MONOCLONAL ANTIBODY OF HUMAN-DERIVED PROCALCITONIN, AND PREPARATION METHOD AND APPLICATION THEREOF

20190031744 ยท 2019-01-31

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention provides a monoclonal antibody that specifically binds to human-derived procalcitonin and application thereof. The present invention also provides a hybridoma cell line secreting the monoclonal antibody and having an accession number of CGMCC No. 10417, and a method for preparing an antibody against procalcitonin by using a procalcitonin mutant antigen as the immunogen.

    Claims

    1. An anti-procalcitonin antibody capable of specifically binding to human-derived procalcitonin, wherein the anti-procalcitonin antibody specifically binds to the same procalcitonin epitope as the anti-procalcitonin monoclonal antibody produced by a hybridoma cell line with an accession number of CGMCC No. 10417.

    2. The anti-procalcitonin antibody according to claim 1, comprising a humanized sequence of the anti-procalcitonin monoclonal antibody produced by a hybridoma cell line with an accession number of CGMCC No. 10417.

    3. The anti-procalcitonin antibody according to claim 1, wherein the anti-procalcitonin antibody is a monoclonal antibody.

    4. The anti-procalcitonin antibody according to claim 1, wherein the anti-procalcitonin antibody specifically binds to an epitope having an amino acid sequence of RLLLAALVQDYV (SEQ ID NO: 1).

    5. The anti-procalcitonin antibody according to claim 1, wherein the anti-procalcitonin antibody is obtained from a hybridoma cell line with an accession number of CGMCC No. 10417.

    6. The anti-procalcitonin antibody according to claim 1, wherein the anti-procalcitonin antibody is obtained from a method comprising the following steps of: (1) mutating the N-terminal amino acid residue(s) of procalcitonin, to obtain a nucleotide sequence corresponding to the sequence of the mutated amino acid residues; (2) inserting the nucleotide sequence into a prokaryotic expression vector, and carrying out an induction expression and protein purification; and (3) immunizing an animal with the purified protein as immunogen, fusing the splenocytes from the animal with mouse myeloma cells to prepare hybridoma cells, and screening to obtain the hybridoma cells that can stably secrete an anti-procalcitonin antibody, and obtain the corresponding monoclonal antibody.

    7. The anti-procalcitonin antibody according to claim 6, wherein the mutation is carried out to the amino acid residues from positions 1 to 57 of procalcitonin.

    8. The anti-procalcitonin antibody according to claim 6, wherein the mutated procalcitonin amino acid sequences are SEQ ID NOs: 2-4.

    9. An immunodetection reagent or a kit comprising the anti-procalcitonin antibody according to claim 1, for detection or quantification of procalcitonin or a fragment thereof.

    10. The immunodetection reagent or kit according to claim 9, wherein the anti-procalcitonin antibody comprises a humanized sequence of the anti-procalcitonin monoclonal antibody produced by a hybridoma cell line with an accession number of CGMCC No. 10417.

    11. The immunodetection reagent or kit according to claim 9, wherein the anti-procalcitonin antibody is a monoclonal antibody.

    12. The immunodetection reagent or kit according to claim 9, wherein the anti-procalcitonin antibody specifically binds to an epitope having an amino acid sequence of RLLLAALVQDYV (SEQ ID NO: 1).

    13. The immunodetection reagent or kit according to claim 9, wherein the anti-procalcitonin antibody is obtained from a hybridoma cell line with an accession number of CGMCC No. 10417.

    14. The immunodetection reagent or kit according to claim 9, wherein the kit comprises at least the anti-procalcitonin antibody according to claim 1, and an antibody against an epitope within an amino acid sequence from positions 50 to 116 of procalcitonin.

    15. The immunodetection reagent or kit according to claim 9, wherein the detection or quantification of procalcitonin or a fragment thereof adopts immunoassay.

    16. A hybridoma cell line for producing an anti-procalcitonin monoclonal antibody, having an accession number of CGMCC No. 10417.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0028] FIG. 1 is the identification results of agarose gel electrophoresis of three mutants. TB1: Mutant 1, M: DL2000 DNA Marker, TB2: Mutant 2, TB3: Mutant 3, wherein the bands indicated by the arrowheads refer to the places of the 500 bp and 300 bp Marker, respectively.

    [0029] FIG. 2 is the identification results of agarose gel electrophoresis of dual-enzyme digested pET34.

    [0030] FIG. 3 is the identification results of agarose gel electrophoresis of bacteria liquid PCR. TB1: Mutant 1, TB2: Mutant 2, TB3: Mutant 3, wherein the bands indicated by the arrowheads refer to the places of the 500bp and 300bp Marker, respectively.

