COMPOSITIONS AND METHODS FOR TREATING FUNGAL AND BACTERIAL PATHOGENS

20190030141 ยท 2019-01-31

    Inventors

    Cpc classification

    International classification

    Abstract

    The invention features fragments of the Candida cell surface proteins Als3 and Hyr1 and combinations thereof useful in immunizing a subject against fungal or bacterial infections or both.

    Claims

    1. An isolated polypeptide optionally fused to a heterologous fusion partner, wherein the amino acid sequence of said polypeptide consists of an amino acid sequence having at least 95% identity to Als (18-324) TABLE-US-00022 (SEQIDNO:2) KTITGVFNSFNSLTWSNAATYNYKGPGTPTWNAVLGWSLDGTS ASPGDTFTLNMPCVFKFTTSQTSVDLTAHGVKYATCQFQAGEEFMTFSTLTCTVSNTLTP SIKALGTVTLPLAFNVGGTGSSVDLEDSKCFTAGTNTVTFNDGGKKISINVDFERSNVDP KGYLTDSRVIPSLNKVSTLFVAPQCANGYTSGTMGFANTYGDVQIDCSNIHVGITKGLND WNYPVSSESFSYTKTCSSNGIFITYKNVPAGYRPFVDAYISATDVNSYTLSYANEYTCAG GYWQRAPFTLRWTGYRNSDAGSNG.

    2. An isolated polypeptide optionally fused to a heterologous fusion partner, wherein the amino acid sequence of said polypeptide consists of an amino acid sequence having at least 95% identity to Als3 (Ser/Thr-rich sequence) TABLE-US-00023 (SEQIDNO:3) IVIVATTRTVTDSTTAVTTLPFDPNRDKTKTIEILK PIPTTTITTSYVGVTTSYSTKTAPIGETATVIVDIPYHTTTTVTSKWTGTITSTTTHTNP TDSIDTVIVQVP.

    3. An isolated polypeptide optionally fused to a heterologous fusion partner, wherein the amino acid sequence of said polypeptide consists of an amino acid sequence having at least 95% identity to Hyr1 (hydrophobic sequence) TABLE-US-00024 (SEQIDNO:5) TSRIDRGGIQGFHGDVKVHSGATWAILGTTLCSFFGGLEVEKGASLFIKSDNGPVLALNV ALSTLVRPVINNGVISLNSKSSTSFSNFDIGGSSFTNNGEIYLDSSGLVKSTAYLYAREW TNNGLIVAY.

    4. An isolated polypeptide optionally fused to a heterologous fusion partner, wherein the amino acid sequence of said polypeptide consists of an amino acid sequence having at least 95% identity to Hyr1 (154-350) TABLE-US-00025 (SEQIDNO:6) QNQKAAGNIAFGTAYQTITNNGQICLR HQDFVPATKIKGTGCVTADEDTWIKLGNTILSVEPTHNFYLKDSKSSLIVHAVSSNQTFT VHCFGNGNKLGLTLPLTGNRDHFRFEYYPDTGILQLRADALPQYFKIGKGYDSKLFRIVN SRGLKNAVTYDGPVPNNEIPAVCLIPCTNGPSAPESESDLNTPTTSSIET.

    5. An isolated polypeptide optionally fused to a heterologous fusion partner, wherein the amino acid sequence of said polypeptide consists of an amino acid sequence having at least 95% identity to Hyr1 (201-350) TABLE-US-00026 (SEQIDNO:7) DTWIKLGNTILSVEPTHNFYLKDSKSSLIVHAVSSNQTFT VHGFGNGNKLGLTLPLTGNRDHFRFEYYPDTGILQLRADALPQYFKIGKGYDSKLFRIVN SRGLKNAVTYDGPVPNNEIPAVCLIPCINGPSAPESESDLNTPTTSSIET.

    6. An isolated polypeptide optionally fused to a heterologous fusion partner, wherein the amino acid sequence of said polypeptide consists of an amino acid sequence having at least 95% identity to Hyr1 (25-469) TABLE-US-00027 (SEQIDNO:8) TSRIDRGGIQGFHGDVKVHSGATWAILGTTLCSFFG GLEVEKGASLFIKSDNGPVLALNVALSTLVRPVINNGVISLNSKSSTSFSNFDIGGSSFT NNCEIYLDSSGLVKSTAYLYAREWTNNCLIVAYQNQKAACNIAFCTAYQTITNNGQICLR HQDFVPATKIKGTGCVTADEDTWIKLGNTILSVEPTHNFYLKDSKSSLIVHAVSSNQTFT VHGFGNGNKLGLTLPLTGNRDHFRFEYYPDTGILQLRADALPQYFKIGKGYDSKLFRIVN SRGLKNAVTYDGPVPNNEIPAVCLIPCTNGPSAPESESDLNTPTTSSIETSSYSSAATES SVVSESSSAVDSLTSSSLSSKSESSDVVSSTTNIESSSTAIETTMNSESSTDAGSSSISQ SESSSTAITSSSETSSSESMSASSTTASNTSIETDSGIVSQSESSSNAL.

    7. An isolated polypeptide optionally fused to a heterologous fusion partner, wherein the amino acid sequence of said polypeptide consists of an amino acid sequence having at least 95% identity to Hyr1 (201-469) TABLE-US-00028 (SEQIDNO:9) DTWIKLGNTILSVEPTHNFYLKDSKSSLIVHAVSSNQTFT VHGFGNGNKLGLTLPLTGNRDHFRFEYYPDTGILQLRADALPQYFKIGKGYDSKLFRIVN SRGLKNAVTYDGPVPNNEIPAVCLIPCINGPSAPESESDLNTPTTSSIETSSYSSAATES SVVSESSSAVDSLTSSSLSSKSESSDVVSSTTNIESSSTAIETTMNSESSTDAGSSSISQ SESSSTAITSSSETSSSESMSASSTTASNTSIETDSGIVSQSESSSNAL.

    8. An isolated polypeptide optionally fused to a heterologous fusion partner, wherein the amino acid sequence of said polypeptide consists of an amino acid sequence having at least 95% identity to Hyr1 (Ser/Thr-rich sequence) TABLE-US-00029 (SEQIDNO:10) SSYSSAATESSVVSESSSAVDSLTSSSLSSKSES SDVVSSTTNIESSSTAIETTMNSESSTDAGSSSISQSESSSTAITSSSETSSSESMSASS TTASNTSIETDSGIVSQSESSSNAL.

    9. An isolated polypeptide optionally fused to a heterologous fusion partner, wherein the amino acid sequence of said polypeptide consists of an amino acid sequence having at least 95% identity to Hyr1 (154-469) TABLE-US-00030 (SEQIDNO:33) QNQKAAGNIAFGTAYQTITNNGQICLR HQDFVPATKIKGTGCVTADEDTWIKLCNTILSVEPTHNFYLKDSKSSLIVHAVSSNQTFT VHGFGNGNKLGLTLPLTGNRDHERFEYYPDTGILQLRADALPQYFKIGKGYDSKLFRIVN SRGLKNAVTYDGPVPNNEIPAVCLIPCTNGPSAPESESDLNTPTTSSIETSSYSSAATES SVVSESSSAVDSLTSSSLSSKSESSDVVSSTTNIESSSTAIETTMNSESSTDACSSSISQ SESSSTAITSSSEISSSESMSASSTTASNTSIETDSGIVSQSESSSNAL.

    10. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence E. coli expressed Als3/Hyr1 fusion proteins E1=A-B-X-C-D A-B-X-C-D (SEQ ID NO: 11), wherein A is SEQ ID NO: 2; wherein B is SEQ ID NO: 3; wherein X is absent or is a linker peptide; wherein C is SEQ ID NO: 5; and wherein D is SEQ ID NO: 6.

    11. The isolated polypeptide of claim 10, wherein said polypeptide is substantially identical to A-B-C-D (SEQ ID NO: 12).

    12. The isolated polypeptide of claim 10, wherein said polypeptide is A-B-C-D (SEQ ID NO: 12).

    13. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence E2=A-X-C-D A-X-C-D (SEQ ID NO: 13), wherein A is SEQ ID NO: 2; wherein X is absent or is a linker peptide; wherein C is SEQ ID NO: 5; and wherein D is SEQ ID NO: 6.

    14. The isolated polypeptide of claim 13, wherein said polypeptide is substantially identical to A-C-D (SEQ ID NO: 14).

    15. The isolated polypeptide of claim 13, wherein said polypeptide is A-C-D (SEQ ID NO: 14).

    16. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence E3=A-X-D A-X-D (SEQ ID NO: 15), wherein A is SEQ ID NO: 2; wherein X is absent or is a linker peptide; and wherein D is SEQ ID NO: 6.

    17. The isolated polypeptide of claim 16, wherein said polypeptide is substantially identical to A-D (SEQ ID NO: 16).

    18. The isolated polypeptide of claim 16, wherein said polypeptide is A-D (SEQ ID NO: 16).

    19. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence E4=C-D-X-A-B C-D-X-A-B (SEQ ID NO: 17), wherein C is SEQ ID NO: 5; wherein D is SEQ ID NO: 6; wherein X is absent or is a linker peptide; wherein A is SEQ ID NO: 2; and wherein B is SEQ ID NO: 3.

