein the agent is a USP10 polypeptide.

21. The method of claim 20, wherein the USP10 polypeptide comprises the amino acid sequence set forth in SEQ ID NO:2.

22-23. (canceled)

24. The method of claim 20, wherein the USP10 polypeptide is a biologically active fragment of the USP10 polypeptide having the sequence set forth in SEQ ID NO:2.

25. (canceled)

26. The method of claim 19, wherein the agent is a nucleic acid encoding a USP10 polypeptide.

27. The method of claim 26, wherein the nucleic acid comprises the sequence set forth in nucleotides 143-2536 of SEQ ID NO:1.

28-29. (canceled)

30. The method of claim 26, wherein the nucleic acid encodes a biologically active fragment of a USP10 polypeptide having the sequence set forth in SEQ ID NO:2.

31-32. (canceled)

33. The method of claim 19, wherein the cell is in a subject identified as having cancer.

34. (canceled)

35. The method of claim 33, wherein the subject is a human.

36-41. (canceled)

42. A method for increasing the activity of AMPK in a cell, comprising contacting the cell with an agent effective to increase, in the cell, the level of an AMPK polypeptide that lacks one or more ubiquitination sites.

43. The method of claim 42, wherein the agent is the AMPK polypeptide that lacks one or more ubiquitination sites.

44. The method of claim 42, wherein the agent is a nucleic acid encoding the AMPK polypeptide that lacks one or more ubiquitination sites.

45. The method of claim 43 or claim 44, wherein the AMPK polypeptide is an AMPK1 polypeptide comprising a substitution of one or more of the lysine at position 71, the lysine at position 285, the lysine at position 396, and the lysine at position 485.

46-48. (canceled)

49. The method of claim 43 or claim 44, wherein the AMPK polypeptide is an AMPK2 polypeptide comprising a substitution of one or more of the lysine at position 60, the lysine at position 379, the lysine at position 391, and the lysine at position 470.

50-51. (canceled)

Description

DESCRIPTION OF DRAWINGS

[0015] FIGS. 1A-1I demonstrate that USP10 regulates AMPK activation and cellular metabolism. FIG. 1A is a picture of an immunoblot showing the effect of USP10 knockdown on AMPK activation. HCT116 cells were infected with lentivirus encoding the indicated shRNAs. Cell lysates were immunoblotted as indicated. FIGS. 1B and 1C are a picture (FIG. 1B) and a graph (FIG. 1C) showing Oil-Red-O staining of HCT116 cells with or without shRNA knockdown of USP10. Control or USP10 knockdown HCT116 cells were incubated in medium supplemented with 200 M sodium oleate overnight (20 hours) and fixed with formalin. The intracellular lipid droplet abundance was assessed by Oil-Red-O staining. The results represent the means (SEM) of three independent experiments. **, p<0.01. FIG. 1D is a graph plotting lactate concentration in HCT116 cells. Lactate production was measured after incubation of control and USP10 knockdown HCT116 cells in medium for 48 hours. The results represent the means (SEM) of three independent experiments. **, p<0.01. FIG. 1E is a graph plotting relative expression of aldoa, ldha, and pdkl mRNA in control or USP10 knockdown HCT116 cells, as determined by qPCR. Transcript levels were determined relative to actin mRNA levels, and normalized relative to control cells. The results represent the means (SEM) of three independent experiments. **, p<0.01. FIG. 1F is a picture of an immunoblot showing the effect of USP10 activity or USP10 knockdown on AMPK activation. Cells were transfected with indicated USP10 constructs and placed in medium without glucose for 4 hours. Cell lysates were immunoblotted with the indicated antibodies. FIG. 1G is a graph plotting relative Oil-Red-O staining in cells transfected with the indicated USP10 constructs and subjected or not subjected to shRNA knockdown. Cells as in FIG. 1F were incubated in medium supplemented with 200 M sodium oleate overnight (20 hours) and placed in medium without glucose for 4 hours. The intracellular lipid droplet abundance was assessed by Oil-Red-O staining. The results represent the means (SEM) of three independent experiments. **, p<0.01. FIG. 1H is a graph plotting the effect of USP10 deubiquitinase activity on glycolytic gene expression. Cells as in FIG. 1F were placed in medium without glucose for 4 hours. The relative expression of aldoa, ldha, and pdkl mRNA in the indicated cells was determined by qPCR. Transcript levels were determined relative to actin mRNA levels, and normalized relative to control cells. The results represent the means (SEM) of three independent experiments. **, p<0.01. FIG. 1I is a picture of an immunoblot showing the effect of Spautin-1 treatment on AMPK activation. HCT116 cells were treated with indicated concentration of Spautin-1 and cell lysates were immunoblotted as indicated.

[0016] FIGS. 2A-2H demonstrate that USP10 regulates cellular metabolism through AMPK but not through p53. FIG. 2A is a picture of an immunoblot showing the effect of USP10 knockdown on AMPK activation in the absence of p53. HCT116 p53/ cells were infected with lentivirus encoding the indicated shRNAs. Cell lysates were immunoblotted as indicated. FIG. 2B is a graph plotting relative Oil-Red-O staining in p53/ cells with and without shRNA knockdown of USP10. Control and USP10 knockdown HCT116 p53/ cells were incubated in medium supplemented with 200 M sodium oleate overnight (20 hours) and fixed with formalin. Intracellular lipid droplet abundance was assessed by Oil-Red-O staining. FIG. 2C is a graph plotting lactate production in p53/ cells with and without shRNA knockdown of USP10. Lactate production was measured after incubation of control and USP10 knockdown HCT116 p53/ cells in medium for 48 hours. The results represent the means (SEM) of three independent experiments. **, p<0.01. FIG. 2D is a graph plotting relative mRNA levels for glycolytic genes in p53/ cells with and without knockdown of USP10. Relative expression of aldoa, ldha, and pdkl mRNA in control or USP10 knockdown HCT116 p53/ cells was determined by qPCR. Transcript levels were determined relative to actin mRNA levels, and normalized relative to control cells. The results represent the means (SEM) of three independent experiments. **, p<0.01. FIG. 2E is a picture of an immunoblot of lysates from cells infected with lentivirus encoding shRNAs targeted to USP10, AMPK, or both. Cell lysates were incubated with the indicated antibodies. FIG. 2F is a graph plotting relative Oil-Red-O staining in cells that were infected with lentivirus encoding the indicated shRNAs, incubated in medium supplemented with 200 M sodium oleate overnight (20 hours), and fixed with formalin. Intracellular lipid droplet abundance was assessed by Oil-Red-O staining. The results represent the means (SEM) of three independent experiments. **, p<0.01; n.s, not significant. FIG. 2G is a graph plotting lactate production by cells treated with the indicated shRNAs and incubated in medium for 48 hours. The results represent the means (SEM) of three independent experiments. **, p<0.01; n.s, not significant. FIG. 2H is a graph plotting relative expression of mRNA for the glycolytic genes aldoa, ldha, and pdkl in the indicated cells, as determined by qPCR. Transcript levels were determined relative to actin mRNA levels, and normalized relative to control cells. The results represent the means (SEM) of three independent experiments. **, p<0.01; n.s, not significant.

[0017] FIGS. 3A-3H demonstrate that USP10 interacts with AMPK and deubiquitinates AMPK. FIG. 3A is a picture of a blot demonstrating that USP10 directly interacts with AMPK in vitro. Purified His6-USP10 was incubated with the indicated GST tagged AMPK subunits coupled to GSH-Sepharose. Proteins retained on Sepharose were then blotted with the indicated antibodies. FIGS. 3B-3D are immunoblots showing the interaction of USP10 with AMPK in cells. HCT116 cell lysates were subjected to immunoprecipitation (IP) with control IgG, anti-USP10 (FIG. 3B), anti-AMPK1 (FIG. 3C), anti-AMPK2 (FIG. 3D) antibodies. The immunoprecipitates were then blotted with the indicated antibodies. FIG. 3E is an immunoblot (upper panel) demonstrating the interaction of AMPK with various portions of USP10 (lower panel). 293T cells transfected with the indicated constructs were lysed, and lysates were incubated with anti-FLAG beads. Proteins retained on beads were blotted with the indicated antibodies. FIG. 3F is a picture of an immunoblot demonstrating that USP10 knockdown increases AMPK ubiquitination. HCT116 cells infected with lentivirus encoding the indicated shRNAs were transfected with the indicated constructs. Cell lysates and Ni-NTA pulldowns were immunoblotted as indicated. -Glu, glucose starvation. FIG. 3G is a picture of an immunoblot showing that USP10 deubiquitinase activity is required for AMPK deubiquitination. The indicated constructs were transfected into USP10 knockdown cell lines, and cells were placed in medium without glucose for 4 hours. Cell lysates were incubated with anti-HA beads and immunoblotted with the indicated antibodies. -Glu, glucose starvation. FIG. 3H is a picture of an immunoblot showing deubiquitination of AMPK2 in vitro by USP10. Ubiquitinated AMPK2 was incubated with purified USP10 or USP10CA in vitro, and then blotted with indicated antibodies.

[0018] FIGS. 4A-4C demonstrate that USP10 interacts with AMPK and deubiquitinates AMPK. FIG. 4A is a picture of an immunoblot showing the effect of USP10 on AMPK1 ubiquitination. HCT116 cells infected with lentivirus encoding the indicated shRNAs were transfected with the indicated constructs. Cell lysates and Ni-NTA pulldowns were immunoblotted as indicated. FIG. 4B is a picture of an immunoblot showing the effect of USP10 on AMPK1 ubiquitination. The indicated constructs were transfected into USP10 knockdown cell lines. Cells were placed in medium without glucose for 4 hours. Cell lysates were incubated with anti-HA beads and immunoblotted with the indicated antibodies. FIG. 4C is a picture of an immunoblot showing deubiquitination of AMPK1 in vitro by USP10. Ubiquitinated AMPK1 was incubated with purified USP10 or USP10CA in vitro, and then blotted with indicated antibodies.