    [0031] FIG. 4 is the identification results of agarose gel electrophoresis of the extracted plasmids pET34-PCT-TB1, pET34-PCT-TB2, and pET34-PCT-TB3.

    [0032] FIG. 5 is the identification results of SDS-PAGE electrophoresis of the purified pET34-PCT-TB1, pET34-PCT-TB2, and pET34-PCT-TB3 protein. The band indicated by the arrowhead is a protein band of 15 kd. L: Loading, M: protein Marker, P: filtered liquid, 80: 80 mM imidazole, 250: 250 mM imidazole.

    BRIEF DESCRIPTION OF DEPOSITION

    [0033] The Balb/c mouse hybridoma cell obtained in the present invention was deposited with an accession number of CGMCC No. 10417 in China General Microbiological Culture Collection Center (CGMCC) on Apr. 1, 2015, CGMCC address: Institute of Microbiology Chinese Academy of Sciences, NO.3 in Court NO.1, Beichen West Road, Chaoyang District, Beijing, Postal code: 100101.

    BRIEF DESCRIPTION OF SEQUENCES

    [0034] The sequences involved in the present invention, including nucleotide sequences and amino acid sequences, have been sorted out to constitute a sequence listing and arranged at the end of the description. In addition, the inventor has submitted a computer readable form file of the sequence listing.

    DETAILED DESCRIPTION OF THE INVENTION

    [0035] The present invention is not limited to the specific methodology, solutions, antibodies or cell lines described herein, since they may vary. In addition, the terms used herein are only used for the purpose of describing the specific embodiments, rather than limiting the scope of the present invention.

    [0036] Unless otherwise defined herein, all the technical and scientific terms and any abbreviations herein have the same meanings as generally understood by one skilled in the art to which the present invention pertains. Although in the practicing of the present invention, methods and materials similar or equivalent to those described herein may be used, the exemplified methods, apparatuses and materials are described herein.

    [0037] Unless otherwise specified, the terms of the present invention have the meanings generally used in the art.

    [0038] The term antibody used in the present invention, refers to any immunoglobulin or whole molecule binding to a specific epitope, and a fragment thereof. The antibody includes, but is not limited to, a polyclonal antibody, a monoclonal antibody, a chimeric antibody, a humanized antibody, a single-chain antibody and a fragment and/or a part of whole antibody, as long as these fragments or parts retain the antigen binding ability of the parent antibody. For example, in the present invention, anti-procalcitonin antibody refers to a monoclonal antibody, a polyclonal antibody, a single-chain antibody, and a fragment or a part thereof having immunological activity, which can specifically bind to procalcitonin protein or a functional variant or functional fragment thereof. In the present invention, the terms such as procalcitonin antibody, anti-procalcitonin antibody and antibody against procalcitonin can be used interchangeably.

    [0039] The term bind (binding) or specifically bind (specific binding) used in the present invention refers to the binding of an antibody to an epitope of an antigen as measured in in vitro assay using a purified wild-type antigen, preferably in plasmon resonance measurement(BIAcore, GE-Healthcare Uppsala, Sweden). The binding affinity is defined by the terms ka (binding rate constant of the antibody from an antibody/antigen complex), kD (dissociation constant) and KD (kD/ka). The term bind (binding) or specifically bind (specific binding) refers to a binding affinity (KD) of 10.sup.8 mol/l or less, preferably of 10.sup.9 to 10.sup.13 mol/l. Thus, the procalcitonin antibody of the present invention may specifically bind to an antigen with a binding affinity (Kd) of 10.sup.8 mol/l or less, preferably of 10.sup.9 to 10.sup.13 mol/l.

    [0040] The term human monoclonal antibody used in the present invention refers to an antibody displaying a single binding specificity which has variable and constant regions derived from human germline immunoglobulin sequences. In one embodiment, the human monoclonal antibody is produced by a hybridoma which includes a B cell obtained from a transgenic non-human animal, e.g. a transgenic mouse, having a genome comprising a human heavy chain transgene and a light human chain transgene, fused to an immortalized cell.