    20. The isolated polypeptide of claim 19, wherein said polypeptide is substantially identical to C-D-A-B (SEQ ID NO: 18).

    21. The isolated polypeptide of claim 19, wherein said polypeptide is C-D-A-B (SEQ ID NO: 18).

    22. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence E5=C-D-X-A C-D-X-A (SEQ ID NO: 19), wherein C is SEQ ID NO: 5; wherein D is SEQ ID NO: 6; wherein X is absent or is a linker peptide; and wherein A is SEQ ID NO: 2.

    23. The isolated polypeptide of claim 22, wherein said polypeptide is substantially identical to C-D-A (SEQ ID NO: 20).

    24. The isolated polypeptide of claim 22, wherein said polypeptide is C-D-A (SEQ ID NO: 20).

    25. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence E6=D-X-A-B D-X-A-B (SEQ ID NO: 21), wherein D is SEQ ID NO: 6; wherein X is absent or is a linker peptide; wherein A is SEQ ID NO: 2; and wherein B is SEQ ID NO: 3.

    26. The isolated polypeptide of claim 25, wherein said polypeptide is substantially identical to D-A-B (SEQ ID NO: 22).

    27. The isolated polypeptide of claim 25, wherein said polypeptide is D-A-B (SEQ ID NO: 22).

    28. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence E7 D-X-A D-X-A (SEQ ID NO: 23), wherein D is SEQ ID NO: 6; wherein X is absent or is a linker peptide; and wherein A is SEQ ID NO: 2.

    29. The isolated polypeptide of claim 28, wherein said polypeptide is substantially identical to D-A (SEQ ID NO: 24).

    30. The isolated polypeptide of claim 28, wherein said polypeptide is D-A (SEQ ID NO: 24).

    31. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence S. cerevisiae expressed Als3/Hyr1 fusion proteins S1=A-B-X-C-D A-B-X-C-D (SEQ ID NO: 11), wherein A is SEQ ID NO: 2; wherein B is SEQ ID NO: 3; wherein X is absent or is a linker peptide; wherein C is SEQ ID NO: 5; and wherein D is SEQ ID NO: 6.

    32. The isolated polypeptide of claim 31, wherein said polypeptide is substantially identical to A-B-C-D (SEQ ID NO: 12).

    33. The isolated polypeptide of claim 31, wherein said polypeptide is A-B-C-D (SEQ ID NO: 12).

    34. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence S2=A-X-C-D-E A-X-C-D-E (SEQ ID NO: 25), wherein A is SEQ ID NO: 2; wherein X is absent or is a linker peptide; wherein C is SEQ ID NO: 5; wherein D is SEQ ID NO: 6; and wherein E is SEQ ID NO: 10.

    35. The isolated polypeptide of claim 34, wherein said polypeptide is substantially identical to A-C-D-E (SEQ ID NO: 26).

    36. The isolated polypeptide of claim 34, wherein said polypeptide is A-C-D-E (SEQ ID NO: 26).

    37. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence S3=A-X-D-E A-X-D-E (SEQ ID NO: 27), wherein A is SEQ ID NO: 2; wherein X is absent or is a linker peptide; wherein D is SEQ ID NO: 6; and wherein E is SEQ ID NO: 10.

    38. The isolated polypeptide of claim 37, wherein said polypeptide is substantially identical to A-D-E (SEQ ID NO: 28).

    39. The isolated polypeptide of claim 37, wherein said polypeptide is A-D-E (SEQ ID NO: 28).

    40. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence S4=C-D-E-X-A-B C-D-E-X-A-B (SEQ ID NO: 29), wherein C is SEQ ID NO: 5; wherein D is SEQ ID NO: 6; wherein E is SEQ ID NO: 10; wherein X is absent or is a linker peptide; wherein A is SEQ ID NO: 2; and wherein B is SEQ ID NO: 3.

    41. The isolated polypeptide of claim 40, wherein said polypeptide is substantially identical to C-D-E-A-B (SEQ ID NO: 30).

    42. The isolated polypeptide of claim 40, wherein said polypeptide is C-D-E-A-B (SEQ ID NO: 30).

    43. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence S5=C-D-X-A-B C-D-X-A-B (SEQ ID NO: 17), wherein C is SEQ ID NO: 5; wherein D is SEQ ID NO: 6; wherein X is absent or is a linker peptide; wherein A is SEQ ID NO: 2; and wherein B is SEQ ID NO: 3.

    44. The isolated polypeptide of claim 43, wherein said polypeptide is substantially identical to C-D-A-B (SEQ ID NO: 18).

    45. The isolated polypeptide of claim 43, wherein said polypeptide is C-D-A-B (SEQ ID NO: 18).

    46. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence S6=D-X-A-B D-X-A-B (SEQ ID NO: 21), wherein D is SEQ ID NO: 6; wherein X is absent or is a linker peptide; wherein A is SEQ ID NO: 2; and wherein B is SEQ ID NO: 3.

    47. The isolated polypeptide of claim 46, wherein said polypeptide is substantially identical to D-A-B (SEQ ID NO: 22).

    48. The isolated polypeptide of claim 46, wherein said polypeptide is D-A-B (SEQ ID NO: 22).

    49. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence S7=D-X-A D-X-A (SEQ ID NO: 23), wherein D is SEQ ID NO: 6; wherein X is absent or is a linker peptide; and wherein A is SEQ ID NO: 2.

    50. The isolated polypeptide of claim 49, wherein said polypeptide is substantially identical to D-A (SEQ ID NO: 24).

    51. The isolated polypeptide of claim 49, wherein said polypeptide is D-A (SEQ ID NO: 24).

    52. An isolated nucleic acid molecule which encodes a polypeptide of any one of claim 1-51, 59, or 118-137.

    53. An isolated nucleic acid molecule comprising a nucleic acid sequence which is substantially identical to the isolated nucleic acid molecule of claim 52.

    54. A vector comprising the nucleic acid molecule of claim 52 or 53.

    55. A cell comprising the nucleic acid molecule of claim 52 or 53.

    56. A method of producing a recombinant polypeptide, said method comprising the steps of: (a) providing a cell transformed with the nucleic acid molecule of claim 52 or 53 encoding an polypeptide positioned for expression in the cell; (b) culturing the transformed cell under conditions for expressing the nucleic acid molecule, wherein said culturing results in expression of said recombinant polypeptide; and (c) isolating the recombinant polypeptide.

    57. The method of claim 56, wherein said cell is a bacterium.

    58. The method of claim 57, wherein said cell is a yeast.

    59. A recombinant polypeptide produced according to the method of claim 56.

    60. A substantially pure antibody that specifically recognizes and binds to any one of the polypeptides of claim 1-51, 59, or 118-137.

    61. An antigenic composition comprising the polypeptide of any one of claim 1-51, 59, or 118-137, and a pharmaceutically acceptable carrier, diluent, and/or excipient.

    62. The composition of claim 61, further comprising an adjuvant.

    63. A method of inducing an immune response in a mammal against an antigen comprising administering a polypeptide of any one of claim 1-51, 59, or 118-137, or the antigenic composition of claim 61 to said mammal, wherein said polypeptide or said composition induces an immune response against said antigen in said mammal.

    64. The method of claim 63, wherein the mammal is administered a single dose of said polypeptide or said composition.

    65. The method of claim 63, wherein the mammal is administered a plurality of doses of said polypeptide or said composition.

    66. The method of claim 63, wherein said plurality of doses are administered at least one day apart.

    67. The method of claim 65, wherein said composition is administered twice.

    68. The method of claim 65, wherein said plurality of doses are administered at least two weeks apart.

    69. The method of any one of claims 63-68, wherein said mammal is a human.

    70. A vaccine comprising an immunogenic amount of the polypeptide of any one of claim 1-51, 59, or 118-137, and a pharmaceutically acceptable excipient.

    71. The vaccine of claim 70, comprising a mixture of distinct polypeptides of any one of claim 1-51, 59, or 118-137.

    72. The vaccine of claim 70 or 71, further comprising an adjuvant.

    73. The vaccine of claim 72, wherein said adjuvant is Alhydrogel.

    74. The vaccine of any one of claims 70-73 for use in the vaccination of a mammal against candidiasis or a gram negative bacterium or S. aureus.

    75. The vaccine of claim 74, wherein said mammal is a human.

    76. The vaccine of claim 74 or 75, wherein said vaccine is to be administered by intramuscular, subcutaneous, or intradermal administration.

    77. The vaccine of claim 76, wherein said vaccine is to be administered by intramuscular administration.

    78. The vaccine of any one of claims 70-77, wherein said vaccination further comprises administering a booster dose.

    79. The vaccine of any one of claims 74-77, wherein said candidiasis is disseminated candidiasis.

    80. The vaccine of claim 79, wherein said disseminated candidiasis is hematogenously disseminated candidiasis.

    81. The vaccine of any one of claims 74-77, wherein said candidiasis is mucosal candidiasis.

    82. The vaccine of any one of claims 74-81, wherein said candidiasis is caused by Candida albicans, Candida glabrata, Candida krusei, Candida parapsilosis, or Candida tropicalis.

    83. A method of vaccinating a mammal against candidiasis comprising administering to said mammal the vaccine of claim 70, thereby vaccinating said mammal against candidiasis or a gram negative bacterium or S. aureus.