[0019] FIGS. 5A-5K demonstrate that ubiquitination of AMPK inhibits its activation. FIG. 5A is a picture of an immunoblot showing the effect of ubiquitin chain type on AMPK2. AMPK2 expression vectors and the indicated HA-tagged ubiquitin were transfected into USP10 knockdown cells. Cell lysates were boiled and immunoprecipitated with anti-HA beads and immunoblotted as indicated. FIG. 5B is a picture of an immunoblot showing that knockdown of USP10 increases AMPK2 K63 ubiquitination. HCT116 cells infected with lentivirus encoding the indicated shRNAs were transfected with the indicated constructs. Cell lysates were boiled and immunoprecipitated with anti-FLAG beads and immunoblotted as indicated. FIG. 5C shows AMPK sequences containing candidate ubiquitin sites. FIG. 5D is a picture of an immunoblot indicating the ubiquitination sites on AMPK2. AMPK2 expression vectors and HA-Ub K63 plasmid were transfected into USP10 knockdown cells. Cell lysates were boiled and immunoprecipitated with FLAG beads and immunoblotted as indicated. FIG. 5E is a picture of immunoblots demonstrating regulation of AMPK2 ubiquitination by USP10. AMPK2 expression vectors were transfected into control and USP10 knockdown cells. Cell lysates were boiled and immunoprecipitated with FLAG beads and immunoblotted as indicated. FIGS. 5F and 5G are immunoblots demonstrating that ubiquitination of AMPK affects LKB1 binding (FIG. 5G) and T172 phosphorylation (FIG. 5F). AMPK2 expression vectors were transfected into HCT116 cells. Lysates were immunoprecipitated with FLAG beads and immunoblotted as indicated. FIG. 5H is a picture of immunoblots demonstrating that USP10 regulates AMPK activation through deubiquitination of AMPK. AMPK2 expression vectors were transfected into control or USP10 knockdown cells. Cell lysates were immunoprecipitated with FLAG beads and immunoblotted as indicated. FIG. 5I is a picture of immunoblots showing that ubiquitination of AMPK inhibits AMPK activation. Wild-type (WT) or AMPK 1/2 double knockout (DKO) mouse embryonic fibroblasts (MEFs) were infected with retrovirus expression AMPK or the 4KR mutant, and placed in media containing vehicle or 2 mM AICAR for 1 hour. Cell lysates were immunoblotted as indicated. FIG. 5J is a graph plotting relative Oil-Red-O staining for AMPK 1/2 double knockout (DKO) MEFs infected with retrovirus expression AMPK or the 4KR mutant. Cells were incubated in medium supplemented with 200 M sodium oleate overnight (20 hours) and placed in medium without glucose for 4 hours. The intracellular lipid droplet abundance was assessed by Oil-Red-O staining. The results represent the means (SEM) of three independent experiments. **, p<0.01. FIG. 5K is a graph plotting relative mRNA levels for glycolytic genes in AMPK 1/2 double knockout (DKO) MEFs infected with retrovirus expressing AMPK or the KR mutant. Cells were placed in medium without glucose for 4 hours. Relative expression of aldoa, ldha, and pdkl mRNA in the indicated cells was determined by qPCR. Transcript levels were determined relative to actin mRNA levels, and normalized relative to control cells. The results represent the means (SEM) of three independent experiments. **, p<0.01.

[0020] FIGS. 6A-6G demonstrate that ubiquitination of AMPK inhibits its activation. FIG. 6A is a picture of an immunoblot showing the effect of ubiquitin chain type on AMPK1. AMPK1 expression vectors and indicated HA tag ubiquitin were transfected into USP10 knockdown cells. Cell lysates were boiled and immunoprecipitated with anti-HA beads, and immunoblotted as indicated. FIG. 6B is a picture of immunoblots showing the effect of USP10 knockdown on AMPK1 K63 ubiquitination. HCT116 cells infected with lentivirus encoding the indicated shRNAs were transfected with the indicated constructs. Cell lysates were boiled and immunoprecipitated with anti-FLAG beads and immunoblotted as indicated. FIG. 6C is a picture of immunoblots indicating the ubiquitination sites on AMPK1. AMPK1 expression vectors and HA-Ub K63 plasmid were transfected into USP10 knockdown cells. Cell lysates were boiled and immunoprecipitated with FLAG beads and immunoblotted as indicated. FIG. 6D is a picture of immunoblots showing the effect of AMPK1 expression vectors transfected into control or USP10 knockdown cells. Cell lysates were boiled and immunoprecipitated with FLAG beads and immunoblotted as indicated. FIG. 6E is a picture of immunoblots showing the effect of WT or 4KR AMPK1 expression on AMPK phosphorylation in HCT116 cells. Lysates were immunoprecipitated with FLAG beads and immunoblotted as indicated. FIG. 6F is a picture of immunoblots showing the effect of WT or 4KR AMPK1 expression on LKB1 in HCT116 cells. Lysates were immunoprecipitated with FLAG beads and immunoblotted as indicated. FIG. 6G is a picture of immunoblots showing the effect of WT or 4KR AMPK1 expression on protein interactions in control or USP10 knockdown cells. Cell lysates were immunoprecipitated with FLAG beads and immunoblotted as indicated.

[0021] FIGS. 7A-7D demonstrate that glucose starvation increases USP10 activity. FIGS. 7A and 7B are immunoblots showing the effect of glucose starvation on ubiquitination of AMPK1 (FIG. 7A) and AMPK2 (FIG. 7B). AMPK and Ub expression vectors were transfected into HCT116 cells, and cells were placed in medium with or without glucose for 4 hours. Cell lysates were boiled and immunoprecipitated with FLAG beads and immunoblotted as indicated. FIG. 7C is a graph plotting the USP10 deubiquitinase activity. Cells transfected with FLAG-USP10 expression vector were placed in medium with or without glucose for 4 hours. Cell lysates were incubated with FLAG beads and then eluted with FLAG peptide. The activities of eluted proteins were assayed using ubiquitin-7-amido-4-methylcoumarin (Ub-AMC) as a substrate. FIG. 7D is a picture of immunoblots demonstrating USP10 deubiquitinating activity in cells cultured in medium with or without glucose for 4 hours. Cells were lysed in lysis buffer and total protein was labeled with Ub-VS probe, then subjected to immunoblotting with the indicated antibodies.

[0022] FIGS. 8A-8G demonstrate that AMPK phosphorylates USP10 at Ser76. FIG. 8A is a Clustal alignment of conserved sites in USP10 from various species that match the optimal AMPK substrate motif. FIG. 8B is a picture of immunoblots demonstrating that USP10 is phosphorylated under energy stress. USP10 expression vectors were transfected into HCT116 cells. Cells were placed in medium with or without glucose for 4 hours. FLAG-USP10 was immunoprecipitated and treated with or without -PPase, then blotted with the indicated antibodies. -Glu, glucose starvation. FIG. 8C is a picture of a gel showing phosphorylation of USP10 by radiolabeled AMPK in vitro. Bacterially expressed GST and USP10 were incubated with purified AMPK in the presence of [-.sup.32P]ATP with or without AMP. Proteins were resolved by SDS-PAGE; proteins were visualized by Coomassie Brilliant Blue (CBB) staining (bottom panel), and phosphorylated proteins were visualized with autoradiography (top panel). FIG. 8D is a graph plotting phosphorylation of the USP10 S76 peptide and SAMS peptide by AMPK in vitro. Initial rates of .sup.32P-incorporation by AMPK into the USP10 peptide and SAMS peptide were 15536 and 9518 pmol/min/reaction mix, respectively. The results represent the means (SEM) of three independent experiments. FIG. 8E is a graph plotting the maximal stoichiometry of phosphorylation of the USP10 S76 peptide and SAMS peptide by AMPK. Stoichiometries of .sup.32P-incorporation after 30 minutes of incubation were calculated from the data shown in FIG. 8D. The results represent the means (SEM) of three independent experiments. FIG. 8F is a picture of a gel showing phosphorylation of USP10 at Ser76 by AMPK in vitro. Bacterially expressed WT USP10 and the S76A mutant were incubated with purified AMPK in the presence of [-.sup.32P]ATP and AMP. Proteins were resolved by SDS-PAGE; phosphorylated proteins were visualized with autoradiography (top), and total protein was visualized by CBB staining (bottom). FIG. 8G is a picture of immunoblots showing that AMPK phosphorylates USP10 at Ser76 in cells. USP10 expression vectors were transfected into HCT116 cells. Cells were placed in medium with or without glucose for 4 hours. FLAG-USP10 was immunoprecipitated and immunoblotted with the indicated antibodies.

[0023] FIGS. 9A-9F demonstrate that phosphorylation of USP10 promotes its activation. FIG. 9A is a graph plotting USP10 deubiquitinase activity in vitro after phosphorylation of USP10 by AMPK. Purified WT USP10 or the S76A mutant was incubated with or without active AMPK. The activities of USP10 were assayed using Ub-AMC as a substrate. FIG. 9B is a picture of an immunoblot showing that phosphorylation of USP10 regulates USP10 deubiquitinase activity in cells. Cells expressing WT or S76A USP10 were cultured in medium with or without glucose for 4 hours. Cells were lysed, and total proteins were labeled with Ub-VS probe and then subjected to immunoblotting with the indicated antibodies. FIG. 9C is a picture of immunoblots showing the effect of USP10 phosphorylation on AMPK ubiquitination. The indicated constructs were transfected into USP10 knockdown cell lines. Cells were placed in medium without glucose for 4 hours. Cell lysates were immunoprecipitated with anti-HA beads and immunoblotted with the indicated antibodies. -Glu, glucose starvation. FIG. 9D is a picture of immunoblots showing the effect of USP10 phosphorylation on AMPK activation. WT USP10 or S76A mutant constructs were transfected into indicated cells. Cells were placed in medium without glucose for 4 hours. Cell lysates were immunoblotted with the indicated antibodies. FIG. 9E is a graph plotting Oil-Red-O staining as a measure of lipid droplet formation in response to phosphorylation of USP10. WT USP10 or S76A mutant constructs were transfected into the indicated cells. Cells were incubated in medium supplemented with 200 M sodium oleate overnight (20 hours) and placed in medium without glucose for 4 hours. Intracellular lipid droplet abundance was assessed by Oil-Red-O staining. The results represent the means (SEM) of three independent experiments. **, p<0.01. FIG. 9F is a graph plotting relative mRNA levels of glycolytic genes in cells containing phosphorylated or non-phosphorylated USP10. WT USP10 or S76A mutant constructs were transfected into the indicated cells. Cells were placed in medium without glucose for 4 hours. Relative expression of aldoa, ldha, and pdkl mRNA was determined by qPCR. Transcript levels were determined relative to actin mRNA levels, and normalized relative to control cells. The results represent the means (SEM) of three independent experiments. **, p<0.01.