    EXAMPLES

    Example 1

    l Construction of Procalcitonin Mutant Plasmid as Well as Expression and Purification of Recombinant Protein

    [0041] 1.1 Experimental Materials

    [0042] 1.1.1 Bacterial Strain and Plasmid

    [0043] E. coli Top10, BL21(DE3)

    [0044] Plasmid pET34

    [0045] 1.1.2 Primers

    TABLE-US-00001 Mutationstrategy: Mutant1: (SEQIDNO:2) APFRSALESSPADPATLSEEEARLLLAALVQDYVQMKASELEQEQEREGS SLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSD LERDHRPHVSMPQNAN Mutant2: (SEQIDNO:3) APFRSALESSPADPATLSEDEARLLLAALVQDYVQMKAAELEQEQEREGS SLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSD LERDHRPHVSMPQNAN Mutant3: (SEQIDNO:4) APFRSALESSPADPATLAEDEARLLLAALVQDYVQMKASELEQEQEREGS SLDSPRSKRCGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAPGKKRDMSSD LERDHRPHVSMPQNAN Wholegenesynthesis: Mutant1: (SEQIDNO:5) CACGGATCCGCACCGTTCCGTTCTGCGCTGGAAAGCTCTCCAGCCGATCC GGCCACCCTGAGCGAAGAGGAAGCGCGTCTGCTGCTGGCGGCACTGGTCC AGGACTACGTTCAGATGAAAGCGTCTGAACTGGAGCAGGAACAGGAACGC GAAGGTAGCAGCCTGGACTCTCCACGTTCCAAGCGCTGTGGTAACCTGAG CACTTGTATGCTGGGCACCTATACTCAGGACTTCAACAAGTTCCACACTT TCCCGCAGACTGCGATCGGTGTGGGCGCACCGGGTAAGAAACGTGACATG AGCTCCGACCTGGAGCGTGACCACCGTCCACATGTATCCATGCCACAGAA CGCCAACTAACTCGAGCAC Mutant2: (SEQIDNO:6) CACGGATCCGCTCCGTTCCGCAGCGCACTGGAGTCCTCTCCAGCCGACCC TGCTACCCTGTCTGAAGACGAAGCGCGTCTGCTGCTGGCTGCGCTGGTTC AGGACTACGTACAGATGAAGGCGGCTGAACTGGAACAAGAACAGGAGCGC GAAGGCTCCAGCCTGGATTCCCCGCGTAGCAAACGCTGTGGCAACCTGTC CACTTGCATGCTGGGTACCTACACCCAAGACTTTAACAAATTTCACACGT TTCCGCAAACTGCTATTGGCGTTGGTGCCCCGGGTAAGAAACGTGATATG TCTAGCGACCTGGAACGCGATCACCGCCCGCACGTTAGCATGCCGCAGAA CGCAAATTAACTCGAGCAC Mutant3: (SEQIDNO:7) CACGGATCCGCACCATTTCGTTCTGCTCTGGAATCTTCTCCTGCTGATCC TGCAACCCTGGCTGAAGACGAGGCGCGTCTGCTGCTGGCAGCACTGGTTC AGGATTATGTTCAGATGAAAGCGAGCGAACTGGAGCAGGAACAGGAGCGC GAGGGCAGCTCTCTGGATTCTCCTCGTAGCAAACGTTGCGGTAACCTGAG CACCTGCATGCTGGGTACCTACACGCAAGACTTCAACAAATTCCACACTT TTCCGCAGACTGCGATTGGTGTGGGTGCGCCGGGTAAAAAGCGTGACATG AGCTCTGACCTGGAACGTGACCATCGTCCGCATGTTTCTATGCCGCAGAA CGCGAACTAACTCGAGCAC Primerdesign: Mutant1: PCT-TB1-1: (SEQIDNO:8) CACGGATCCGCACCGTTCCGTTCTGCGCTGG PCT-TB1-2: (SEQIDNO:9) TGGCCGGATCGGCTGGAGAGCTTTCCAGCGCAGAACGGAAC PCT-TB1-3: (SEQIDNO:10) CAGCCGATCCGGCCACCCTGAGCGAAGAGGAAGCGCGTCTG PCT-TB1-4: (SEQIDNO:11) TCCTGGACCAGTGCCGCCAGCAGCAGACGCGCTTCCTCTTC PCT-TB1-5: (SEQIDNO:12) CGGCACTGGTCCAGGACTACGTTCAGATGAAAGCGTCTGAA PCT-TB1-6: (SEQIDNO:13) GTTCCTGTTCCTGCTCCAGTTCAGACGCTTTCATCTGAACG PCT-TB1-7: (SEQIDNO:14) CTGGAGCAGGAACAGGAACGCGAAGGTAGCAGCCTGGACTC PCT-TB1-8: (SEQIDNO:15) TACCACAGCGCTTGGAACGTGGAGAGTCCAGGCTGCTACCT PCT-TB1-9: (SEQIDNO:16) GTTCCAAGCGCTGTGGTAACCTGAGCACTTGTATGCTGGGC