    84. The method of claim 83, wherein said mammal is a human.

    85. The method of claim 83 or 84, wherein said vaccine is administered by intramuscular, subcutaneous, or intradermal administration.

    86. The method of claim 83 or 84, wherein said vaccine is administered by intramuscular administration.

    87. The method of any one of claims 83-86, wherein said administering further comprises administering a booster dose.

    88. The method of any one of claims 83-87, wherein said candidiasis is disseminated candidiasis.

    89. The method of claim 88, wherein said disseminated candidiasis is hematogenously disseminated candidiasis.

    90. The method of any one of claims 83-87, wherein said candidiasis is mucosal candidiasis.

    91. The method of any one of claims 83-90, wherein said candidiasis is caused by Candida albicans, Candida glabrata, Candida krusei, Candida parapsilosis, or Candida tropicalis.

    92. A method of producing a chimeric vaccine comprising the steps of: (a) providing a phage, yeast, or virus; (b) inserting into said phage, yeast, or virus a nucleic acid molecule that encodes the polypeptide of any one of claim 1-51, 59, or 118-137; (c) allowing expression of said polypeptide in said phage, yeast, or virus; (d) isolating said phage, yeast, or virus of step (c) comprising said expressed polypeptide; and (e) adding a pharmaceutically acceptable excipient to said isolated phage, yeast, or virus of step (d).

    93. The method of claim 92, wherein said polypeptide is displayed on the surface of said phage, yeast, or virus following step (c).

    94. An isolated monoclonal antibody that binds to the polypeptide of any one of claim 1-51, 59, or 118-137.

    95. The antibody of claim 94, wherein said antibody is human or humanized.

    96. The antibody of claim 94, wherein said antibody is chimeric.

    97. The antibody of any one of claims 94 and 96, wherein said antibody is produced recombinantly.

    98. A diagnostic composition comprising the antibody of any one of claims 94-97.

    99. A pharmaceutical composition comprising the antibody of any one of claims 94-97 and a pharmaceutically acceptable excipient.

    100. The pharmaceutical composition of claim 99, comprising a mixture of antibodies of any one of claims 94-97 with a plurality of distinct specificities.

    101. A pharmaceutical composition comprising polyclonal antibodies that bind to the polypeptide of any one of claim 1-51, 59, or 118-137, or that bind to a mixture of distinct polypeptides of any one of claim 1-51, 59, or 118-137.

    102. The pharmaceutical composition of any one of claims 98-100 for use in the passive immunization of a mammal against candidiasis or a gram negative bacterium or S. aureus.

    103. The composition of claim 102, wherein said mammal is a human.

    104. The composition of claim 102 or 103, wherein said pharmaceutical composition is administered by intramuscular, subcutaneous, or intradermal administration.

    105. The composition of claim 104, wherein said pharmaceutical composition is administered by intramuscular administration.

    106. The composition of any one of claims 102-105, wherein said candidiasis is disseminated candidiasis.

    107. The composition of claim 106, wherein said disseminated candidiasis is hematogenously disseminated candidiasis.

    108. The composition of any one of claims 102-105, wherein said candidiasis is mucosal candidiasis.

    109. The composition of any one of claims 102-108, wherein said candidiasis is caused by Candida albicans, Candida glabrata, Candida krusei, Candida parapsiiosis, or Candida tropicalis.

    110. A method of passive immunization of a mammal against candidiasis comprising administering to said mammal an effective amount of the pharmaceutical composition of claim 102, thereby passively immunizing said mammal against said candidiasis or a gram negative bacterium or S. aureus.

    111. The method of claim 110, wherein said mammal is a human.

    112. The method of claim 110 or 111, wherein said pharmaceutical composition is administered by intramuscular, subcutaneous, or intradermal administration.

    113. The method of claim 112, wherein said pharmaceutical composition is administered by intramuscular administration.

    114. The method of any one of claims 110-113, wherein said candidiasis is disseminated candidiasis.

    115. The method of claim 114, wherein said disseminated candidiasis is hematogenously disseminated candidiasis.

    116. The method of any one of claims 110-113, wherein said candidiasis is mucosal candidiasis.

    117. The method of any one of claims 110-116, wherein said candidiasis is caused by Candida albicans, Candida glabrata, Candida krusei, Candida parapsilosis, or Candida tropicalis.

    118. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence A-B-X-C-D-E (SEQ ID NO: 31), wherein A is absent or is SEQ ID NO: 2; wherein B is absent or is SEQ ID NO: 3; wherein X is absent or is a linker peptide; wherein C is absent or is SEQ ID NO: 5; wherein D is absent or is SEQ ID NO: 6; and wherein E is absent or is SEQ ID NO: 10, provided that two or more of A, B, C, D and E are present in said polypeptide.

    119. The polypeptide of claim 118, wherein said polypeptide is A-B-C-D-E (SEQ ID NO: 32).

    120. The polypeptide of claim 118, wherein said polypeptide is A-B-X-C-D (SEQ ID NO: 11).

    121. The polypeptide of claim 120, wherein said polypeptide is A-B-C-D (SEQ ID NO: 12).

    122. The polypeptide of claim 118, wherein said polypeptide is A-X-C-D-E (SEQ ID NO: 25).

    123. The polypeptide of claim 122, wherein said polypeptide is A-C-D-E (SEQ ID NO: 26).

    124. The polypeptide of claim 118, wherein said polypeptide is A-X-C-D (SEQ ID NO: 13).

    125. The polypeptide of claim 124, wherein said polypeptide is A-C-D (SEQ ID NO: 14).

    126. The polypeptide of claim 118, wherein said polypeptide is A-X-D-E (SEQ ID NO: 27).

    127. The polypeptide of claim 126, wherein said polypeptide is A-D-E (SEQ ID NO: 28).

    128. The polypeptide of claim 118, wherein said polypeptide is A-X-D (SEQ ID NO: 15).

    129. The polypeptide of claim 128, wherein said polypeptide is A-D (SEQ ID NO: 16).

    130. An isolated polypeptide comprising a sequence having substantial identity to the amino acid sequence C-D-E-X-A-B (SEQ ID NO: 29), wherein C is absent or is SEQ ID NO: 5; wherein D is absent or is SEQ ID NO: 6; wherein E is absent or is SEQ ID NO: 10; wherein X is absent or is a linker peptide; wherein A is absent or is SEQ ID NO: 2; wherein B is absent or is SEQ ID NO: 3, provided that two or more of C, D, E, A, and B are present in said polypeptide.

    131. The polypeptide of claim 130, wherein said polypeptide is C-D-E-A-B (SEQ ID NO: 30).

    132. The polypeptide of claim 130, wherein said polypeptide is C-D-X-A-B (SEQ ID NO: 17).

    133. The polypeptide of claim 132, wherein said polypeptide is C-D-A-B (SEQ ID NO: 18).

    134. The polypeptide of claim 130, wherein said polypeptide is D-X-A-B (SEQ ID NO: 21).

    135. The polypeptide of claim 134, wherein said polypeptide is D-A-B (SEQ ID NO: 22).

    136. The polypeptide of claim 130, wherein said polypeptide is D-X-A (SEQ ID NO: 23).

    137. The polypeptide of claim 136, wherein said polypeptide is D-A (SEQ ID NO: 24).

    138. In any aforementioned claim, wherein the gram negative bacterium is Acinetobacter.

    139. In any aforementioned claim, wherein S. aureus is MRSA.

    Description

    DETAILED DESCRIPTION OF THE INVENTION

    [0136] The identification of the Als3 and Hyr1 polypeptide fragments and Als3/Hyr1 fusion polypeptides and other compositions described herein allow, e.g., for the effective treatment of and vaccination against candidiasis or bacterial infections such as those caused by any of those disclosed herein.

    [0137] The invention provides polypeptides, e.g., derived from Als3 or Hyr1 or Als3/Hyr1 fusion polypeptides, conjugates, vaccines, antibodies, compositions, methods of vaccination using same, and methods of production of same, as described in further detail below.

    Polypeptides

    [0138] The invention features polypeptides derived from Als3 or Hyr1. The amino acid sequence of rAls3 protein is as follows:

    TABLE-US-00016 1 KTITGVFNSFNSLTWSNAATYNYKGPGTPTWNAVLGWSLDGTSASPGDTFTLNMPCVFKF 61 TTSQTSVDLTAHGVKYATCQFQAGEEFMTFSTLTCTVSNTLTPSIKALGTVTLPLAFNVG 121 GTGSSVDLEDSKCFTAGTNTVTFNDGGKKISINVDFERSNVDPKGYLTDSRVIPSLNKVS 121 TLFVAPQCANGYTSGTMGFANTYGDVQIDCSNIHVGITKGLNDWNYPVSSESFSYTKTCS 241 SNGIFITYKNVPAGYRPFVDAYISATDVNSYTLSYANEYTCAGGYWQRAPFTLRWTGYRN 301 SDAGSNGIVIVATTRTVTDSTTAVTTLPFDPNRDKTKTIEILKPIPTTTITTSYVGVTTS 361 YSTKTAPIGETATVIVDIPYHTTTTVTSKWTGTITSTTTHTNPTDSIDTVIVQVP
    The amino acid sequence of the rHyr1 protein is as follows:

    TABLE-US-00017 1 TSRIDRGGIQGFHGDVKVHSGATWAILGTTLCSFFGGLEVEKGASLFIKSDNGPVLALNV 61 ALSTLVRPVINNGVISLNSKSSTSFSNFDIGGSSFTNNGEIYLDSSGLVKSTAYLYAREW 121 TNNGLIVAYQNQKAAGNIAFGTAYQTITNNGQICLRHQDFVPATKIKGTGCVTADEDTWI 181 KLGNTILSVEPTHNFYLKDSKSSLIVHAVSSNQTFTVHGFGNGNKLGLTLPLTGNRDHFR 241 FEYYPDTGILQLRADALPQYFKIGKGYDSKLFRIVNSRGLKNAVTYDGPVPNNEIPAVCL 301 IPCTNGPSAPESESDLNTPTTSSIETSSYSSAATESSVVSESSSAVDSLTSSSLSSKSES 361 SDVVSSTTNIESSSTAIETTMNSESSTDAGSSSISQSESSSTAITSSSETSSSESMSASS 401 TTASNTSIETDSGIVSQSESSSNAL
    The invention features polypeptides having substantial identity to any of the polypeptides described herein, including the following.