[0024] FIGS. 10A-10C demonstrate gene editing in adult mouse liver by adenoviral delivery of CRISPR/Cas9. FIG. 10A is an illustration of the usp10 locus, with the shRNA and PAM sequences highlighted. Four edited sequences also are shown. FIG. 10B is a picture of a gel showing a fragment of the T7EN1 gene before and after gene editing with adenoviral CRISPR/Cas9. AdenoCas9 virus against GFP (control) or USP10 as well as the buffer in which the viruses were suspended for injection (control) were injected into 6-week old male C57BL/6 mice via tail vein. Ten days after the injection, a third of the livers from the injected animals were removed for T7EN1 gene editing analysis. FIG. 10C is a picture of Western blots analyzing USP10 levels from the indicated tissues.

[0025] FIGS. 11A-11G demonstrate that knockout of hepatic Usp10 leads to multiple metabolic defects. FIG. 11A is a picture of Western blots showing AMPK and ACC1 phosphorylation levels in liver from the indicated mice. FIG. 11B is a series of pictures showing hematoxylin & eosin (H&E) staining of liver tissue from the indicated mice. FIGS. 11C and 11D are graphs plotting liver triglyceride (FIG. 11C) and cholesterol (FIG. 11D) levels in the indicated mice. Lipids were extracted and hepatic triglyceride and cholesterol levels were assayed using a commercial kit. Values are expressed as meanSEM. n=6. **, p<0.01. FIG. 11E is a graph plotting blood glucose levels measured in tail vein blood samples of the indicated mice using a glucometer. Values are expressed as meanSEM (n=6). **, p<0.01. FIG. 11F is a graph plotting the glucose infusion rate in the indicated mice. Blood glucose levels were measured in tail vein blood samples using a glucometer. Values are expressed as SEM. n=6. **, p<0.01. FIG. 11G is a diagram of a model for the AMPK-USP10 positive feedback loop.

[0026] FIGS. 12A-12H demonstrate that USP10 interacts with and regulates mTOR signaling. FIGS. 12A and 12B are pictures of immunoblots from co-immuno-precipitation assays showing that USP10 interacts with mTOR. FIG. 12C is a picture of an immunoblot demonstrating that USP10 regulates mTOR ubiquitination. FIG. 12D is a graph plotting survival of cancer cells with and without USP10, after treatment with the mTOR inhibitor, everolimus. The inhibitor had a greater effect on cells in the absence of USP10, demonstrating that USP10 regulates the response of cancer cells to everolimus. FIG. 12E is a graph plotting survival of cancer cells with and without USP10 knockdown by shRNA, after treatment with everolimus. The mTOR inhibitor had a greater effect on the USP10 knockdown cells than on cells treated with a control shRNA. FIGS. 12F and 12G are pictures of immunoblots showing that USP10 negatively regulates mTOR signaling, as USP10 knockout (FIG. 12F) or knockdown (FIG. 12G) resulted in increased levels of phospho-S6K. FIG. 12H is a picture of an immunoblot demonstrating that USP10 negatively regulates mTOR signaling. As in FIG. 12G, USP10 knockdown using shRNA increased the level of phospho-S6K, while reconstitution of USP10 in knockdown cells resulted in decreased levels of phospho-S6K.

DETAILED DESCRIPTION

[0027] Protein ubiquitination is an important posttranslational modification that regulates various biological functions. Ubiquitination through K48 of the ubiquitin chain generally targets proteins for degradation, whereas K63-linked ubiquitination often regulates signaling and trafficking (Clague and Urb, Cell 143(5):682-685, 2010). As described in the Examples below, AMPK is ubiquitinated mainly through the K63 specific ubiquitin chain. Under normal conditions, ubiquitination of AMPK may mask it or change its structure to block access of LKB1. As further described below, under energy stress, USP10 removes the ubiquitination of AMPK and exposes AMPK to LKB1.

[0028] USP10 is a 798 amino-acid protein with a predicted catalytic domain between about residues 414 to 793. Representative human USP10 nucleic acid and amino acid sequences are provided below as SEQ ID NO:1 and SEQ ID NO:2, respectively. The start and stop codons in SEQ ID NO:1 are underlined; nucleotides 143-2536 encode SEQ ID NO:2. As described herein, phosphorylation of human USP10 at a single serine residue (Ser76; underlined in SEQ ID NO:2) is necessary to activate the enzyme; disruption of this phosphorylation led to decreased catalytic activity toward fluorogenic substrates and Ub-VS binding.

TABLE-US-00001 (SEQIDNO:1) ctccccgcgccccgcggcgcgcggccagtgcgcaggcgcggcggccgatg cgagtgtgtatgtgcgggcgagaagatggcggcggcgggggaagcagcgt gagcagccggaggatcgcggagtcccaatgaaacgggcagccatggccct ccacagcccgcagtatatttttggagattttagccctgatgaattcaatc aattctttgtgactcctcgatcttcagttgagcttcctccatacagtgga acagttctgtgtggcacacaggctgtggataaactacctgatggacaaga atatcagagaattgagtttggtgtcgatgaagtcattgaacccagtgaca ctttgccgagaacccccagctacagtatttcaagcacactgaaccctcag gcccctgaatttattctcggttgtacagcttccaaaataacccctgatgg tatcactaaagaagcaagctatggctccatcgactgccagtacccaggct ctgccctcgctttggatggaagttctaatgtggaggcggaagttttggaa aatgatggtgtctcaggtggtcttggacaaagggagcgtaaaaagaagaa aaagcggccacctggatattacagctatttgaaagatggtggcgatgata gtatctccacagaagccctggtcaatggccatgccaattcagcagtcccg aacagtgtcagtgcagaggatgcagaatttatgggtgacatgcccccgtc agttacgcccaggacttgtaacagcccccagaactccacagactctgtca gtgacattgtgcctgacagtcctttccccggagcactcggcagtgacacc aggactgcagggcagccagaggggggccccggggctgattttggtcagtc ctgcttccctgcagaggctggcagagacaccctgtcaaggacagctgggg ctcagccctgcgttggtaccgatactactgaaaaccttggagttgctaat ggacaaatacttgaatcctcgggtgagggcacagctaccaacggggtgga gttgcacaccacggaaagcatagacttggacccaaccaaacccgagagtg catcacctcctgctgacggcacgggctctgcatcaggcacccttcctgtc agccagcccaagtcctgggccagcctctttcatgattctaagccctcttc ctcctcgccggtggcctatgtggaaactaagtattcccctcccgccatat ctcccctggtttctgaaaagcaggttgaagtcaaagaagggcttgttccg gtttcagaggatcctgtagccataaagattgcagagttgctggagaatgt aaccctaatccataaaccagtgtcgttgcaaccccgtgggctgatcaata aagggaactggtgctacattaatgctacactgcaggcattggttgcttgc ccgccgatgtaccacctgatgaagttcattcctctgtattccaaagtgca aaggccttgtacgtcaacacccatgatagacagctttgttcggctaatga atgagttcactaatatgccagtacctccaaaaccccgacaagctcttgga gataaaatcgtgagggatattcgccctggagctgcctttgagcccacata tatttacagactcctgacagttaacaagtcaagcctgtctgaaaagggtc gacaagaagatgctgaggaatacttaggcttcattctaaatggacttcat gaggaaatgttgaacctaaagaagcttctctcaccaagtaatgaaaaact tacgatttccaacggccccaaaaaccactcggtcaatgaagaagagcagg aagaacaaggtgaaggaagcgaggatgaatgggaacaagtgggcccccgg aacaagacttccgtcacccgccaggcggattttgttcagactccaatcac cggcatttttggtggacacatcaggtctgtggtttaccagcagagttcaa aagaatctgccactttgcagccatttttcacgttgcagttggatatccag tcagacaagatacgcacagtccaggatgcactggagagcttggtggcaag agaatctgtccaaggttataccacaaaaaccaaacaagaggttgagataa gtcgaagagtgactctggaaaaactccctcctgtcctcgtgctgcacctg aaacgattcgtttatgagaagactggtgggtgccagaagcttatcaaaaa tattgaatatcctgtggacttggaaattagtaaagaactgctttctccag gggttaaaaataagaattttaaatgccaccgaacctatcggctctttgca gtggtctaccatcacggcaacagtgcgacgggcggccattacactacaga cgtcttccagatcggtctgaatggctggctgcgcatcgatgaccagacag tcaaggtgatcaaccagtaccaggtggtgaaaccaactgctgaacgcaca gcctacctcctgtattaccgccgagtggacctgctgtaaaccctgtgtgc gctgtgtgtgcgcccagtgcccgcttcgtaggacaccacctcacactcac ttcccgcctctctttagtggctctttagagagaaactctttctccctttg caaaaatgggctagaatgaaaaggagatgccttggggttcgtgcacaaca cagcttctgttgactctaacttccaaatcaaaatcatttggttgaaacag actgttgcttgattttagaaaatacacaaaaacccatatttctgaaataa tgctgattcctgagataagaaagtggatttgatccccagtctcattgctt agtagaataaatcctgcaccagcaacaacacttgtaaatttgtgaaaatg aattttatctttccttaaaaaagaaattttttaatccatcacacttttct tccctaccctttagtttttgataaatgataaaaatgagccagttatcaaa gaagaactagttcttacttcaaaagaaaaataaacataaaaaataagttg ctggttcctaacaggaaaaattttaataattgtactgagagaaactgctt acgtacacattgcagatcaaatatttggagttaaaatgttagtctacata gatgggtgattgtaactttattgccattaaaagatttcaaattgcattca tgcttctgtgtacacataatgaaaaatgggcaaataatgaagatctctcc ttcagtagactgtttaattctgctgtagacttctctaatgctgcgtccct aattgtacacagtttagtgatatctaggagtataaagttgtcgcccatca ataaaaatcacaaagttggtttaaaaaaaaaaaaaaaaaaaaaaa (SEQIDNO:2) MALHSPQYIFGDFSPDEFNQFFVTPRSSVELPPYSGTVLCGTQAVDKLPD GQEYQRIEFGVDEVIEPSDTLPRTPSYSISSTLNPQAPEFILGCTASKIT PDGITKEASYGSIDCQYPGSALALDGSSNVEAEVLENDGVSGGLGQRERK KKKKRPPGYYSYLKDGGDDSISTEALVNGHANSAVPNSVSAEDAEFMGDM PPSVTPRTCNSPQNSTDSVSDIVPDSPFPGALGSDTRTAGQPEGGPGADF GQSCFPAEAGRDTLSRTAGAQPCVGTDTTENLGVANGQILESSGEGTATN GVELHTTESIDLDPTKPESASPPADGTGSASGTLPVSQPKSWASLFHDSK PSSSSPVAYVETKYSPPAISPLVSEKQVEVKEGLVPVSEDPVAIKIAELL ENVTLIHKPVSLQPRGLINKGNWCYINATLQALVACPPMYHLMKFIPLYS KVQRPCTSTPMIDSFVRLMNEFTNMPVPPKPRQALGDKIVRDIRPGAAFE PTYIYRLLTVNKSSLSEKGRQEDAEEYLGFILNGLHEEMLNLKKLLSPSN EKLTISNGPKNHSVNEEEQEEQGEGSEDEWEQVGPRNKTSVTRQADFVQT PITGIFGGHIRSVVYQQSSKESATLQPFETLQLDIQSDKIRTVQDALESL VARESVQGYTTKTKQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKL IKNIEYPVDLEISKELLSPGVKNKNEKCHRTYRLEAVVYHHGNSATGGHY TTDVFQIGLNGWLRIDDQTVKVINQYQVVKPTAERTAYLLYYRRVDLL