PCT-TB1-10: (SEQIDNO:17) TTGTTGAAGTCCTGAGTATAGGTGCCCAGCATACAAGTGCT PCT-TB1-11: (SEQIDNO:18) ACCTATACTCAGGACTTCAACAAGTTCCACACTTTCCCGCA PCT-TB1-12: (SEQIDNO:19) GTGCGCCCACACCGATCGCAGTCTGCGGGAAAGTGTGGAAC PCT-TB1-13: (SEQIDNO:20) TCGGTGTGGGCGCACCGGGTAAGAAACGTGACATGAGCTCC PCT-TB1-14: (SEQIDNO:21) CGGTGGTCACGCTCCAGGTCGGAGCTCATGTCACGTTTCTT PCT-TB1-15: (SEQIDNO:22) TGGAGCGTGACCACCGTCCACATGTATCCATGCCACAGAAC PCT-TB1-16: (SEQIDNO:23) GTGCTCGAGTTAGTTGGCGTTCTGTGGCATGGATACATG Mutant2: PCT-TB2-1: (SEQIDNO:24) CACGGATCCGCTCCGTTCCGCAGCGCACTG PCT-TB2-2: (SEQIDNO:25) TAGCAGGGTCGGCTGGAGAGGACTCCAGTGCGCTGCGGAAC PCT-TB2-3: (SEQIDNO:26) CCAGCCGACCCTGCTACCCTGTCTGAAGACGAAGCGCGTCT PCT-TB2-4: (SEQIDNO:27) CCTGAACCAGCGCAGCCAGCAGCAGACGCGCTTCGTCTTCA PCT-TB2-5: (SEQIDNO:28) GCTGCGCTGGTTCAGGACTACGTACAGATGAAGGCGGCTGA PCT-TB2-6: (SEQIDNO:29) CGCGCTCCTGTTCTTGTTCCAGTTCAGCCGCCTTCATCTGT PCT-TB2-7: (SEQIDNO:30) AACAAGAACAGGAGCGCGAAGGCTCCAGCCTGGATTCCCCG PCT-TB2-8: (SEQIDNO:31) CAGGTTGCCACAGCGTTTGCTACGCGGGGAATCCAGGCTGG PCT-TB2-9: (SEQIDNO:32) AACGCTGTGGCAACCTGTCCACTTGCATGCTGGGTACCTAC PCT-TB2-10: (SEQIDNO:33) GTGAAATTTGTTAAAGTCTTGGGTGTAGGTACCCAGCATGCAAG PCT-TB2-11: (SEQIDNO:34) ACCCAAGACTTTAACAAATTTCACACGTTTCCGCAAACTGCTA PCT-TB2-12: (SEQIDNO:35) TTACCCGGGGCACCAACGCCAATAGCAGTTTGCGGAAACGT PCT-TB2-13: (SEQIDNO:36) GTTGGTGCCCCGGGTAAGAAACGTGATATGTCTAGCGACCT PCT-TB2-14: (SEQIDNO:37) GCGGGCGGTGATCGCGTTCCAGGTCGCTAGACATATCACGT PCT-TB2-15: (SEQIDNO:38) GCGATCACCGCCCGCACGTTAGCATGCCGCAGAACGCAAAT PCT-TB2-16: (SEQIDNO:39) GTGCTCGAGTTAATTTGCGTTCTGCGGCA Mutant3: PCT-TB3-1: (SEQIDNO:40) CACGGATCCGCACCATTTCGTTCTGCTCTGGAATCT PCT-TB3-2: (SEQIDNO:41) GTTGCAGGATCAGCAGGAGAAGATTCCAGAGCAGAACGAAA PCT-TB3-3: (SEQIDNO:42) CTCCTGCTGATCCTGCAACCCTGGCTGAAGACGAGGCGCGT PCT-TB3-4: (SEQIDNO:43) CCTGAACCAGTGCTGCCAGCAGCAGACGCGCCTCGTCTTCA PCT-TB3-5: (SEQIDNO:44) GGCAGCACTGGTTCAGGATTATGTTCAGATGAAAGCGAGCG PCT-TB3-6: (SEQIDNO:45) GCTCCTGTTCCTGCTCCAGTTCGCTCGCTTTCATCTGAACA PCT-TB3-7: (SEQIDNO:46) TGGAGCAGGAACAGGAGCGCGAGGGCAGCTCTCTGGATTCT PCT-TB3-8: (SEQIDNO:47) TACCGCAACGTTTGCTACGAGGAGAATCCAGAGAGCTGCCC PCT-TB3-9: (SEQIDNO:48) CGTAGCAAACGTTGCGGTAACCTGAGCACCTGCATGCTGGG PCT-TB3-10: (SEQIDNO:49) TTTGTTGAAGTCTTGCGTGTAGGTACCCAGCATGCAGGTGC PCT-TB3-11: (SEQIDNO:50) CTACACGCAAGACTTCAACAAATTCCACACTTTTCCGCAGAC PCT-TB3-12: (SEQIDNO:51) GGCGCACCCACACCAATCGCAGTCTGCGGAAAAGTGTGGAA PCT-TB3-13: (SEQIDNO:52) TGGTGTGGGTGCGCCGGGTAAAAAGCGTGACATGAGCTCTG PCT-TB3-14: (SEQIDNO:53) GGACGATGGTCACGTTCCAGGTCAGAGCTCATGTCACGCTT PCT-TB3-15: (SEQIDNO:54) GGAACGTGACCATCGTCCGCATGTTTCTATGCCGCAGAACG PCT-TB3-16: (SEQIDNO:55) GTGCTCGAGTTAGTTCGCGTTCTGCGGCATAGAAACA