    TABLE-US-00018 Als3 (SEQIDNO:2) A= KTITGVFNSFNSLTWSNAATYNYKGPGTPTWNAVLGWSLDGTSASPGDTFTLNMPCVFKF TTSQTSVDLTAHCVKYATCQFQAGEEFMTFSTLTCTVSNTLTPSIKALCTVTLPLAFNVC GTGSSVDLEDSKCFTAGTNTVTFNDGGKKISINVDFERSNVDPKGYLTDSRVIPSLNKVS TLFVAPQCANGYTSGTMGFANTYGDVQIDCSNIHVGITKGLNDWNYPVSSESFSYTKTCS SNGIFITYKNVPAGYRPFVDAYISATDVNSYTLSYANEYTCAGGYWQRAPFTLRWTGYRN SDAGSNG. (SEQIDNO:3) B= IVIVATTRTVTDSTTAVTTLPFDPNRDKTKTIEILKPIPTTTITTSYVGVTTS YSTKTAPIGETATVIVDIPYHTTTTVTSKWTGTITSTTTHTNPTDSIDTVIVQVP Hyr1 (SEQIDNO:5) C= TSRIDRGGIQGFHGDVKVHSGAIWAILGTILCSFFGGLEVEKGASLFIKEDNGPVLALNV ALSTLVRPVINNGVISLNSKSSTSFSNFDIGGSSFTNNGEIYLDSSGLVKSTAYLYAREW TNNGLIVAY (SEQIDNO:6) D= QNQKAAGNIAFGTAYQTITNNGQICLRHQDFVPATKIKGTGCVDADEDTWI KLGNTILSVEPTHNFYLKDSKSSLIVHAVSSNQTFTVHGFGNGNKLGLTLPLTGNRDHFR FEYYPDTGILQLRADALPQYFKIGKGYDSKLFRIVNSRGLKNAVTYDGPVPNNEIPAVCL IPCTNGPSAPESESDLNTPTTSSIET X = is present or absent (designated as -X), wherein X is a linker peptide.

    TABLE-US-00019 E1= A-B-X-C-D (SEQ ID NO: 11) E1 (-X)= A-B-C-D (SEQ ID NO: 12) E2= A-X-C-D (SEQ ID NO: 13) E2 (-X)= A-C-D (SEQ ID NO: 14) E3= A-X-D (SEQ ID NO: 15) E3 (-X)= A-D (SEQ ID NO: 16) E4= C-D-X-A-B (SEQ ID NO: 17) E4 (-X)= C-D-A-B (SEQ ID NO: 18) E5= C-D-X-A (SEQ ID NO: 19) E5 (-X)= C-D-A (SEQ ID NO: 20) E6- D-X-A-B (SEQ ID NO: 21) E6 (-X)- D-A-B (SEQ ID NO: 22) E7= D-X-A (SEQ ID NO: 23) E7 (-X)= D-A (SEQ ID NO: 24)

    TABLE-US-00020 Als3 (SEQIDNO:2) A= KTITGVFNSFNSLTWSNAATYNYKGPGTPTWNAVLGWSLDGTSASPGDTFTLNMPCVFKF TTSQTSVDLTAHCVKYATCQFQAGEEFMTFSTLTCTVSNTLTPSIKALCTVTLPLAFNVC GTGSSVDLEDSKCFTAGTNTVTFNDGGKKISINVDFERSNVDPKGYLTDSRVIPSLNKVS TLFVAPQCANGYTSGTMGFANTYGDVQIDCSNIHVGITKGLNDWNYPVSSESFSYTKTCS SNGIFITYKNVPAGYRPFVDAYISATDVNSYTLSYANEYTCAGGYWQRAPFTLRWTGYRN SDAGSNG. (SEQIDNO:3) B= IVIVATTRTVTDSTTAVTTLPFDPNRDKTKTIEILKPIPTTTITTSYVGVTTS YSTKTAPIGETATVIVDIPYHTTTTVTSKWTGTITSTTTHTNPTDSIDTVIVQVP Hyr1 (SEQIDNO:5) C= TSRIDRGGIQGFHGDVKVHSGAIWAILGTILCSFFGGLEVEKGASLFIKEDNGPVLALNV ALSTLVRPVINNGVISLNSKSSTSFSNFDIGGSSFTNNGEIYLDSSGLVKSTAYLYAREW TNNGLIVAY (SEQIDNO:6) D= QNQKAAGNIAFGTAYQTITNNGQICLRHQDFVPATKIKGTGCVDADEDTWI KLGNTILSVEPTHNFYLKDSKSSLIVHAVSSNQTFTVHGFGNGNKLGLTLPLTGNRDHFR FEYYPDTGILQLRADALPQYFKIGKGYDSKLFRIVNSRGLKNAVTYDGPVPNNEIPAVCL IPCTNGPSAPESESDLNTPTTSSIET (SEQIDNO:10) E= SSYSSAATESSVVSESSSAVDSLTSSSLSSKSES SDVVSETTNIESSETAIETTMNSESSTDAGSSSISQSESSSTAITSESETSSEESMSASS TTASNTSIETDSGIVSQSESSSNAL X = is present or absent (designated as -X), wherein X is a linker peptide.

    TABLE-US-00021 S1= A-B-X-C-D (SEQ ID NO: 11) S1 (-X)= A-B-C-D (SEQ ID NO: 12) S2= A-X-C-D-E (SEQ ID NO: 25) S2 (-X)= A-C-D-E ((SEQ ID NO: 26) S3= A-X-D-E (SEQ ID NO: 27) S3 (-X)= A-D-E (SEQ ID NO: 28) S4= C-D-E-X-A-B (SEQ ID NO: 29) S4 (-X)= C-D-E-A-B (SEQ ID NO: 30) S5= C-D-X-A-B (SEQ ID NO: 17) S5 (-X)= C-D-A-B (SEQ ID NO: 18) S6= D-X-A-B (SEQ ID NO: 21) S6 (-X)= D-A-B (SEQ ID NO: 22) S7= D-X-A (SEQ ID NO: 23) S7 (-X)= D-A (SEQ ID NO: 24)

    [0139] In some instances, a modification to a polypeptide as described herein does not substantially reduce the biological activity, e.g., immunogenic activity, of the polypeptide. The modified polypeptide may have or may optimize a characteristic of a polypeptide, such as in vivo stability, bioavailability, toxicity, immunological activity, immunological identity, or conjugation properties.

    [0140] Modifications include those by natural processes, such as posttranslational processing, or by chemical modification techniques known in the art. Modifications may occur anywhere in a polypeptide including the polypeptide backbone, the amino acid side chains, and the amino- or carboxy-terminus. The same type of modification may be present in the same or varying degrees at several sites in a given polypeptide, and a polypeptide may contain more than one type of modification.

    [0141] A variant or otherwise modified polypeptide can also include one or more amino acid insertions, deletions, or substitutions, either conservative or non-conservative (e.g., D-amino acids, desamino acids) in the polypeptide sequence. For example, the addition of one or more cysteine residues to the amino or carboxy terminus of any of the polypeptides of the invention can facilitate conjugation of these polypeptides. Exemplary polypeptides having an N- or C-terminal cysteine.

    [0142] Amino acid substitutions can be conservative (i.e., wherein a residue is replaced by another of the same general type or group) or non-conservative (i.e., wherein a residue is replaced by an amino acid of another type). In addition, a non-naturally occurring amino acid can be substituted for a naturally occurring amino acid (i.e., non-naturally occurring conservative amino acid substitution or a non-naturally occurring non-conservative amino acid substitution).

    [0143] Polypeptides made synthetically, e.g., using methods known in the art, can include substitutions of amino acids not naturally encoded by DNA (e.g., non-naturally occurring or unnatural amino acid). Examples of non-naturally occurring amino acids include D-amino acids, an amino acid having an acetylaminomethyl group attached to a sulfur atom of a cysteine, a pegylated amino acid, the omega amino acids of the formula NH.sub.2(CH.sub.2).sub.nCOOH wherein n is 2-6, neutral nonpolar amino acids, such as sarcosine, t-butyl alanine, t-butyl glycine, N-methyl isoleucine, and norleucine. Phenylglycine may substitute for Trp, Tyr, or Phe; citrulline and methionine sulfoxide are neutral nonpolar, cysteic acid is acidic, and ornithine is basic. Proline may be substituted with hydroxyproline and retain the conformation conferring properties.