[0029] This document relates to methods and materials involved in modulating deubiquitinases (e.g., USP10 polypeptides) and/or ubiquitinated polypeptides (e.g., kinases such as AMPK and mTOR). For example, this document provides methods and materials for increasing deubiquitinase (e.g., a USP10 polypeptide) expression or activity, methods and materials for reducing ubiquitination of polypeptides (e.g., AMPK and mTOR), methods and materials for treating disorders such as insulin resistance, type 1 or type 2 diabetes, and metabolic syndrome, and methods and materials for reducing cancer cell proliferation, increasing cancer cell apoptosis, and/or treating cancer. This document also provides methods and materials for identifying agonists or antagonists of USP10-mediated activation or inhibition of substrate polypeptides (e.g., activation of AMPK or inhibition of mTOR). Representative amino acid sequences of the human AMPK1 and AMPK2 polypeptides are provided in SEQ ID NOS:41 and 42, respectively:

TABLE-US-00002 (SEQIDNO:41) MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTG HKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDI FMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRD LKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRL YAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFYTPQYLNP SVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKD FYLATSPPDSFLDDHHLTRPHPERVPFLVAETPRARHTLDELNPQKSKHQ GVRKAKWHLGIRSQSRPNDIMAEVCRAIKQLDYEWKVVNPYYLRVRRKNP VTSTYSKMSLQLYQVDSRTYLLDFRSIDDEITEAKSGTATPQRSGSVSNY RSCQRSDSDAEAQGKSSEVSLTSSVTSLDSSPVDLTPRPGSHTIEFFEMC ANLIKILAQ (SEQIDNO:42) MAEKQKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQ KIRSLDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGE LFDYICKHGRVEEMEARRLFQQILSAVDYCHRHMVVHRDLKPENVLLDAH MNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDIWSC GVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRSVATLLMHMLQ VDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPSGS FMDDSAMHIPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKA KWHLGIRSQSKPYDIMAEVYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNY VKMSLQLYLVDNRSYLLDFKSIDDEVVEQRSGSSTPQRSCSAAGLHRPRS SFDSTTAESHSLSGSLTGSLTGSTLSSVSPRLGSHTMDFFEMCASLITTL AR

[0030] In some embodiments, this document provides methods and materials related to treating mammals (e.g., humans) having a clinical condition such as obesity, insulin resistance, diabetes, metabolic syndrome, a neurological disorder, and cancer. Examples of mammals that can be treated as described herein include, without limitation, humans, monkeys, dogs, cats, cows, horses, pigs, rats, and mice. Examples of cancers that can be treated as described herein include, without limitation, renal cancers (e.g., renal cell carcinomas), pancreatic cancers, breast cancers, glioma, prostate cancers, lung cancers, melanoma, bladder cancers, and brain cancers such as glioma.

[0031] Treatments as described herein can be effective to reduce one or more symptoms of the clinical conditions noted herein. Symptoms of diabetes include, for example, high blood sugar levels over a prolonged period of time, frequent urination, increased thirst, and increased hunger. Symptoms of metabolic syndrome can include, without limitation, elevated triglycerides, reduced HDL cholesterol, elevated blood pressure, elevated fasting plasma glucose, microalbuminuria, and central obesity. Symptoms of insulin resistance include, for example, elevated blood sugar and elevated blood insulin.

[0032] As described herein, a clinical condition such as diabetes or cancer can be treated by increasing the level of USP10 polypeptide expression or activity. The increased level of USP10 polypeptide expression or activity can reduce ubiquitination of substrate polypeptides such as AMPK and mTOR, which, as described herein, increases the activity of AMPK but decreases the activity of mTOR. In some cases, the level of USP10 activity within cells can be increased by administering to the cells a composition containing one or more USP10 polypeptides (e.g., a USP10 polypeptide having the amino acid sequence set forth in SEQ ID NO:2, or a biologically active fragment or functional variant thereof). In some cases, the level of USP10 polypeptide expression or activity within cells can be increased by administering to the cells a composition containing a USP10 agonist, or a nucleic acid encoding a USP10 polypeptide (e.g., a nucleic acid having the sequence set forth in SEQ ID NO:1, nucleotides 143-2536 of SEQ ID NO:1, or a fragment or variant thereof). A nucleic acid can encode a full-length USP10 polypeptide, such as a human USP10 polypeptide having the amino acid sequence set forth in SEQ ID NO:2, a biologically active fragment of a USP10 polypeptide (e.g., a fragment containing amino acid residues 520 to 793 of SEQ ID NO:2), or a functional variant of a USP10 polypeptide that is catalytically active and can have activity that is the same, higher or lower than the parent protein or protein domain. In some cases, a functional variant of a USP10 polypeptide can have an amino acid sequence that is at least 95% (e.g., at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to the sequence set forth in SEQ ID NO:2. In some cases, a functional variant of a USP10 polypeptide can be encoded by a nucleic acid having a sequence that is at least 95% (e.g., at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to the nucleic acid sequence set forth in SEQ ID NO:1, or at least 95% (e.g., at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%) identical to nucleotides 143-2536 of SEQ ID NO:1.

[0033] The percent sequence identity between a particular nucleic acid or amino acid sequence and a sequence referenced by a particular sequence identification number is determined as follows. First, a nucleic acid or amino acid sequence is compared to the sequence set forth in a particular sequence identification number using the BLAST 2 Sequences (Bl2seq) program from the stand-alone version of BLASTZ containing BLASTN version 2.0.14 and BLASTP version 2.0.14. This stand-alone version of BLASTZ can be obtained online at fr.com/blast or at ncbi.nlm.nih.gov. Instructions explaining how to use the Bl2seq program can be found in the readme file accompanying BLASTZ. Bl2seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm. BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences. To compare two nucleic acid sequences, the options are set as follows: -i is set to a file containing the first nucleic acid sequence to be compared (e.g., C:\seq1.txt); -j is set to a file containing the second nucleic acid sequence to be compared (e.g., C:\seq2.txt); -p is set to blastn; -o is set to any desired file name (e.g., C:\output.txt); -q is set to -l; -r is set to 2; and all other options are left at their default setting. For example, the following command can be used to generate an output file containing a comparison between two sequences: C:\Bl2seq c:\seq1.txt -j c:\seq2.txt -p blastn -o c:\output.txt -q -l -r 2. To compare two amino acid sequences, the options of Bl2seq are set as follows: -i is set to a file containing the first amino acid sequence to be compared (e.g., C:\seq1.txt); -j is set to a file containing the second amino acid sequence to be compared (e.g., C:\seq2.txt); -p is set to blastp; -o is set to any desired file name (e.g., C:\output.txt); and all other options are left at their default setting. For example, the following command can be used to generate an output file containing a comparison between two amino acid sequences: C:\Bl2seq c:\seq1.txt -j c:\seq2.txt -p blastp -o c:\output.txt. If the two compared sequences share homology, then the designated output file will present those regions of homology as aligned sequences. If the two compared sequences do not share homology, then the designated output file will not present aligned sequences.

[0034] Once aligned, the number of matches is determined by counting the number of positions where an identical nucleotide or amino acid residue is presented in both sequences. The percent sequence identity is determined by dividing the number of matches either by the length of the sequence set forth in the identified sequence (e.g., SEQ ID NO:2), or by an articulated length (e.g., 100 consecutive nucleotides or amino acid residues from a sequence set forth in an identified sequence), followed by multiplying the resulting value by 100. For example, a nucleic acid sequence that has 760 matches when aligned with the sequence set forth in SEQ ID NO:2 is 95.2 percent identical to the sequence set forth in SEQ ID NO:2 (i.e., 760798100=95.2). It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 75.11, 75.12, 75.13, and 75.14 are rounded down to 75.1, while 75.15, 75.16, 75.17, 75.18, and 75.19 are rounded up to 75.2. It also is noted that the length value will always be an integer.

[0035] The terms nucleic acid and polynucleotide are used interchangeably, and refer to both RNA and DNA, including cDNA, genomic DNA, synthetic (e.g., chemically synthesized) DNA, and DNA (or RNA) containing nucleic acid analogs. Polynucleotides can have any three-dimensional structure. A nucleic acid can be double-stranded or single-stranded (i.e., a sense strand or an antisense single strand). Non-limiting examples of polynucleotides include genes, gene fragments, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers, as well as nucleic acid analogs.

[0036] As used herein, isolated, when in reference to a nucleic acid, refers to a nucleic acid that is separated from other nucleic acids that are present in a genome, e.g., a plant genome, including nucleic acids that normally flank one or both sides of the nucleic acid in the genome. The term isolated as used herein with respect to nucleic acids also includes any non-naturally-occurring sequence, since such non-naturally-occurring sequences are not found in nature and do not have immediately contiguous sequences in a naturally-occurring genome.