    [0046] 1.1.3 Main Reagents and Preparation

    [0047] Restrictive endonuclease BamH I, Xho I, Fast pfu DNA polymerase, and Taq polymerase were purchased from Takara Company; T4-DNA ligase was purchased from Promega Company; ampicillin antibiotic was purchased from Sangon Biotech (Shanghai) Co., Ltd.; DL2000 DNA Marker was purchased from GenScript Co., Ltd.; Agarose gel DNA Extraction Kit was purchased from Tiangen Biotech Co., Ltd.; Plasmid Extraction Kit was purchased from Axygen Company; Tryptone and Yeast extract were OXOID products; IPTG and protein Marker were purchased from SunShine Biotechnology Co., LTD.; Ni column gel (Ni-Sepharose 6 FF) was purchased from GE Company.

    [0048] Buffer A: 20 mM Tris, 300 mM NaCl, 20 mM Imi, pH 7.4

    [0049] Buffer B: 20 mM Tris, 300 mM NaCl, 80 mM Imi, pH 7.4

    [0050] Buffer C: 20 mM Tris, 300 mM NaCl, 250 mM Imi, pH 7.4

    [0051] 1.1.4 Main Experimental Apparatus

    [0052] 1) Refrigerated centrifuge

    [0053] 2) Desk centrifuge

    [0054] 3) PCR instrument

    [0055] 4) Nucleic acid electrophoresis apparatus

    [0056] 5) Protein electrophoresis apparatus

    [0057] 6) Gel imaging analyzer

    [0058] 7) Ultrasonic cell disruptor

    [0059] 8) Thermostatic culture shaker

    [0060] 1.2 Experimental Methods

    [0061] 1.2.1 Obtainment of the Target Gene

    [0062] By overlap-extension PCR, 16 primers were linked, respectively, resulting in the full length of three mutants. Agarose gel identification (see FIG. 1) was performed, the PCR product was purified by using an Agarose gel DNA Extraction Kit.

    [0063] 1.2.2 Double Enzyme Digestion of Plasmid and PCR Product

    [0064] 1) Enzyme Digestion of three PCR Products

    TABLE-US-00002 PCR product 15 l Enzyme digestion buffer 3 l BamH I 2 l Xho I 2 l ddH.sub.2O 8 l

    [0065] 2) Enzyme Digestion of Plasmid pET34

    TABLE-US-00003 Plasmid pET34 8 l Enzyme digestion buffer 3 l BamH I 2 l Xho I 2 l ddH.sub.2O 15 l

    [0066] Said reaction solutions were mixed homogeneously, respectively, and after reaction at 37 C. for 30 min, the identification was performed by electrophoresis (see FIG. 2). After complete enzyme digestion, the purification was performed in accordance with the instructions of DNA Fragment Purification Kit.

    [0067] 1.2.3 Ligation Reaction

    [0068] As calculated by DNA ligation reaction calculator, the PCR product was reacted with a carrier DNA at a molar ratio of 9:1, and under the action of T4-DNA ligase, the ligation was performed at 22 C. for 30 min.

    [0069] 1.2.4 Transformation 10 l the ligation product was added to 100 l Top10 competent cells. The mixture was blown with a pipette tip for several times, placed in ice bath for 30 min, subjected to thermal shock at 42 C. for 90 s, placed in ice bath again for 2 min, and added with 800 l LB culture medium. After incubation at 37 C. in a shaker for 1 h, the centrifugation was performed at 6000 rpm for 30 s, and about 800 l supernatant was removed. The bacteria cells were re-suspended and spread onto LB plate with ampicillin.

    [0070] 1.2.5 Bacteria Liquid PCR

    [0071] The next day, the individual bacterial colonies were selected after bacteria grew out.