    [0144] Variants may be generated by substitutional mutagenesis and retain or even increase the biological activity, e.g., immunogenic activity, of the original polypeptide.

    [0145] The polypeptides described herein can be obtained, e.g., by chemical synthesis using a commercially available automated peptide synthesizer. The synthesized protein or polypeptide can be precipitated and further purified, for example by high performance liquid chromatography (HPLC). Alternatively, the proteins and polypeptides can be obtained by recombinant methods, e.g., that are well-known in the art.

    Conjugates

    [0146] Polypeptides of the invention may be conjugated to another moiety or particle.

    [0147] Protein Moieties

    [0148] In some instances, it may be useful to conjugate the polypeptide to a protein that is immunogenic in the species to be immunized, e.g., keyhole limpet hemocyanin (KLH), CRM197, tetanus toxoid, diptheria toxoid, serum albumin, bovine thyroglobulin, soybean trypsin inhibitor, or a polycation (poly-L-Lysine or poly-L-arginine), e.g., using a bifunctional or derivatizing agent as known in the art, for example, maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide (through lysine residues), glutaraldehyde, or succinic anhydride.

    [0149] In some instances, the conjugate may be a recombinant fusion protein, e.g., to facilitate expression and purification of the polypeptide.

    [0150] Particles for Conjugation or Display of Polypeptides

    [0151] In some instances, polypeptides are conjugated to or displayed on a particle, e.g., a phage, a yeast, a virus, a virosome, or a recombinant virus-like particle.

    [0152] For example, one or more polypeptides may be conjugated to a phage, a yeast, or a virus particle, e.g., to the surface of the particle. In one embodiment, a nucleic acid molecule encoding the polypeptide is inserted into the phage, yeast, or virus particle, resulting in expression of the polypeptide in the phage, yeast, or virus, e.g., at the surface of the particle. The phage, yeast, or virus population containing the polypeptide may then be isolated and prepared, e.g., as a vaccine, by adding a pharmaceutically acceptable excipient.

    [0153] In some embodiments, polypeptides as described herein are conjugated to a virosome or virus-like particle (VLP). Virosomes and VLPs generally contain one or more proteins from a virus optionally combined or formulated with a phospholipid. They are generally non-pathogenic, non-replicating and generally do not contain any of the native viral genome. The viral proteins may be recombinantly produced or isolated from whole viruses. Viral proteins suitable for use in virosomes or VLPs include proteins derived from influenza virus (such as HA or NA), Hepatitis B virus (such as core or capsid proteins), Hepatitis E virus, measles virus, Sindbis virus, Rotavirus, Foot-and-Mouth Disease virus, Retrovirus, Norwalk virus, human Papilloma virus, HIV, RNA-phages, Q-phage (such as coat proteins), GA-phage, fr-phage, AP205 phage, and Ty (such as retrotransposon Ty protein p 1). Virosomes are discussed further in, e.g., Gluck et al. (2002), Vaccine 20:B10-B16, which is incorporated by reference in its entirety.

    [0154] VLPs are discussed further, e.g., in Niikura et al. (2002), Virology 293:273-280; Lenz et al. (2001), J Immunol 166:5346-5355; Pinto et al. (2003), J Infect Dis 188:327-338; Gerber et al. (2001), Viral 75:4752-4760; WO03/024480; and WO03/024481, each of which is incorporated by reference in its entirety.

    Antibodies

    [0155] The invention features monoclonal and polyclonal antibodies that bind to the polypeptides or conjugates described herein.

    [0156] Monoclonal Antibodies

    [0157] Monoclonal antibodies may be made, e.g., using the hybridoma method first described by Kohler et al., Nature 256:495, 1975, or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). In the hybridoma method, a mouse or other appropriate host animal, such as a hamster or macaque monkey, is immunized, e.g., using a polypeptide or conjugate described herein, to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the polypeptide or conjugate used for immunization. Alternatively, lymphocytes may be immunized in vitro. Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103, Academic Press, 1986).

    [0158] The hybridoma cells thus prepared are seeded and grown in a suitable culture medium that can contain one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.

    [0159] Exemplary myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. Among these, particular myeloma cell lines that may be considered for use are murine myeloma lines, such as those derived from MOPC-21 and MPC-11 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, Calif., USA, and SP-2 or X63-Ag8-653 cells available from the American Type Culture Collection, Manassas, Va., USA. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol. 133:3001, 1984; Brodeur et al., Monoclonal Antibody Production Techniques and Applications, pp. 51-63, Marcel Dekker, Inc., New York, 1987).

    [0160] Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against the antigen. The binding specificity of monoclonal antibodies produced by hybridoma cells can be determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).

    [0161] After hybridoma cells are identified that produce antibodies of the desired specificity, affinity, and/or activity, clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103, Academic Press, 1986). Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as ascites tumors in an animal.

    [0162] The monoclonal antibodies secreted by the subclones are suitably separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.

    [0163] DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies). The hybridoma cells serve as a source of such DNA. Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. Recombinant production of antibodies will be described in more detail below.

    [0164] In a further embodiment, antibodies or antibody fragments can be isolated from antibody phage libraries generated using the techniques described, for example, in McCafferty et al., Nature 348:552-554, 1990.

    [0165] Clackson et al., Nature 352:624-628, 1991 and Marks et al., J. Mol. Biol. 222:581-597, 1991, describe the isolation of murine and human antibodies, respectively, using phage libraries. Subsequent publications describe the production of high affinity (nM range) human antibodies by chain shuffling (Marks et al., Bio/Technology 10:779-783, 1992), as well as combinatorial infection and in vivo recombination as a strategy for constructing very large phage libraries (Waterhouse et al., Nucl. Acids. Res. 21:2265-2266, 1993). Thus, these techniques are viable alternatives to traditional monoclonal antibody hybridoma techniques for isolation of monoclonal antibodies.

    [0166] The DNA also may be modified, for example, by substituting the coding sequence for human heavy- and light-chain constant domains in place of the homologous murine sequences (U.S. Pat. No. 4,816,567; Morrison et al., Proc. Natl. Acad. Sci. U.S.A. 81:6851, 1984), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.

    [0167] Typically, such non-immunoglobulin polypeptides are substituted for the constant domains of an antibody, or they are substituted for the variable domains of one antigen-combining site of an antibody to create a chimeric bivalent antibody comprising one antigen-combining site having specificity for an antigen and another antigen-combining site having specificity for a different antigen.

    [0168] Polyclonal Antibodies

    [0169] Polyclonal antibodies are typically raised in animals by multiple injections, e.g., subcutaneous or intraperitoneal injections, of the relevant antigen and an adjuvant. In some instances, it may be useful to conjugate the polypeptide to a protein that is immunogenic in the species to be immunized, e.g., keyhole limpet hemocyanin (KLH), CRM197, tetanus toxoid, diptheria toxoid, serum albumin, bovine thyroglobulin, soybean trypsin inhibitor, or a polycation (poly-L-Lysine or poly-L-arginine), e.g., using a bifunctional or derivatizing agent as known in the art, for example, maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide (through lysine residues), glutaraldehyde, or succinic anhydride.

    Vaccines and Antibody-Containing Pharmaceutical Compositions

    [0170] Formulations for vaccines and antibody-containing pharmaceutical compositions (collectively compositions) as described herein can be prepared using standard pharmaceutical formulation chemistries and methodologies that are readily available to the reasonably skilled artisan. For example, polypeptides, conjugates, or antibodies as described herein can be combined with one or more pharmaceutically acceptable excipients or vehicles. Auxiliary substances, such as wetting or emulsifying agents, pH buffering substances and the like, may be present in the excipient or vehicle. These excipients, vehicles and auxiliary substances are generally pharmaceutical agents that do not induce an immune response in the individual receiving the composition, and which may be administered without undue toxicity. Pharmaceutically acceptable excipients include, but are not limited to, liquids such as water, saline, polyethyleneglycol, hyaluronic acid, glycerol and ethanol. Pharmaceutically acceptable salts can also be included therein, for example, mineral acid salts such as hydrochlorides, hydrobromides, phosphates, sulfates, and the like; and the salts of organic acids such as acetates, propionates, malonates, benzoates, and the like. A thorough discussion of pharmaceutically acceptable excipients, vehicles and auxiliary substances is available in Remington's Pharmaceutical Sciences (Mack Pub. Co., N.J. 1991).