[0037] An isolated nucleic acid can be, for example, a DNA molecule, provided one of the nucleic acid sequences normally found immediately flanking that DNA molecule in a naturally-occurring genome is removed or absent. Thus, an isolated nucleic acid includes, without limitation, a DNA molecule that exists as a separate molecule (e.g., a chemically synthesized nucleic acid, or a cDNA or genomic DNA fragment produced by PCR or restriction endonuclease treatment) independent of other sequences, as well as DNA that is incorporated into a vector, an autonomously replicating plasmid, a virus (e.g., a pararetrovirus, a retrovirus, lentivirus, adenovirus, or herpes virus), or the genomic DNA of a prokaryote or eukaryote. In addition, an isolated nucleic acid can include a recombinant nucleic acid such as a DNA molecule that is part of a hybrid or fusion nucleic acid. A nucleic acid existing among hundreds to millions of other nucleic acids within, for example, cDNA libraries or genomic libraries, or gel slices containing a genomic DNA restriction digest, is not to be considered an isolated nucleic acid.

[0038] A nucleic acid can be made by, for example, chemical synthesis or polymerase chain reaction (PCR). PCR refers to a procedure or technique in which target nucleic acids are amplified. PCR can be used to amplify specific sequences from DNA as well as RNA, including sequences from total genomic DNA or total cellular RNA. Various PCR methods are described, for example, in PCR Primer: A Laboratory Manual, Dieffenbach and Dveksler, eds., Cold Spring Harbor Laboratory Press, 1995. Generally, sequence information from the ends of the region of interest or beyond is employed to design oligonucleotide primers that are identical or similar in sequence to opposite strands of the template to be amplified. Various PCR strategies also are available by which site-specific nucleotide sequence modifications can be introduced into a template nucleic acid.

[0039] The term polypeptide as used herein refers to a compound of two or more subunit amino acids regardless of post-translational modification (e.g., phosphorylation or glycosylation). The subunits may be linked by peptide bonds or other bonds such as, for example, ester or ether bonds. The term amino acid refers to either natural and/or unnatural or synthetic amino acids, including D/L optical isomers.

[0040] By isolated or purified with respect to a polypeptide it is meant that the polypeptide is separated to some extent from the cellular components with which it is normally found in nature (e.g., other polypeptides, lipids, carbohydrates, and nucleic acids). A purified polypeptide can yield a single major band on a non-reducing polyacrylamide gel. A purified polypeptide can be at least about 75% pure (e.g., at least 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% pure). Purified polypeptides can be obtained by, for example, extraction from a natural source, by chemical synthesis, or by recombinant production in a host cell or transgenic plant, and can be purified using, for example, affinity chromatography, immunoprecipitation, size exclusion chromatography, and ion exchange chromatography. The extent of purification can be measured using any appropriate method, including, without limitation, column chromatography, polyacrylamide gel electrophoresis, or high-performance liquid chromatography.

[0041] A USP10 polypeptide or a nucleic acid encoding a USP10 polypeptide or fragment thereof can be administered to a mammal using any appropriate method. For example, a nucleic acid can be administered to a mammal using a vector such as a viral vector. A vector is a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. In particular, a vector is a replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. A vector can be, without limitation, a viral vector, a plasmid, a RNA vector or a linear or circular DNA or RNA molecule which can consist of chromosomal, non-chromosomal, semi-synthetic, or synthetic nucleic acids. Vectors can be capable of autonomous replication (episomal vector) and/or expression of nucleic acids to which they are linked (expression vectors). Large numbers of suitable vectors are known to those of skill in the art and commercially available.

[0042] Viral vectors for administering nucleic acids (e.g., a nucleic acid encoding a USP10 polypeptide or fragment thereof) to a mammal are known in the art and can be prepared using standard materials (e.g., packaging cell lines, helper viruses, and vector constructs). See, for example, Gene Therapy Protocols (Methods in Molecular Medicine), ed. Jeffrey R. Morgan, Humana Press, Totowa, N.J. (2002) and Viral Vectors for Gene Therapy: Methods and Protocols, ed. Curtis A. Machida, Humana Press, Totowa, N.J. (2003). Virus-based nucleic acid delivery vectors are typically derived from animal viruses, such as adenoviruses, adeno-associated viruses, retroviruses, lentiviruses, vaccinia viruses, herpes viruses, and papilloma viruses. Lentiviruses are a genus of retroviruses that can be used to infect cells (e.g., cancer cells). Adenoviruses contain a linear double-stranded DNA genome that can be engineered to inactivate the ability of the virus to replicate in the normal lytic life cycle. Adenoviruses and adeno-associated viruses can be used to infect cancer cells.

[0043] Viral vectors for nucleic acid delivery can be genetically modified such that the pathogenicity of the virus is altered or removed. The genome of a virus can be modified to increase infectivity and/or to accommodate packaging of a nucleic acid, such as a nucleic acid encoding a USP10 polypeptide or fragment thereof. A viral vector can be replication-competent or replication-defective, and can contain fewer viral genes than a corresponding wild-type virus or no viral genes at all.

[0044] In addition to nucleic acid encoding a USP10 polypeptide or fragment thereof, a viral vector can contain regulatory elements operably linked to a nucleic acid encoding a USP10 polypeptide or fragment thereof. Such regulatory elements can include promoter sequences, enhancer sequences, response elements, signal peptides, internal ribosome entry sequences, polyadenylation signals, terminators, or inducible elements that modulate expression (e.g., transcription or translation) of a nucleic acid. The choice of element(s) that may be included in a viral vector depends on several factors, including, without limitation, inducibility, targeting, and the level of expression desired. For example, a promoter can be included in a viral vector to facilitate transcription of a nucleic acid encoding a USP10 polypeptide or fragment thereof. A promoter can be constitutive or inducible (e.g., in the presence of tetracycline), and can affect the expression of a nucleic acid encoding a USP10 polypeptide or fragment thereof in a general or tissue-specific manner. Tissue-specific promoters include, without limitation, enolase promoter, prion protein (PrP) promoter, and tyrosine hydroxylase promoter.

[0045] As used herein, operably linked refers to positioning of a regulatory element in a vector relative to a nucleic acid in such a way as to permit or facilitate expression of the encoded polypeptide. For example, a viral vector can contain a neuronal-specific enolase promoter and a nucleic acid encoding a USP10 polypeptide or fragment thereof. In this case, the enolase promoter is operably linked to a nucleic acid encoding a USP10 polypeptide or fragment thereof such that it drives transcription in neuronal tumor cells.

[0046] A nucleic acid encoding a USP10 polypeptide or fragment thereof also can be administered to cells using non-viral vectors. Methods of using non-viral vectors for nucleic acid delivery are known to those of ordinary skill in the art. See, for example, Gene Therapy Protocols (Methods in Molecular Medicine), ed. Jeffrey R. Morgan, Humana Press, Totowa, N.J. (2002). For example, a nucleic acid encoding a USP10 polypeptide or fragment thereof can be administered to a mammal by direct injection (e.g., an intratumoral injection) of nucleic acid molecules (e.g., plasmids) comprising nucleic acid encoding a USP10 polypeptide or fragment thereof, or by administering nucleic acid molecules complexed with lipids, polymers, or nanospheres.

[0047] A nucleic acid encoding a USP10 polypeptide or fragment thereof can be produced by standard techniques, including, without limitation, common molecular cloning, polymerase chain reaction (PCR), chemical nucleic acid synthesis techniques, and combinations of such techniques. For example, PCR or RT-PCR can be used with oligonucleotide primers designed to amplify nucleic acid (e.g., genomic DNA or RNA) encoding a USP10 polypeptide or fragment thereof.

[0048] In some cases, a nucleic acid encoding a USP10 polypeptide or fragment thereof can be isolated from a healthy mammal or from a mammal having a clinical condition such as obesity, insulin resistance, diabetes (e.g., type 1 or type 2 diabetes), metabolic syndrome, a neurological disorder, or cancer. For example, a nucleic acid that encodes a wild type USP10 polypeptide having the amino acid sequence set forth in SEQ ID NO:2 can be isolated from a human containing that nucleic acid. The isolated nucleic acid can then be used to generate a viral vector, for example, which can be administered to a mammal so that the level of a USP10 polypeptide or fragment thereof in cancer cells within the mammal is increased.

[0049] This document also provides methods and materials related to identifying agonists or antagonists of USP10-mediated action on polypeptides such as AMPK and mTOR. For example, this document provides methods and materials for using USP10 and AMPK or mTOR polypeptides (e.g., ubiquitinated AMPK or mTOR polypeptides) to identify agents that increase or decrease the ability of USP10 to deubiquitinate substrates such as AMPK and mTOR. In some cases, the kinase activity of ubiquitinated AMPK or mTOR treated with USP10 in the presence and absence of a test agent can be assessed to determine whether or not the test agent increases or decreases the activity of the kinases. For example, an agent that increases the activity of a ubiquitinated AMPK polypeptide or decreases the activity of a ubiquitinated mTOR polypeptide in a manner dependent on the USP10 polypeptide can be considered an agonist of USP10 polypeptide-mediated activation of AMPK polypeptides and inhibition of mTOR polypeptides. Conversely, an agent that decreases the activity of a ubiquitinated AMPK polypeptide or increases the activity of a ubiquitinated mTOR polypeptide in a manner dependent on the USP10 polypeptide can be considered an antagonist of USP10 polypeptide-mediated activation of AMPK polypeptides and inhibition of mTOR polypeptides. The activity of kinase polypeptides can be assessed using assays that are known in the art, including those described in the Examples herein.

[0050] USP10 polypeptide agonists and antagonists can be identified by screening test agents (e.g., from synthetic compound libraries and/or natural product libraries). Test agents can be obtained from any commercial source, or can be chemically synthesized using methods that are known to those of skill in the art. Test agents can be screened and characterized using in vitro cell-based assays, cell free assays, and/or in vivo animal models.

[0051] USP10 agonists or antagonists also can be identified using an in vitro screen that includes using purified His-tagged USP10 polypeptide together with ubiquitin-AMC (BIOMOL) as the substrate. Ubiquitin-AMC is a fluorogenic substrate for a wide range of deubiquitinating enzymes (Dang et al., Biochemistry, 37:1868 (1998)). This fluorescence can allow high-throughput screen of USP10 agonists and antagonists in vitro. Further, in some embodiments, agents that act as USP10 agonists or antagonists (e.g., modified ubiquitin molecules) can be identified using conformational display assays as described, for example, in U.S. Pat. No. 9,139,863 (see, also, Zhang et al., Nature Chem Biol 9:51-58, 2013).

[0052] The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.