    [0072] Mutation 1:

    TABLE-US-00004 ddH.sub.2O 20.7 l buffer 3 l dNTP 1 l Primer PCT-TB1-1 1 l Primer PCT-TB1-16 1 l Bacteria liquid 3 l Taq polymerase 0.3 l

    [0073] Mutation 2:

    TABLE-US-00005 ddH.sub.2O 20.7 l buffer 3 l dNTP 1 l Primer PCT-TB2-1 1 l Primer PCT-TB2-16 1 l Bacteria liquid 3 l Taq polymerase 0.3 l

    [0074] Mutation 3:

    TABLE-US-00006 ddH.sub.2O 20.7 l buffer 3 l dNTP 1 l Primer PCT-TB3-1 1 l Primer PCT-TB3-16 1 l Bacteria liquid 3 l Taq polymerase 0.3 l

    [0075] PCR conditions: 95 C., 3 min. 95 C., 30 s, 58 C., 30 s, 72 C., 30 s. 30 cycles. 8 l sample was verified by agarose gel electrophoresis (see FIG. 3).

    [0076] 1.2.6 Plasmid Extraction

    [0077] The extraction of plasmids pET34-PCT-TB1, pET34-PCT-TB2 and pET34-PCT-TB3 were performed in accordance with the instructions of the kit, and 2 l sample was verified by agarose gel electrophoresis (see FIG. 4).

    [0078] 1.2.7 Sequencing

    [0079] The extracted plasmids pET34-PCT-TB1, pET34-PCT-TB2 and pET34-PCT-TB3 were sent to GenScript Company for sequencing. The sequencing results were in accordance with the designed sequences.

    [0080] 1.2.8 Re-Transformation

    [0081] The BL21(DE3) competent cells were separately transformed with the recombinant plasmids pET34-PCT-TB1, pET34-PCT-TB2 and pET34-PCT-TB3, which were verified by sequencing to have the correct sequences.

    [0082] 1.2.9 Expression

    [0083] 1) Activation: individual bacterial colonies containing pET34-PCT-TB1, pET34-PCT-TB2, pET34-PCT-TB3, were picked and cultured in 3 ml LB culture medium overnight.

    [0084] 2) Amplification culture and induction expression: to 100 ml LB liquid culture medium, 1 ml the activated bacteria liquid was added to perform amplification culture; after shaking at 37 C., 200 rpm for 2-3 h, the absorbance value OD.sub.600 of the bacteria was measured. When A.sub.600 nm reached 0.40.6, 1 mol/L IPTG solution was added until its final concentration was 1 mmol/L. After induction expression for 4 h, the bacteria were harvested.

    [0085] 1.2.10 Protein Purification

    [0086] The bacteria were collected by centrifugation at 12000 rpm, and the bacteria were re-suspended in 20 ml Buffer A, after ultrasonation in ice bath for 20 min and centrifugation at 12000 rpm for 20 min, the supernatant was taken, purified by passing through a Ni column, prewashed by Buffer A and Buffer B, and the target protein was eluted with Buffer C, dialyzed into PBS, 20 l the dialyzed sample was identified by SDS-PAGE electrophoresis (see FIG. 5).

    Example 2

    Preparation of Hybridoma Cell Line

    [0087] 2.1 Immunization of Mice

    [0088] Three 6-week old Balb/c mice were used. After Freund's adjuvant and an antigen were mixed and emulsified, the resultant mixture was subcutaneously injected to the back of mice for immunization three times with an interval of 2 weeks. After the completion of immunization, blood was collected from the orbits of mice for determining titer. The mice, the titer of which met the requirement, were directly injected with the antigen intraperitoneally, and were prepared for use three days after the boost immunization.

    [0089] 2.2 SP2/0 Myeloma Cell Culture

    [0090] To an incomplete DMEM medium, 10% fetal bovine serum and 1% double antibody were added, to prepare a complete DMEM medium. 15 ml the complete medium was added to a T75 cell culture flask, in which SP2/0 myeloma cells were cultured. The medium was replaced every two days. When the cells were in exponential phase and the cells spread to 70% of the bottom of the flask, the medium was replaced, and the cells were prepared for use the next day.