    [0171] Such compositions may be prepared, packaged, or sold in a form suitable for bolus administration or for continuous administration. Injectable compositions may be prepared, packaged, or sold in unit dosage form, such as in ampoules or in multi-dose containers containing a preservative. Compositions may include, but are not limited to, suspensions, solutions, emulsions in oily or aqueous vehicles, pastes, and implantable sustained-release or biodegradable formulations. Such compositions may further comprise one or more additional ingredients including, but not limited to, suspending, stabilizing, or dispersing agents. In one embodiment of a composition for parenteral administration, the active ingredient is provided in dry (for e.g., a powder or granules) form for reconstitution with a suitable vehicle (e.g., sterile pyrogen-free water) prior to parenteral administration of the reconstituted composition. The compositions may be prepared, packaged, or sold in the form of a sterile injectable aqueous or oily suspension or solution. This suspension or solution may be formulated according to the known art, and may comprise, in addition to the active ingredient, additional ingredients such as the dispersing agents, wetting agents, or suspending agents described herein. Such sterile injectable formulations may be prepared using a non-toxic parenterally-acceptable diluent or solvent, such as water or 1,3-butane diol, for example. Other acceptable diluents and solvents include, but are not limited to, Ringer's solution, isotonic sodium chloride solution, and fixed oils such as synthetic mono- or di-glycerides.

    [0172] Other parentally-administrable compositions that are useful include those which comprise the active ingredient in microcrystalline form, in a liposomal preparation, or as a component of a biodegradable polymer systems. Compositions for sustained release or implantation may comprise pharmaceutically acceptable polymeric or hydrophobic materials such as an emulsion, an ion exchange resin, a sparingly soluble polymer, or a sparingly soluble salt.

    [0173] Alternatively, the polypeptides, conjugates, and antibodies described herein may be encapsulated, adsorbed to, or associated with particulate carriers. Suitable particulate carriers include those derived from polymethyl methacrylate polymers, as well as PLG microparticles derived from poly(lactides) and poly(lactide-co-glycolides). See, e.g., Jeffery et al. (1993) Pharm. Res. 10:362-368. Other particulate systems and polymers can also be used, for example, polymers such as polylysine, polyarginine, polyornithine, spermine, spermidine, as well as conjugates of these molecules.

    [0174] The formulated compositions will include an amount of one or more polypeptides or conjugates described herein that is sufficient to mount an immunological response. An immunogenic amount can be readily determined by one of skill in the art. Such an amount will fall in a relatively broad range that can be determined through routine trials. The compositions may contain from about 0.1% to about 99.9% of the polypeptides, conjugates, or antibodies, and can be administered directly to the subject or, alternatively, delivered ex vivo, to cells derived from the subject, using methods known to those skilled in the art.

    [0175] Compositions can include a mixture of distinct polypeptides, conjugates, or antibodies as described herein. For example, vaccines may include, e.g., 2, 3, 4, 5, 6, 7, 8, or more distinct polypeptides or conjugates as described herein, e.g., containing or consisting of the amino acid sequences disclosed herein, or a variant sequence thereof having up to three substitutions, deletions, or additions to the amino acid sequence of any one of amino acid sequences disclosed herein. In one embodiment, a vaccine includes eight distinct polypeptides, wherein the amino acid sequence of the eight polypeptides consist of the sequence of the amino acid sequences disclosed herein. In another embodiment, antibody-containing pharmaceutical compositions may include a mixture of monoclonal or polyclonal antibodies, e.g., having distinct specificities to polypeptides or conjugates as described herein.

    [0176] Substances that stimulate the immune response, e.g., adjuvants, may be included in the compositions, e.g., in vaccines. Examples of chemical compounds used as adjuvants include, but are not limited to, aluminum compounds (e.g., alum, Alhydrogel), oils, block polymers, immune stimulating complexes, vitamins and minerals (e.g., vitamin E, vitamin A, selenium, and vitamin B12), Quil A (saponins), bacterial and fungal cell wall components (e.g., lipopolysaccarides, lipoproteins, and glycoproteins), hormones, cytokines, and co-stimulatory factors.

    Methods of Treatment

    [0177] The invention features methods of vaccinating a mammal against candidiasis including administering to the animal a vaccine as described herein, thereby vaccinating the mammal against candidiasis. Additionally, the invention features methods of passive immunization of a mammal against candidiasis including administering to the mammal an effective amount of a pharmaceutical composition as described herein, thereby passively immunizing the mammal against candidiasis. Candidiasis may include, e.g., disseminated candidiasis, e.g., hematogenously disseminated candidiasis, or mucosal candidiasis. In some instances, the candidiasis is caused, e.g., by Candida albicans, Candida glabrata, Candida krusei, Candida parapsilosis, or Candida tropicalis. Other Candida species include Candida lusitaniae and Candida stellatoidea.

    [0178] Additionally, the compositions and methods described herein may be used, e.g., to vaccinate a human at risk for the development of a S. aureus systemic infection or a skin or soft tissue infection against S. aureus. First, a human at risk for the development of a S. aureus infection or a S. aureus SSSI is identified. Second, the human is administered an immunogenic amount of a vaccine comprising a polypeptide described herein, in a pharmaceutically acceptable medium with or without an adjuvant. For example, the human is administered between one and three doses of a polypeptide disclosed herein containing between 3 and 1000 g of the polypeptide per dose, with multiple doses occurring at intervals of two weeks to six months.

    [0179] It is expected that, following administration of the vaccine, the human is at decreased risk for the development of a S. aureus infection or an S. aureus SSSI for a period lasting from one month to several years or more.

    [0180] Likewise, a human who is identified as having an S. aureus infection or an S. aureus SSSI may be treated by administration of an immunogenic amount of a pharmaceutical composition comprising a Peptide 1 in a pharmaceutically acceptable medium with or without an adjuvant. For example, the human is administered between one and three doses of a polypeptide disclosed herein containing between 3 and 1000 g of the polypeptide per dose, with multiple doses occurring at intervals of two weeks to six months.

    [0181] Again, it is expected that, following administration of the pharmaceutical composition, the S. aureus SSSI of the human is decreased in severity.

    [0182] The compositions and methods described herein may be used, e.g., to vaccinate a bovine species at risk for the development of a systemic S. aureus infection or even S. aureus skin or soft tissue infection against Staphylococcus aureus. In particular, the bovine species may be at risk of developing bovine mastitis caused by S. aureus. First, a bovine species at risk for the development of an S. aureus SSSI, e.g., bovine mastitis, is identified. For example, any milk-producing bovine may be considered to be at risk of developing bovine mastitis caused by S. aureus. Second, the bovine species is administered an immunogenic amount of a vaccine comprising one or more of the polypeptides disclosed herein in a pharmaceutically acceptable medium with or without an adjuvant. For example, the bovine species is administered between one and three doses of a polypeptide disclosed herein containing between 3 and 1000 g of the polypeptide per dose, with multiple doses occurring at intervals of two weeks to six months.

    [0183] It is expected that, following administration of the vaccine, the bovine species is at decreased risk for the development of an S. aureus SSSI, e.g., bovine mastitis.

    [0184] Likewise, a bovine species identified as having an S. aureus SSSI, e.g., bovine mastitis, may be treated by administration of an immunogenic amount of a pharmaceutical composition comprising one or more polypeptides disclosed herein in a pharmaceutically acceptable medium with or without an adjuvant. For example, the bovine species is administered between one and three doses of the polypeptide containing between 3 and 1000 g of the polypeptide per dose, with multiple doses occurring at intervals of two weeks to six months.

    [0185] It is expected that, following administration of the pharmaceutical composition, the S. aureus SSSI, e.g., bovine mastitis, of the bovine species is decreased in severity.

    [0186] Vaccines and antibody-containing pharmaceutical compositions (collectively compositions) as described herein can be administered prophylactically or therapeutically on their own or in combination with other art-known compositions that induce protective responses against pathogens (e.g., viral, bacterial, fungal, or parasitic pathogens), tumors or cancers, allergens, autoimmune disorders, or graft rejection. For example, the compositions can be administered simultaneously, separately, or sequentially, e.g., with another immunization vaccine, such as a vaccine for, e.g., influenza, malaria, tuberculosis, smallpox, measles, rubella, mumps, or any other vaccines known in the art.

    [0187] Compositions as described herein can be delivered to a mammalian subject (e.g., a human or other mammal described herein) using a variety of known routes and techniques. For example, a composition can be provided as an injectable solution, suspension, or emulsion, and administered via intramuscular, subcutaneous, intradermal, intracavity, parenteral, epidermal, intraarterial, intraperitoneal, or intravenous injection using a conventional needle and syringe, or using a liquid jet injection system. Compositions can also be administered topically to skin or mucosal tissue, such as nasally, intratracheally, intestinal, rectally or vaginally, or provided as a finely divided spray suitable for respiratory or pulmonary administration. Other modes of administration include oral administration, suppositories, and active or passive transdermal delivery techniques.

    [0188] The compositions described herein can be administered to a mammalian subject (e.g., a human or other mammal described herein) in an amount that is compatible with the dosage formulation and that will be prophylactically and/or therapeutically effective. An appropriate effective amount will fall in a relatively broad range but can be readily determined by one of skill in the art by routine trials. The Physicians Desk Reference and Goodman and Gilman's The Pharmacological Basis of Therapeutics are useful for the purpose of determining the amount needed.

    [0189] Prophylaxis or therapy can be accomplished by a single direct administration at a single time point or by multiple administrations, optionally at multiple time points. Administration can also be delivered to a single or to multiple sites. Those skilled in the art can adjust the dosage and concentration to suit the particular route of delivery. In one embodiment, a single dose is administered on a single occasion. In an alternative embodiment, a number of doses are administered to a subject on the same occasion but, for example, at different sites. In a further embodiment, multiple doses are administered on multiple occasions. Such multiple doses may be administered in batches, i.e. with multiple administrations at different sites on the same occasion, or may be administered individually, with one administration on each of multiple occasions (optionally at multiple sites). Any combination of such administration regimes may be used.