EXAMPLES

Example 1

Materials and Methods

[0053] Experimental animalsCRISPR/Cas9-mediated gene editing was performed in adult live mice to obtain liver specific USP10 gene knockout directly, without resorting to knockout in the germline as described elsewhere (Cheng et al., Febs Lett 588:3954-3958, 2014). Briefly, AdenoCas9 virus against GFP (control) or USP10 were packaged in 293A cells. The viral particles were concentrated and purified through gradient centrifugation. AdenoCas9n targeting USP10 (110.sup.10 virus particles/animal), as well as control virus and a control containing only the buffer in which the viruses were suspended, was injected into mice via the tail vein. The vast majority of adenoviruses injected into the tail vein end up in the liver, and other organs and tissues are spared. Ten days after the injection, the animals were sacrificed, the liver was isolated, and genomic DNA, total RNA, and proteins were extracted for analyses.

[0054] Measurement of intracellular lipid, cholesterol, and triglyceride contentsIntracellular lipid droplet contents of cultured cells were evaluated by Oil Red O staining. Lipids in mouse liver were extracted as described elsewhere (Folch et al., J Biol Chem 226:497-509, 1957). Cholesterol and triglyceride levels in extracted lipids were measured enzymatically using reagents from Cayman Chemical (Ann Arbor, Mich.) according to the manufacturer's instruction.

[0055] Hyperinsulinemic-euglycemic clampHyperinsulinemic-euglycemic clamps were performed as described elsewhere (Katz et al., J Clin Endocr Metab 85:2402-2410, 2000). Briefly, mice were anesthetized by intraperitoneal injection of ketamine (100 mg/kg) and xylazine (20 mg/kg). Heparin (200 U/mL) was intraperitoneally injected to prevent blood clotting. A polyethylene catheter was inserted into the right jugular vein for infusion of 20% glucose and insulin (2 mU/mL) in normal saline, using a peristaltic pump. The left carotid artery was cannulated for blood sampling. Insulin (3 mU/kg/min) was infused through the jugular vein catheter from 0 to 120 min. During this period, the blood glucose concentration was monitored every 5 minutes with a glucometer and clamped at euglycemic levels (5.00.5 mmol/L) by a variable infusion of 20% glucose. Clamping was achieved by 90 minutes and maintained for 30 minutes. Mean glucose infusion rates (ml/min/kg) were calculated during the last 30 minutes of the clamp. To determine blood glucose levels, mice were fasted overnight and their blood glucose was monitored by applying tail blood to the glucometer.

[0056] Cell cultureHCT116 p53.sup.+/+ and p53.sup./cells were cultured in McCoy's 5A supplemented with 10% FBS. 293T, AMPK1/2 DKO MEFs were cultured in DMEM supplemented with 10% FBS. HepG2 was cultured in EMEM supplemented with 10% FBS.

[0057] Ub-VS labelingCells were treated as indicated, harvested, and lysed in lysis buffer (50 mM N-2-hydroxyethylpiperazineN9-2-ethanesulfonic acid; pH 7.4], 250 mM sucrose, 10 mM MgCl.sub.2, 2 mM adenosine triphosphate, 1 mM dithiothreitol), followed by removal of debris by centrifugation. Total protein (25 mg) was labeled with 1 M ubiquitin-vinyl sulfone (Ub-VS; U-505; Boston Biochem) probe for 30 minutes at 37 C. and then subjected to western blotting.

[0058] In vitro deubiquitinase enzymatic assayIn vitro enzymatic assays using ubiquitin-7-amido-4-methylcoumarin (Ub-AMC; U-550; Boston Biochem) were performed in 50-100 l reaction buffer (20 mM HEPES-KOH [pH 7.8], 20 mM NaCl, 0.1 mg/ml ovalbumin [A7641; Sigma], 0.5 mM EDTA, and 10 mM DTT) at 25 C. Fluorescence was monitored in an INFINITE M1000 PRO Fluorometer (TECAN).

[0059] Quantitative Real-Time PCRTotal mRNA was isolated from cells using a PARIS Kit (ThermoFisher). Quantitative PCR (qPCR) was performed using the one-step, Brilliant SYBR Green qRT-PCR master mix kit (Stratagene), and the Stratagene Mx3005P Real-Time PCR detection system (Stratagene) using primers against aldoA, ldha, and pdkl. All experiments were performed in triplicate with beta-actin as an internal control. All samples were normalized to -actin mRNA levels. Primer sequences are shown in TABLE 1.

TABLE-US-00003 TABLE1 qPCRprimers Gene Direction Sequence SEQIDNO: Mouse-actin Forward CGGTTCCGATGCCCTGAGGCTCTT 3 Reverse CGTCACACTTCATGATGGAATTGA 4 Mousealdoa Forward GTGGGAAGAAGGAGAACCTG 5 Reverse CTGGAGTGTTGATGGAGCAG 6 Mouseldha Forward TGTCTCCAGCAAAGACTACTGT 7 Reverse GACTGTACTTGACAATGTTGGGA 8 Mousepdk1 Forward ACAAGGAGAGCTTCGGGGTGGATC 9 Reverse CCACGTCGCAGTTTGGATTTATGC 10 human-actin Forward AGGCACCAGGGCGTGAT 11 Reverse CGTCACACTTCATGATGGAATTGA 12 humanaldoc Forward GCCCGTTATGCCAGTATCT 13 Reverse AGCCAAGACCTTCTCTGTAA 14 humanldha Forward GGTTGAGAGTGCTTATGA 15 Reverse AACACTAAGGAAGACATCA 16 humanpdk1 Forward CGGATCAGAAACCGACACA 17 Reverse ACTGAACATTCTGGCTGGTGA 18

[0060] Plasmids and antibodiesAMPK 1 and 2 were cloned into the pMSCV-puro (Sigma), pCMV-HA, pIRES-SFB, pLenti-FLAG 6.3, and pLVX3-IRESpuro vectors for mammalian expression. USP10 expression and shRNA plasmids were as described elsewhere (Yuan et al., Cell 140:384-U121, 2010). Point mutations were performed by a PCR-based site-directed mutagenesis method using Pfu polymerase (Stratagene). AMPK 1, AMPK 2, AMPK 1, AMPK 2, AMPK 1 were cloned into pGEX-4T-1 for bacterial expression. HA-tagged ubiquitin and ubiquitin lysine mutants were obtained from Addgene. Antibodies against AMPK1, AMPK2, pAMPK T172, LKB1 and pan-AMPK substrates were purchased from Cell Signaling. Ubiquitin antibody was obtained from Santa Cruz. Anti-FLAG (M2), anti-HA, and anti--actin antibodies were purchased from Sigma.

[0061] Lentivirus InfectionLentiviruses for infection of HCT116, HepG2, and MEF cells were packaged in HEK293T cells using LIPOFECTAMINE 2000 (ThermoFisher) transfection. Forty-eight hours after transfection, medium was collected and added to the target cells with 8 g/mL polybrene to enhance infection efficiency.

[0062] In vitro deubiquitination of AMPKTo prepare ubiquitinated AMPK as the substrate for the in vitro deubiquitination assay, HCT116 cells were transfected with both HA-Ub and FLAG-AMPK. After 36 hours, ubiquitinated AMPK was purified from the cell extracts with anti-FLAG-affinity column in FLAG-lysis buffer (50 mM Tris-HCl pH 7.8, 137 mM NaCl, 10 mM NaF, 1 mM EDTA, 1% Triton X-100, 0.2% Sarcosyl, 1 mM DTT, 10% glycerol, and fresh proteinase inhibitors). Following extensive washing with the FLAG-lysis buffer, proteins were eluted with FLAG-peptides (Sigma). The recombinant His-USP10 and USP10CA polypeptides were expressed in BL21 cells and purified with the His-tag purification column (Novagen). For the in vitro deubiquitination assay, ubiquitinated AMPK protein was incubated with recombinant USP10 in a deubiquitination buffer (50 mM Tris-HCl pH 8.0, 50 mM NaCl, 1 mM EDTA, 10 mM DTT, 5% glycerol) overnight at 16 C.

[0063] Denaturing Ni-NTA pull-downTransiently transfected or virus infected cells were harvested and pellets were washed once in PBS. Cells were lysed in 8 M urea, 0.1 M NaH.sub.2PO.sub.4, 300 mM NaCl, 0.01 M Tris (pH 8.0). Lysates were briefly sonicated to shear DNA and incubated with Ni-NTA agarose beads (QIAGEN) for 1-2 hours at room temperature. Beads were washed 5 times with 8 M urea, 0.1 M NaH.sub.2PO.sub.4, 300 mM NaCl, 0.01 M Tris (pH 8.0). Input and beads were boiled in loading buffer and subjected to SDS-PAGE and immunoblotting.

[0064] Denaturing immunoprecipitation for ubiquitinationCells were lysed in 100 l 62.5 mM Tris-HCl (PH 6.8), 2% SDS, 10% glycerol, 20 mM NEM and 1 mM iodoacetamide, boiled for 15 minutes, diluted 10 times with NETN buffer containing protease inhibitors, 20 mM NEM, and 1 mM iodoacetamide, and centrifuged to remove cell debris. Cell extracts were subjected to immunoprecipitation with the indicated antibodies, and blotted as indicated.

[0065] Immunoprecipitation, immunoblotting, and in vitro pull-down assayCell lysates were prepared and immunoprecipitation and immunoblotting were performed as described elsewhere (Yuan et al., supra). In brief, cells were lysed with NETN buffer (20 mM Tris-HCl, pH 8.0, 100 mM NaCl, 1 mM EDTA, 0.5% Nonidet P-40) containing 50 mM -glycerophosphate, 10 mM NaF, and 1 mg/ml each of pepstatin A and aprotinin. Whole cell lysates were centrifuged at 12000 rpm for 15 minutes, and then incubated with 2 g of antibody and protein A or protein G Sepharose beads (Amersham Biosciences) for 2 hours or overnight at 4 C. Immunocomplexes were then washed with NETN buffer three times and separated by SDS-PAGE. Immunoblotting was performed following standard procedures. GST fusion proteins were bound to glutathione-Sepharose for 3 hours at 4 C. The beads were washed with PBS twice and incubated with the indicated proteins for 1 hour at 4 C. After washing with NETN three times, the bound proteins were separated by SDS-PAGE and immunoblotted with the indicated antibodies.