    [0091] 2.3 Cell Fusion

    [0092] The spleen of the standby mice was ground in a 200 mesh sterile sieve, and was blown and washed with incomplete DMEM medium. The suspension was transferred to a 50 ml sterile centrifuge tube and mixed homogeneously, and the cells were then counted. SP2/0 culture supernatant was discarded, and the cells were blown off with incomplete DMEM medium, and transferred to a 50 ml sterile centrifuge tube and mixed homogenously, and then counted. The spleen cells and the myeloma cells were mixed at a ratio of 5:1, and centrifuged at 1500 rpm for 3 min, the supernatant was discarded. After mixing homogeneously by flapping, in 37 C. water bath, 1 ml 50% PEG 1500 was added within 1 min, and after standing for 1.5 min, 40 ml incomplete DMEM medium was added to stop the reaction. After centrifugation at 1000 rpm for 10 min, the supernatant was discarded. After mixing homogeneously by flapping, the cells were washed again and centrifuged as described above. The supernatant was discarded. The cells were re-suspended in HAT culture medium (complete DMEM medium+HAT solution) and mixed homogeneously, and then spread onto 96-well cell culture plate, at 100 l/well.

    Example 3

    Screening of Hybridoma Cell Line

    [0093] 3.1 Detection of Culture Supernatant

    [0094] At the seventh day of fusion, a half of the medium in the fusion well was replaced by HT culture medium (complete DMEM medium+HT solution). The supernatant was taken for detection three days later, at 60 l/well. The OD.sub.450 value of the supernatant was measured by indirect ELISA, and the wells, which had a measured value above 2.5 fold of the value of the control well, were used as positive wells and were marked for later use.

    [0095] 3.2 Cell Subclone

    [0096] The marked positive wells were blown with a pasteurpipette, and after mixing homogeneously, a small amount was taken for counting. 200-500 cells were taken for limiting dilution with complete DMEM medium, and spread onto the 96-well cell culture plate containing feeder layer cells, at 200 l/well. The first subcloning was finished. 5-7 days later, the supernatant was taken and detected, and a monoclonal cell stack was chosen to carry out the second subcloning. The operation was repeated until the whole culture plate (containing cells) of the screened hybridoma cells were positive twice, and the cells were obtained from the subclones of the monoclonal cells. The subcloning was stopped, and the finally obtained monoclonal cells were selected and cultured in 24-well cell culture plate, for amplification culture and cryopreservation.

    [0097] 3.3 Cryopreservation of Cells

    [0098] When the hybridoma cells in the 24-well plate spread to 80% of the bottom of the flask, the cells were transferred to a cell culture flask after blowing homogeneously with a pasteurpipette. When the cells spread to 80% of the bottom of the flask, the cells were cryopreserved. The cells in the flask were blown off and transferred to a 50 ml sterile centrifuge tube, and a small amount was taken for counting. The remaining cells were centrifuged at 1500 rpm for 3 min. The supernatant was discarded. After mixing homogeneously by flapping, cryopreservation liquid (90% fetal bovine serum+10% DMSO) was added to prepare a cell suspension (110.sup.6 cells/ml) and was sub-packaged into 2 ml cryopreservation tubes at 1 ml/tube. The tubes were placed in a cell freezing container at 70 C. overnight, and transferred to liquid nitrogen the next day for storage.

    Example 4

    Preparation of Monoclonal Antibodies

    [0099] 4.1 Hybridoma Cell Resuscitation and Culture

    [0100] The desired hybridoma cells were taken from liquid nitrogen, and the freezing tube was quickly placed in 37 C. water bath, and was shaken back and forth to promote quick thawing. The cells were completely thawed within 1 min, and centrifuged at 1500 rpm for 3 min. The supernatant was discarded, and the cells was re-suspended in complete DMEM medium and transferred to a cell culture flask and cultured. The resuscitation was finished. If live cells were observed under a microscope, the resuscitation was successful. Otherwise, the resuscitation was required to be done again.

    [0101] The next day, the medium was replaced with fresh culture medium, and later the medium was replaced every two days. When the cells spread to 70% of the bottom of the flask, the cells were blown off with complete DMEM medium. A half of the cells were transferred to a new culture flask, and cultured in the fresh culture medium supplemented. The cells in the original flask were cultured continuously by supplementing medium. The amplification culture was performed in such a manner until the desired number of cells was achieved.

    [0102] 4.2 Preparation of Ascites Antibody

    [0103] When the cells spread to 80% of the bottom of the flask, the cells in the flask were blown washed with sterile PBS solution, collected in a 50 ml sterile centrifuge tube, and centrifuged at 1500 rpm for 3 min. The supernatant was discarded. The cells were re-suspended in PBS, and centrifuged again after mixing homogenously. The supernatant was discarded. The cells were re-suspended in PBS to prepare a cell suspension at 210.sup.6 cells/ml for later use.

    [0104] Three days before collecting cells, 6-8 week old Balb/c male mice were intraperitoneally injected with sterile paraffin oil, at 0.5 ml/mouse, for later use.

    [0105] The standby mice were intraperitoneally injected with said cell suspension, at 0.5 ml/mouse.