    [0190] In one embodiment, different compositions of the invention may be administered at different sites or on different occasions as part of the same treatment regime.

    [0191] Different administrations may be performed on the same occasion, on the same day, one, two, three, four, five or six days apart, or one, two, three, four or more weeks apart. In some instances, administrations are 1 to 5 weeks apart, e.g., 2 to 4 weeks apart, such as 2 weeks, 3 weeks or 4 weeks apart. The schedule and timing of such multiple administrations can be optimised for a particular vaccine or pharmaceutical composition by one of skill in the art by routine trials.

    [0192] Dosages

    [0193] An adequate dose of the vaccines or antibody-containing pharmaceutical compositions described herein may vary depending on such factors as preparation method, administration method, age, body weight and sex of the patient, severity of symptoms, administration time, administration route, rate of excretion, and responsivity. A physician of ordinary skill in the art will easily determine and diagnose the administration dose effective for treatment.

    [0194] Compositions may be prepared into unit-dose or multiple-dose preparations by those skilled in the art using a pharmaceutically acceptable carrier and/or excipient according to a method known in the art.

    Vectors

    [0195] The invention also provides vectors containing the nucleic acids encoding the polypeptides disclosed herein. Suitable expression vectors are well-known in the art and include vectors capable of expressing a nucleic acid operatively linked to a regulatory sequence or element such as a promoter region or enhancer region that is capable of regulating expression of the nucleic acid. Appropriate expression vectors include vectors that are replicable in eukaryotic cells and/or prokaryotic cells and vectors that remain episomal or integrate into the host cell genome.

    [0196] The terms vector, cloning vector and expression vector mean the vehicle by which a nucleic acid can be introduced into a host cell. The vector can be used for propagation or harboring a nucleic acid or for polypeptide expression of an encoded sequence. A wide variety of vectors are known in the art and include, for example, plasmids, phages and viruses. Exemplary vectors can be found described in, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual, 3.sup.rd Edition. Cold Spring Harbor Laboratories, Cold Spring Harbor, N.Y., 2001; and Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1999)).

    [0197] Promoters or enhancers, depending upon the nature of the regulation, can be constitutive or regulated. The regulatory sequences or regulatory elements are operatively linked to a nucleic acid of the invention such that the physical and functional relationship between the nucleic acid and the regulatory sequence allows transcription of the nucleic acid.

    [0198] Vectors useful for expression in eukaryotic cells can include, for example, regulatory elements including the SV40 early promoter, the cytomegalovirus (CMV) promoter, the mouse mammary tumor virus (MMTV) steroid-inducible promoter, Moloney murine leukemia virus (MMLV) promoter, and the like. The vectors of the invention are useful for subcloning and amplifying a nucleic acid molecule and for recombinantly expressing a polypeptide as disclosed herein. A vector of the invention can include, for example, viral vectors such as a bacteriophage, a baculovirus or a retrovirus; cosmids or plasmids; and, particularly for cloning large nucleic acid molecules, bacterial artificial chromosome vectors (BACs) and yeast artificial chromosome vectors (YACs). Such vectors are commercially available, and their uses are well known in the art. One skilled in the art will know or can readily determine an appropriate promoter for expression in a particular host cell.

    [0199] The invention additionally provides recombinant cells containing nucleic acids of the invention. The recombinant cells are generated by introducing into a host cell a vector containing a nucleic acid molecule. The recombinant cells are transducted, transfected or otherwise genetically modified. Exemplary host cells that can be used to express recombinant molecules include mammalian primary cells; established mammalian cell lines, such as COS, CHO, HeLa, NIH3T3, HEK 293 and PC12 cells; amphibian cells, such as Xenopus embryos and oocytes; and other vertebrate cells. Exemplary host cells also include insect cells such as Drosophila, yeast cells such as Saccharomyces cerevisiae, Saccharomyces pombe, or Pichia pastoris, and prokaryotic cells such as Escherichia coli.

    [0200] Embodiments of the present invention also provide specific Als3 or Hyr1 polypeptides or Als3/Hyr1 polypeptides that can act as antigens for generating an immune response to Candida, gram negative bacteria including bacteria of the Acinetobacter genus, for example, Acinetobacter baumannii, as well as a staphylococcal bacterium.

    [0201] In some aspects of the invention, the polypeptides of the invention include substantially the same amino acid sequence set forth in any one of the amino acid sequences described herein. For example, the amino acid sequence can have at least 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98% or 99% sequence identity to any one of SEQ ID NOS: 1-33. In other aspects, such polypeptides are immunogenic and capable of eliciting production of an anti-Als3 antibody, anti-HYR1 antibody, and Als3/Hyr1 antibody or immunogenic response in a subject.

    [0202] As described herein, the polypeptides of the invention can encompass substantially similar amino acid sequences having at least about 65% identity with respect to the reference amino acid sequence, and retaining comparable functional and biological activity characteristic of the reference amino acid sequence. In one aspect, polypeptides having substantially the same amino acid sequence will have at least 50% or 60% identity, at least 65% identity, at least 70% identity, at least 75% identity, at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity, at least 98% identity, or at least 99% identity. It is recognized, however, that polypeptides, or encoding nucleic acids, containing less than the described levels of sequence identity arising as splice variants or that are modified by conservative amino acid substitutions, or by substitution of degenerate codons are also encompassed within the scope of the present invention.

    Assessment

    [0203] The following examples are intended to illustrate the invention. These are not meant to limit the invention in any way.

    Methods and Materials for Evaluating Treatment of Candidiasis

    [0204] Candida Strains and Growth Conditions

    [0205] C. albicans 15663, C. glabrata 31028, C. parapsilosis 22019 and C. tropicalis 4243 are clinical bloodstream isolates collected from Harbor-UCLA Medical Center. C. krusei 91-1159 was generously provided by Michael Rinaldi, San Antonio, Tex. C. albicans strains CAAH-31 and THE31 are as described in the literature. All tested strains were routinely grown in YPD (2% Bacto Peptone, 1% yeast extract, 2% dextrose). Cell densities were determined by counting in a hemacytometer.

    [0206] Recombinant Polypeptides and Rabbit Polyclonal Antibodies

    [0207] Recombinant polypeptides are generated according to standard methods. To generate antibodies, the peptides may be purified and conjugated to keyhole limpet hemocyanin (KLH) before raising rabbit antiserum individually using a standard immunization protocol. Total IgG from pooled serum is affinity purified using Pierce Protein A plus Agarose (Thermo Scientific, Rockford, Ill.) prior to administering in passive immunization studies.

    [0208] Immunization Protocol and Animal Studies

    [0209] All active vaccinations are conducted according to standard methods. In brief, juvenile (10-12 week) Balb/C mice are vaccinated subcutaneously with 30 g of a polypeptide mixed with alum (2% Alhydrogel; Brenntag Biosector, Frederikssund, Denmark) as an adjuvant in phosphate buffered saline (PBS) on day 0, boosted with the same dose on day 21, then infected via the tail vein on day 35. Control mice are vaccinated with alum alone.

    [0210] To test the efficacy of the vaccine in immunocompromised mice, mice are vaccinated as above prior to inducing neutropenia by intraperitoneal injection of 200 mg/kg of cyclophosphamide on day 2 followed by another dose of 100 mg/kg on day +7 relative to infection. This regimen results in approximately 10 days of leucopenia with reduction in neutrophil, lymphocyte and monocyte counts according to standard methods. For both immunocompetent and neutropenic mice differences in survival between vaccinated and adjuvant vaccinated mice are compared by the Log Rank test.

    [0211] For passive immunization, immune IgG is administered intraperitoneally to nave mice 2 h before infecting i.v. with C. albicans. Control mice are given isotype matching IgG (Innovative Research, USA). IgG doses are repeated 3 days after infection, and survival of mice was monitored twice daily.

    [0212] Quantitative culturing of kidneys from vaccinated or control mice to be infected with different species of Candida is performed according to standard methods. In brief, mice are infected through tail veins. Kidneys are harvested 3 day post infection, homogenized, serially diluted in 0.85% saline, and quantitatively cultured on YPD that contained 50 g/mL chloramphenicol. Colonies are counted after incubation of the plates at 37 C. for 24 to 48 h, and results are expressed as log CFU per gram of infected organ.

    [0213] Concomitant with the fungal burden experiment, kidneys are removed aseptically from two mice per group for histopathological examination. Kidneys are immersed in zinc formalin fixative until examination. Fixed organs are dehydrated in graded alcohol solutions, embedded in paraffin, and cut into 6-m-thick sections. Mounted sections are stained with Gomori methenamine silver and examined by light microscopy (Davis et al. (2000) Infect Immun 68: 5953-5959).