[0066] AMPK in vitro kinase assayPurified AMPK (Upstate Biotechnology) was incubated with various substrates (0.5 g) in kinase reaction buffer (15 mM HEPES, pH 7.0, 1 mm dithiothreitol, 18.75 mM MgCl.sub.2, 1.25 mM EGTA, and 125 M ATP and 12.5 Ci of radiolabeled ATP, with or without 150 M AMP, at 30 C. for 30 minutes. The product was separated by SDS-PAGE and subjected to autoradiography. Phosphorylation was detected by incorporation of radiolabeled [-32P] ATP. To study the stoichiometry of phosphorylation of the USP10 S76 [TLPRTPSYSISST (SEQ ID NO:19), synthesized by Peptide 2.0] and SAMS (Abcam) peptides by AMPK, the peptides (20 M) were individually incubated in 100 l of reaction buffer at 30 C. Aliquots (10 l) were removed at various times to measure .sup.32P incorporation.

[0067] Oil-Red-O stainingHepG2 cells were washed with ice-cold PBS, fixed with 10% formalin for 60 minutes, washed with 60% isopropanol, and stained with Oil-Red-O working solution (1.8 mg/ml of Oil-Red-O in 6:4 isopropanol: water solution) for 10 minutes at room temperature. After staining, cells were washed with water four times to remove any remaining dye. For quantification of Oil-Red-O staining, the cell-retained dye was extracted by isopropanol and the content was measured spectrophotometrically at 500 nm.

[0068] StatisticsData are expressed as meanstandard errors of the mean (SEM). Statistical analyses were performed with the Student's t-test or ANOVA. Statistical significance is represented in the figures by * (p<0.05) and ** (p<0.01).

Example 2

USP10 Regulates AMPK Activation and Cellular Metabolism

[0069] Studies described elsewhere identified USP10 as a deubiquitinase for p53, and showed that its deficiency contributes to cell transformation and cell proliferation (Yuan et al., supra). The follow-up studies discussed herein unexpectedly revealed that USP10 also regulates the AMPK pathway. For example, studies demonstrated that in USP10-deficient cells, the phosphorylation of AMPK is dramatically decreased (FIG. 1A). Phosphorylation of the AMPK substrates, ACC1 and Raptor, also was dramatically decreased. These effects were not caused by decreased p53 levels, as similar phenotypes also were observed in HCT116 p53.sup./ cells (FIG. 2A). As AMPK plays key roles in cellular metabolism such as lipid metabolism and glycolysis (Assifi et al., Am J Physiol-Endoc M 289:E794-E800, 2005; Faubert et al., Cell Metab 17:113-124, 2013; Steinberg and Kemp, Physiol Rev 89:1025-1078, 2009), studies were conducted to determine whether USP10 regulates these metabolic processes. Knocking down USP10 resulted in a significant increase in lipid drop formation (FIGS. 1B, 1C, and 2B), lactate production (FIGS. 1D and 2C), and glycolytic gene expression in p53-profient and p53-deficient cells (FIGS. 1E and 2D). All of these metabolic changes suggested that the AMPK pathway is inactivated with USP10 deficiency.

[0070] To determine the contribution of AMPK to the metabolic phenotype observed in USP10 deficient cells, RNAi was used to stably silence USP10 in control and AMPK-deficient cells (FIG. 2E). Expression of USP10 shRNA increased lipid droplet content, lactate production, and glycolytic gene expression in control cells but not in AMPK-deficient cells (FIGS. 2F, 2G, and 2H), indicating that USP10 regulates cellular metabolism through AMPK.

[0071] To determine whether the deubiquitinase activity of USP10 is required for its function in AMPK activation, wide type (WT) or catalytic inactive mutant (CA) USP10 was reconstructed in USP10 deficient cells. The WT USP10, but not the CA mutant, rescued AMPK from the inactivation triggered by USP10 RNAi (FIG. 1F), suggesting that USP10 deubiquitinase activity is required for AMPK activation. It was then determined whether reconstitution of WT USP10 or the CA mutant could reverse the metabolic defects triggered by loss of USP10. While reconstituted WT USP10 decreased lipid droplet formation and glycolytic gene expression, expression of the CA mutant had no significant effect (FIGS. 1G and 1H). Further, after inhibiting USP10 activity with a small molecular inhibitor of USP10 (Spautin-1; see, Liu et al., Cell 147:223-234, 2011), the AMPK activation was largely inhibited (FIG. 1I). These results suggested that USP10 deubiquitinase activity is required for its effects on AMPK activation and cellular metabolism.

Example 3

USP10 Interacts with AMPK and Deubiquitinates AMPK

[0072] The mechanism by which USP10 modulates AMPK activation was then explored. Using recombinant proteins, it was found that USP10 directly interacts with AMPK 1 and 2 but not the other AMPK subunits (FIG. 3A). The physical interaction in cells was further confirmed by coimmunoprecipitation (Co-IP) assays, demonstrating that AMPK Co-IPed with USP10 (FIGS. 3B, 3C, and 3D). Mapping the region of USP10 required for AMPK binding revealed that the N-terminal region (amino acids 1-100) is critical for the interaction with AMPK (FIG. 3E).

[0073] As USP10 is a deubiquitinase that binds to AMPK and regulates AMPK activation, it was hypothesized that USP10 might regulate AMPK activation through the deubiquitination of AMPK. When USP10 was knocked down, the ubiquitination of AMPK significantly increased (FIGS. 3F and 4A). WT USP10 or the catalytically inactive mutant were further expressed in USP10 deficient cells, revealing that WT USP10, but not the CA mutant, decreased ubiquitination of AMPK (FIGS. 3G and 4B), suggesting that USP10 regulates AMPK ubiquitination in cells. To further confirm the deubiquitinase activity toward AMPK, an in vitro deubiquitination assay was performed using bacterially-expressed USP10. While WT USP10 removed ubiquitin chain from AMPK, the catalytically inactive CA mutant could not (FIGS. 3H and 4C). These results indicated that USP10 is a deubiquitinase for AMPK.

Example 4

Ubiquitination of AMPK Regulates its Activation

[0074] No change in AMPK levels was observed when USP10 levels were modulated (FIGS. 1A and 2A). When the linkage of AMPK ubiquitination was examined after USP10 knockdown, it was observed that AMPK was mainly ubiquitinated through K63-specific chains (FIGS. 5A and 6A), and that these K63 ubiquitin chains were regulated by USP10 (FIGS. 5B and 6B). These results suggested that USP10 regulates the K63 ubiquitin chain on AMPK.

[0075] The ubiquitination sites of AMPK regulated by USP10 were further mapped. Analysis of a public proteomic database (Hornbeck et al., Nucleic Acids Res 43:D512-D520, 2015) suggested that AMPK1 and 2 might be ubiquitinated at four potential sites (K71, K285, K396, and K485 in AMPK1, and K60, K379, K391, and K470 in AMPK2) (FIG. 5C). Mutants of the potential AMPK ubiquitination sites (KR) were generated and tested to determine whether USP10 could regulate ubiquitination of these residues. For AMPK2, single site mutants (K60R, K379R, K391R, and K470R) had little effect on total ubiquitination, while the triple K to R mutants had decreased ubiquitination levels and the quadruple K to R mutant (4KR) nearly abolished ubiquitination of AMPK2 (FIG. 5D). These results indicated that these four lysine residues are the major ubiquitin sites on AMPK2. For AMPK1, one single site mutant (K71R) showed a significant decrease in ubiquitination, while the other single site mutants (K285R, K396R, and K485R) had little effect on ubiquitination (FIG. 6C). However, all three K to R mutants still showed stronger ubiquitination than the 4KR mutant (FIG. 6C), suggesting that all four sites are ubiquitinated and that K71 is more extensively ubiquitinated than the other three.

[0076] Studies were then conducted to test whether ubiquitination at these sites is regulated by USP10. As shown in FIGS. 5E and 6D, knockdown of USP10 resulted in increased ubiquitination of WT AMPK. On the other hand, knockdown of USP10 did not affect ubiquitination levels of the AMPK 4KR mutant (FIGS. 5E and 6D). These results suggested that these sites are major ubiquitination sites regulated by USP10.

[0077] To investigate the functional significance of AMPK ubiquitination, activation of WT AMPK and the 4KR AMPK mutant was evaluated by determining Thr172 phosphorylation. Interestingly, the level of Thr172 phosphorylation for the 4KR mutant was much higher than that of WT AMPK (FIGS. 5F and 6E). These results, together with the results showing that USP10 positively regulates AMPK activation, suggested that ubiquitination of AMPK negatively regulates its activation, and that USP10 removes the inhibitory ubiquitination of AMPK.

[0078] Experiments were then conducted to investigate how USP10-mediated ubiquitination affects its activation. LKB1 is the major kinase responsible for the phosphorylation of Thr172 of AMPK under energy stress (Hawley et al. 2003, supra). As ubiquitination of AMPK affects its phosphorylation, the interaction between LKB1 and WT AMPK or the 4KR mutant was examined. As shown in FIGS. 5G and 6F, the AMPK KR mutants bound much more strongly than WT to LKB1, consistent with higher AMPK phosphorylation of these mutants (FIGS. 5F and 6E). These results suggested that ubiquitination of AMPK interferes with its interaction with LKB1.

[0079] Further studies examined whether USP10 regulates AMPK activation by deubiquitinating AMPK. As shown in FIGS. 5H and 6G, knockdown of USP10 decreased the phosphorylation of WT AMPK, and disrupted LKB1-AMPK binding. However, knockdown of USP10 had no significant effect on phosphorylation of the AMPK 4KR mutants, or on LKB1-AMPK 4KR binding. These results suggested that ubiquitination of AMPK blocks LKB1 binding and subsequent AMPK activation, and that USP10 regulates AMPK activation through deubiquitinating AMPK.

[0080] To study the physiological function of AMPK ubiquitination, AMPK12.sup./ MEF were reconstituted with WT AMPK 2 or the 4KR mutant, and the activation of AMPK was evaluated by assessing phosphorylation of AMPK and its substrates, ACC1 and Raptor. While WT AMPK2 could partially restore the levels of phospho-AMPK, phospho-ACC1, and phospho-Raptor, the AMPK 4KR mutant was much more effective (FIG. 5I). Further, when lipogenesis was evaluated in these MEF cells, it was found that the AMPK2 4KR mutant inhibited lipid droplet accumulation better than WT (FIG. 5J). The effect of expressing WT and the 4KR mutant on glycolytic gene expression also was investigated. The AMPK2 4KR mutant had a much stronger effect toward inhibiting glycolytic gene expression (FIG. 5K). These results suggested that ubiquitination of AMPK inhibits its activation and metabolic functions.