    [0106] 5 days later, ascites was produced in the mice, and the ascites was collected in a centrifuge tube at the end of a 20 ml syringe needle which was inserted into the peritoneal cavity of the mice. When no ascites dripped, the needle was pulled out, and the mice were put back. The ascites was taken every other day. The operation was repeated until the mice died.

    [0107] The collected ascites was stored in the presence of a preservative at 4 C. When the collection of ascites was finished, the ascites was mixed homogeneously, and the ascites antibody was purified.

    [0108] 4.3 Purification of Ascites Antibody

    [0109] To the ascites of the mice, an equal volume of a binding buffer was added. After mixing homogeneously, the obtained mixture was subjected to standing for 1 h at 4 C., and centrifuged (4 C., 12000 rpm, 20 min), the supernatant was taken and subjected to suction filtration through a 0.45 m membrane to remove the particulate matter.

    [0110] After the suction filtration, the ascites was loaded onto a protein A affinity chromatographic column pre-equilibrated with a binding buffer, wherein the flow rate was controlled at 2 mL/min.

    [0111] After the loading, the column was washed with binding buffer until no protein flew out.

    [0112] The column was eluted with pH 3.0 eluent, and the fraction with a high protein content, i.e., the purified monoclonal antibody, was collected in a centrifuge tube in which a neutralizing buffer has been added. After dialysis with PBS, the antibody was determined for its immunological activity, and the antibody was stored in the presence of preservative, for later use.

    [0113] After the antibody was collected, the chromatographic column was regenerated with 3 column volume of regeneration buffer, washed with 20% ethanol, and stored in a 4 C. refrigerator.

    [0114] Binding Buffer: 0.1 M Gly, pH9.0, containing 3 M NaCl;

    [0115] Eluting Buffer: 0.1 M Gly, pH3.0, containing 0.15 M NaCl;

    [0116] Regeneration Buffer: 0.1 M Gly, pH2.0, containing 0.15 M NaCl;

    [0117] Neutralizing Buffer: 1 M Tris-HCl, pH8.0, containing 0.15 M NaCl

    [0118] 4.4 Titer of Monoclonal Antibody

    [0119] The antibody titer was determined by indirect ELISA. The purified antibody was taken and diluted in a gradient from 10.sup.4 to 10.sup.7. Three parallel wells were set for each concentration. Antigen coating: the corresponding antigen was diluted with a coating solution (carbonate buffer pH9.6, 0.05 mol/L) to 2 ug/ml, added to a 96-well ELISA plate, at 100 l/well, incubated at 4 C. overnight (or incubated at 37 C. for 1 h), washed three times, and patted dry.

    [0120] Blocking: blocked with 1% BSA, at 200 l/well, incubated at 37 C. for 1 h, washed three times, and patted dry.

    [0121] Adding an antibody to be tested: the diluted antibody was added to the plate wells, at 100 l/well, and incubated at 37 C. for 1 h (or at 4 C. overnight), washed three times, and patted dry.

    [0122] Adding enzyme-labeled second antibody: goat anti-mouse IgG-HRP was added, a suitable dilution concentration of which was determined by chequerboard titration, at 100 l/well, incubated at 37 C. for 1 h, washed three times, and patted dry.

    [0123] Coloration: TMB color liquid was placed in a 37 C. constant temperature incubator under protection from light, at 100 l/well, and incubated at 37 C. for 1015 min.

    [0124] Stopping the reaction: 50 l of 2 mol/L sulfuric acid was added to each well to stop the reaction.

    [0125] Determination of OD value at 450 nm: the OD value was determined by an ELISA instrument, the value of the blank well was regarded as zero; if the OD value in the well to be tested was greater than 0.2 and above 2.1 fold of the value of the negative control well, the well was regarded as positive; the corresponding antibody dilution factor of the minimum determined value was used as the titer of the antibody, and when the OD value was close to 1.0, the antibody dilution was the best antibody dilution.

    [0126] The titer determination results are as follows:

    TABLE-US-00007 TABLE 1 Antibody OD450 dilutability 1 2 3 10.sup.4 3.024 3.198 3.083 10.sup.5 2.179 2.334 2.546 10.sup.6 1.136 1.279 1.204 10.sup.7 0.262 0.204 0.217 Blank 0.098 0.168 0.087

    [0127] A person skilled in the art shall understand that although for the purpose of exemplification and illustration, the embodiments of the present invention are described herein, various modifications may be made thereto without departing from the spirit and scope of the present invention. Therefore, the embodiments and examples of the present invention shall not be regarded as limiting the present invention. The present invention is defined only by the attached claims.