    [0214] Enzyme-Linked Immunosorbent Assay (ELISA)

    [0215] To test if a polypeptide induces an immune response, antibody titers of serum samples are collected from vaccinated and control mice are determined by ELISA in 96-well plates as previously described (Ibrahim et al. (2005) Infect Immun 73: 999-1005). Wells are coated at 100 l per well with a peptide (e.g., one of more of peptide 2-11) at 5 g/ml in PBS. Mouse sera are incubated for 1 h at room temperature following a blocking step with Tris-buffered saline (TBS; 0.01 M Tris HCl [pH 7.4], 0.15 M NaCl) containing 3% bovine serum albumin. The wells are then washed three times with TBS containing 0.05% Tween 20, followed by another three washes with TBS. Goat anti-mouse secondary antibody conjugated with horseradish peroxidase (Sigma) is added at a final dilution of 1:5000, and the plate is further incubated for 1 h at room temperature. Wells are then washed with TBS and incubated with substrate containing 0.1 M citrate buffer (pH 5.0), 50 mg of o-phenylenediamine (Sigma), and 10 l of 30% H.sub.2O.sub.2. The color is allowed to develop for 30 min, after which the reaction is terminated by addition of 10% H.sub.2SO.sub.4 and the optical density (OD) at 490 nm is determined in a microtiter plate reader. Negative control wells received only diluent, and background absorbance is subtracted from the test wells to obtain final OD readings. The ELISA titer is taken as the reciprocal of the last serum dilution that gave a positive OD reading (i.e., more than the mean OD of negative control samples plus 2 standard deviations).

    [0216] F(Ab).sub.2 Blocking Assay

    [0217] To study the mechanism of protection mediated by anti-polypeptides (e.g., one described herein) antibodies in phagocyte-mediated killing of C. albicans, HL-60 cells that have been differentiated to neutrophil-like phenotype are employed (Luo et al., (2010) J Infect Dis 201: 1718-1728). A killing assay is conducted in the presence of anti-peptide IgG or F(ab).sub.2 fragments as described before (Luo (2010) J Infect Dis 201: 1718-1728). In brief, HL-60 cells are induced with 2.5 M of retinoic acid and 1.3% DMSO for three days at 37 C. with 5% CO.sub.2. Immune anti-Als3 or anti-Hyr1 or anti-Als3/Hyr1 polypeptide sera are, if desired, pooled and total IgG is isolated using protein A agarose (Thermo Scientific). Serum collected from the same rabbits prior to immunization with the polypeptides serves as control serum. The F(ab).sub.2 fragments from immune or control IgG is purified with Pierce F(ab).sub.2 Preparation Kit according to the manufacturer's instruction. SDS-PAGE analysis is utilized to indicate >95% of Fc fragment is digested. Next, C. albicans cells overexpressing or suppressing Als3 is incubated with 50 g/ml of vaccinated or control F(ab).sub.2 fragments on ice for 45 min. C. albicans cocultured with the F(ab).sub.2 fragments is incubated with HL-60 derived neutrophils for 1 h at 37 C. with 5% CO.sub.2 prior to sonication and quantitative culturing on YPD plates. % killing is calculated by dividing the number of CFU after coculturing with HL-60 derived neutrophils by the number of CFU from C. albicans incubated with media without neutrophil-like cells.

    [0218] Statistical Analysis

    [0219] The nonparametric log rank test is used to determine differences in the survival times of the mice. Neutrophil killing assay, titers of antibody, and tissue fungal burden is compared by the Mann-Whitney U test for unpaired comparisons. Correlations are calculated with the Spearman rank sum test. P values of <0.05 are considered significant.

    [0220] Expected Results

    [0221] Peptides that significantly improved survival and decreased fungal burden in immunocompetent mice challenged i.v. with C. albicans are taken as being useful in the invention. Similarly, polypeptides that statistically protect immunocompromised mice against candidiasis are useful in the invention. Mice protected from fungal infection after receiving purified IgG targeting a polypeptide disclosed herein in a dose specific manner are not only taken as an indication of the usefulness of passive immunization strategies for treating candidiasis but also for the usefulness of the polypeptide antigen used to raise an immune response. Polypeptide vaccines that substantially reduce tissue fungal burden in BALB/c mice challenged with several non-albicans species of Candida are likewise taken as being useful in the invention.

    Methods and Materials for Evaluating Treatment of an Acinteobacter Infection

    [0222] Recombinant polypeptides disclosed herein are produces according to standard methods, for example, using E. coli expression system. The recombinant polypeptide is then used to actively vaccinate mice. Mice, for example, are immunized with aluminum hydroxide alone or the recombinant polypeptide mixed with aluminum hydroxide (n=9) on day 0, and boosted on day 21. The vaccinated mice are subsequently infected with A. baumannii on day 35. Polypeptide vaccines providing statistically significant survival compared to control mice are taken as useful in the invention. Additionally, measurement of bacterial burden in the tissue of mice vaccinated and infected similarly are examined. The bacterial burden as measured by the number of colony forming units per gram of tissue showing that tissue isolates from kidney, lung and spleen have a lower bacterial burden as compared to control tissue samples are also taken as indicative of useful polypeptide vaccines.

    [0223] In another working example, overall passive immunization against Acinetobacter baumannii infection may also be assayed in diabetic mice. Purified IgG from the eight different polyclonal antibodies are given to diabetic mice 2 hours prior to infection. Commercially available unrelated rabbit IgG is given to diabetic control mice. The mice are then infected with a lethal dose of Acinetobacter baumannii via tail vein injection. Mice identified as significantly surviving longer after receiving a single dose of the appropriate IgG than mice receiving the control IgG (e.g., 80% survival in the anti-polypeptide IgG vs. 0% in the control arm, p<0.0001 by Log Rank test) are taken as evidence of the effectiveness of the polypeptide antigen.

    Methods and Materials for Evaluating Treatment of a Staphylococcal Infection

    [0224] Briefly, to determine whether a polypeptide described herein protects against S. aureus, female Balb/c mice are vaccinated with complete Freund's Adjuvant according to standard methods with a regimen on day 0, followed by a booster dose in Incomplete Freund's Adjuvant at 3 weeks. Two weeks following vaccination, mice are infected via the tail-vein with a lethal dose of S. aureus strain 67-0, which is methicillin-resistant and is known to be virulent in animal models. Polypeptides mediating improved long-term survival in these infected mice are taken as being useful in the invention.

    [0225] Polypeptides may also be tested in the following murine model of skin or soft tissue infection. Polypeptide vaccination is evaluated across a dose range using a regimen of alhydrogel adjuvant. Doses of 3, 10, 30, 100, or 300 g (IM) are studied in parallel. Primary vaccination (day 0) is followed by an identical boost on study day 21. Mice are infected with S. aureus 14 days after boost (study day 35). A subcutaneous skin/soft tissue abscess model is modified from Ding et al. (J. Bacteriol. 2008 190:7123-9) and/or Voyich et al. (J Infect. Dis. 2006 194:1761-1770) for these studies. On study day 35, mice are anesthetized, flanks were shaved and sterilized, and 2107 CFU inocula (without beads or matrix) is introduced into the subcutaneous compartment by injection (100 l). A minimum of 20 mice per control or vaccine-regimen groups is used in each study. Abscess area/volume is then measured in each mouse flank during the study period up to 14 days post-challenge. To do so, mice are anesthetized, and the lesion site length (1) and width (w) is assessed to quantify abscess or dermonecrosis area (cm2). Abscess volume (cm.sup.3) is calculated per the formula for a spherical ellipsoid: [v=(/6)lw2]. For quantitative culture analyses, at pre-selected times post-infection, mice were humanely sacrificed and processed for quantitative culture of abscesses. Each flank are aseptically dissected, the abscess removed and prepared for culture. Abscesses are individually homogenized, and serially diluted in sterile PBS for quantitative culture onto sheep blood agar plates. Cultures are incubated (37C) for 24 hours, and resulting colonies enumerated. For statistical analyses, differences in experimental results are compared based on power estimates indicating that 16-20 mice per group yields >85% power to detect 1 log difference in CFU per gram tissue, or 2 mm abscess area (a=0.05; Mann-Whitney U test. P values are defined according to standard methods.

    [0226] Expected Results

    [0227] Polypeptide vaccines that significantly reduce the abscess area, volume, or CFU densities in the murine model of MRSA skin or soft tissues assay are taken as being useful in the invention. Such results are taken to indicate that the polypeptide vaccine tested is useful as a means to prevent or mitigate MRSA skin infection or abscesses or both in mammals.

    Additional Assessment Utilizing Human PMBCs

    [0228] Useful polypeptide antigens described herein are also identified using standard human PMBCs. PMBCs are obtained from individuals vaccinated using an Als3 or Hyr1 at various time points following vaccination. Collected PMBCs are stored at 80 C. and thawed before use.

    [0229] For an assay, ELISpot plates coated with antibodies to specific human cytokines or chemokines, e.g. IFN-, IL-17A, IL-4, or GRO are used. PBMC samples are then activated in culture for 48 h and are distributed in 96-well ELISpot plates at 200,000 cells per well. Specific polypeptides and/or combinations of polypeptides are added to triplicate wells and incubated for 48-96 h and then the supernatants from each well are removed for analysis. The ELISpot plates are developed to reveal the spot forming units per well reflecting the number or cells in the well that produce the compound of interest. Peptides or combination of peptides having an increase in cytokine or chemokine production relative to unstimulated PMBCs are taken as being useful in the invention.

    Other Embodiments

    [0230] All publications, patents, and patent applications mentioned in the above specification are hereby incorporated by reference. Various modifications and variations of the described methods of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the art are intended to be within the scope of the invention.

    [0231] Other embodiments are in the claims.