Example 5

AMPK Phosphorylates USP10 Under Energy Stress

[0081] AMPK was activated under energy stress, accompanied by a decrease in AMPK ubiquitination (FIGS. 7A and 7B). Since USP10 regulates AMPK ubiquitination and activation, experiments were done to test whether USP10 activity increases during this process. As shown in FIG. 7C, the deubiquitinase activity of USP10 toward Ub-AMC increased significantly after glucose starvation treatment. To further confirm this, a modified deubiquitinating enzyme substrate, ubiquitin vinyl sulfone (Ub-VS), was used (Borodovsky et al., EMBO J20:5187-5196, 2001). Upon catalysis of Ub-VS, a covalent bond is formed between the substrate and the active cysteine residue of the USP10 enzyme, leading to a mobility shift of 8 kDa for the active enzyme in SDS-PAGE. After glucose starvation, a more apparent mobility shift of USP10 was observed (FIG. 7D), indicating increased USP10 activity after glucose starvation.

[0082] Studies were then conducted to explore how USP10 is regulated under energy stress. By sequence analysis, an optimal AMPK substrate motif was observed around Ser76 in the N-terminal portion of USP10 (FIG. 8A). Publically available mass spectrum databases also have indicated that Ser76 (S76) is phosphorylated in cells (Hornbeck et al., supra). To test whether USP10 could be phosphorylated by AMPK and whether such phosphorylation would affect USP10 activity, studies were carried out using a pan-AMPK substrate antibody. As shown in FIG. 8B, the phosphorylation of USP10 was increased significantly after glucose starvation, suggesting that USP10 might be a substrate of AMPK. To confirm this result, an in vitro kinase assay was performed, revealing that AMPK specifically phosphorylated USP10 but not GST in vitro (FIG. 8C), and further suggesting that USP10 is an AMPK substrate. To further confirm phosphorylation of USP10 by AMPK, the phosphorylation of a synthesized USP10 S76 peptide was compared with the phosphorylation of a SAMS peptide (a known AMPK substrate) in an in vitro kinase assay (Davies et al., Eur J Biochem 186:123-128, 1989). The initial rate of phosphorylation for the USP10 peptide was 15536 pmol/min/reaction mix, which was higher than that of SAMS (9518 pmol/min/reaction mix) (FIG. 8D). The maximal stoichiometry of phosphorylation of the USP10 peptide by AMPK was 0.460.04 mol/mol, which also was higher than that of SAMS (0.350.02 mol/mol) (FIG. 8E). These results indicated that USP10 is an in vitro substrate of AMPK.

[0083] Further experiments tested whether the serine at position 76 (S76) of USP10 is the phosphorylation site. After mutation of S76 to Ala, phosphorylation of USP10 by AMPK in vitro was totally abolished (FIG. 8F). Further, the S76A mutant totally abolished the phosphorylation signal of USP10 in cells following glucose starvation (FIG. 8G). These results indicated that AMPK phosphorylates USP10 at Ser76.

Example 6

Phosphorylation of USP10 by AMPK Increases its Activity

[0084] Because USP10 deubiquitinase activity and phosphorylation at S76 were increased following glucose starvation, studies were conducted to test whether S76 phosphorylation affects USP10 activity. USP10 was phosphorylated using active AMPK in vitro, and its activity toward Ub-AMC was evaluated. Compared to unphosphorylated USP10, phosphorylated USP10 showed much higher activity toward Ub-AMC (FIG. 9A). However, the activity of the S76A mutant remained low even after incubating with active AMPK (FIG. 9A). The activity of WT USP10 and the S76A mutant also was compared in cells using the Ub-VS labeling assay. While the activity of WT USP10 increased significantly after glucose starvation, the activity of the S76A mutant did not increase (FIG. 9B). These results suggested that S76 phosphorylation of USP10 increases its deubiquitinase activity. Further tests were conducted to determine whether phosphorylation of S76 on USP10 would affect the ubiquitination and activation of AMPK in cells. WT USP10 and the S76A mutant were reconstituted in USP10 knockdown cells, and AMPK ubiquitination was evaluated. As shown in FIG. 9C, AMPK ubiquitination was stronger in cells expressing the S76A mutant, suggesting that the S76A mutant has much less deubiquitinase activity toward AMPK than WT USP10, and indicating that phosphorylated S76 is important for the deubiquitinase activity of USP10 toward AMPK.

[0085] To study the physiological significance of S76 phosphorylation, WT USP10 or the S76A mutant was again reconstituted in USP10 knockdown cells, and phosphorylation was measured. In cells reconstituted with USP10 S76A, the phosphorylation of AMPK and ACC1 was much lower than in cells reconstituted with WT USP10 (FIG. 9D), indicating that the phosphorylation of USP10 is important for AMPK activation. The effect of USP10 phosphorylation on lipogenesis and glycolytic gene expression also was assessed. While reconstitution of WT USP10 reversed misregulation of lipid droplet formation and glycolytic gene expression caused by USP10 deficiency, expression of the S76A mutant only had a partial rescue effect (FIGS. 9E and 9F). These results suggested that the phosphorylation of USP10 is important for its function in AMPK activation and cellular metabolism. Taken together, these results indicated that AMPK phosphorylates USP10 at S76, which activates USP10 and facilitates further activation of AMPK under energy stress, forming a feedforward loop.

Example 7

Depletion of hepatic USP10 Leads to Multiple Metabolic Defects

[0086] The physiological function of USP10 in animal models was evaluated using an adenovirus-based gene targeting approach to specifically knock out Usp10 in the mouse liver (FIGS. 10A and 10B). Because of the high tropism of adenovirus for hepatocytes, a total loss of USP10 protein was observed in the livers of adenovirus-injected mice, with no sign of USP10 loss in kidney, brain, or spleen tissue as judged by immunoblotting of lysates from these tissues (FIG. 10C). Consistent with the cell based assays, deletion of the Usp10 gene in the liver resulted in a drastic decrease of phospho-AMPK, as well as phospho-ACC1 (FIG. 11A), indicating that AMPK is not properly activated in the absence of USP10 in vivo. Further, Usp10 liver-specific knockout mice showed multiple metabolic defects. For example, knockout of Usp10 significantly increased hepatic triglyceride and cholesterol contents, as measured by a colorimetric assay and HE staining under both normal fat diet and high fat diet conditions (FIGS. 9B, 9C, and 9D). Usp10 knockout mice also showed increased blood glucose levels and decreased glucose infusion rates (FIGS. 1E and 1F), indicating that USP10 regulates hepatic glucose metabolism. These phenotypes are consistent with the function of AMPK in gluconeogenesis and lipogenesis (Assifi et al., supra; Foretz et al., Diabetes 54:1331-1339, 2005; Steinberg and Kemp, supra). Taken together, these results suggested that USP10 plays a key role in AMPK activation and controls lipid and glucose metabolism in vivo.

[0087] Protein kinases are known to utilize downstream signaling members to remove inhibitory effects on upstream members, thus increasing the total flux through the pathway (Avraham and Yarden, Nat Rev Mol Cell Bio 12:104-117, 2011; Pomerening, Febs Lett 583:3388-3396, 2009). In the model presented herein (FIG. 11G), AMPK is initially activated through AMP or ADP binding and phosphorylation of a threonine residue (Thr-172) within the activation loop of its kinase domain. After AMPK is partially activated, AMPK activates USP10 to remove the inhibitory ubiquitination on itself, forming a positive feedforward loop. In this way, the initial minor activation of AMPK is amplified into a sustained response. Disruption of this feedforward loop would lead to improper AMPK activation under energy stress. Thus this feedforward activation mechanism ensures precise regulation of AMPK activity.

[0088] Since USP10 also regulates p53 expression and suppresses tumor cell growth (Yuan et al., supra), phosphorylation of USP10 under energy stress might contribute to p53 level increase and tumor suppression. AMPK also has been shown to activate p53 (Jones et al., Mol Cell 18:283-293, 2005). Thus, the feedforward loop of AMPK-USP10 also may activate p53 through AMPK.

[0089] AMPK plays important roles in a number of cell signaling pathways, including cell growth, autophagy, and metabolism (Hardie, Genes Dev 25:1895-1908, 2011; Mihaylova and Shaw, supra). The key role of AMPK places it as an ideal therapeutic target for the treatment of obesity, insulin resistance, type 2 diabetes, metabolic syndromes, neurological disorders, and cancer (Steinberg and Kemp, supra). In light of the data described herein, which demonstrate an important role for USP10 in AMPK activation, it appears that USP10 could be a potential target for these diseases.

Example 8

USP10 Interacts with and Regulates mTOR Signaling

[0090] mTOR is a serine/threonine protein kinase that regulates cell growth, cell proliferation, cell motility, cell survival, protein synthesis, autophagy, and transcription (Hay and Sonenberg, supra), and is an important tumor target. Experiments were conducted to assess whether USP10 might interact with and/or affect the activity of mTOR. First, Co-IP assays were conducted, demonstrating that USP10 interacts with mTOR (FIGS. 12A and 12B). Further immunoblotting studies demonstrated that USP10 regulates mTOR ubiquitination (FIG. 12C), as ubiquitination of mTOR was increased when USP10 was knocked down with shRNA.

[0091] USP10 also was found to be involved in the response of cancer cells to everolimus, an mTOR inhibitor. As shown in FIG. 12D, survival of cancer cells treated with everolimus was decreased in the absence of USP10. Thus, the inhibitor had a greater effect on cancer cells in the absence of USP10, demonstrating that USP10 regulates the response of cancer cells to this mTOR inhibitor. Studies using shRNA knockdown of USP10 showed similar results, as the mTOR inhibitor had a greater effect on survival of USP10 knockdown cells than on cells treated with a control shRNA (FIG. 12E).

[0092] To determine the effect of USP10 on mTOR signaling, experiments were conducted to assess phosphorylation of the mTOR substrate, S6K, in the presence and absence of USP10. These studies demonstrated that USP10 negatively regulates mTOR signaling. USP10 knockout (FIG. 12F) or knockdown (FIG. 12G) resulted in increased levels of phospho-S6K, while reconstitution of USP10 in knockdown cells resulted in decreased levels of phospho-S6K (FIG. 12H). Thus, deubiquitination of mTOR by USP10 reduces the activity of mTOR, while increased mTOR ubiquitination in USP10 knockout or knockdown cells is associated with increased mTOR kinase activity.

Other Embodiments

[0093] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.