HERBICIDE-RESISTANT RICE PLANTS, POLYNUCLEOTIDES ENCODING HERBICIDE-RESISTANT ACETOHYDROXYACID SYNTHASE LARGE SUBUNIT PROTEINS, AND METHODS OF USE

20190032029 ยท 2019-01-31

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure provides a method for treating rice. The method comprises the steps of: providing a domestic rice crop plant and at least one AHAS-inhibiting herbicide selected from the group comprising a sulfonylurea herbicide, a sulfonyl carboxamide herbicide, an imidazolinone herbicide, a triazolopyrimidine herbicide, a pyrimidinyloxybenzoate herbicide, and a sulfonylaminocarbonyltriazolinone herbicide; applying an effective amount (measured in g Al/Ha) of one or more of the aforementioned herbicide to the domestic rice crop plant, post-emergence; thereby creating a treated rice plant; and growing the resulting treated rice plant.

    Claims

    1. A method for treating rice, comprising: providing a rice crop plant and at least one sulfonylurea herbicide; applying an effective amount of the at least one sulfonylurea herbicide to the rice crop plant, post-emergence; thereby creating a treated rice plant; and growing the resulting treated rice plant.

    2. The method of claim 1, further comprising harvesting seed from the treated rice plant.

    3. The method of claim 1 or 2, wherein the rice crop plant comprises an acetohydroxyacid synthase large subunit (AHASL) polynucleotide encoding a herbicide-tolerant AHASL polypeptide comprising a leucine substitution at a position corresponding to position 171 of SEQ ID NO:26.

    4. The method of any one of claims 1-3, wherein the rice crop plant comprises an AHASL polypeptide comprising a leucine substitution at the position corresponding to position 171 of SEQ ID NO:26.

    5. The method of any one of claims 1-4, wherein the rice crop plant comprises the herbicide tolerance characteristics of a plant of line IMINTA 15.

    6. The method of any one of claims 1-5, wherein the rice crop plant: (a) is a plant of line IMINTA 15; (b) is a progeny of a plant of line IMINTA 15; (c) is a mutant or recombinant plant of line IMINTA 15; or (d) is a progeny of any one of the plants of (a)-(c).

    7. The method of claim 1, wherein the sulfonylurea herbicide comprises one or more of cyclosulfamuron, chlorsulfuron, metsulfuron, metsulfuron methyl, chlorimuron, chlorimuron ethyl, thifensulfuron, thifensulfuron methyl, tribenuron, tribenuron methyl, bensulfuron, bensulfuron methyl, nicosulfuron, ethametsulfuron, ethametsulfuron methyl, rimsulfuron, triflusulfuron, triflusulfuron methyl, triasulfuron, primisulfuron, primisulfuron methyl, cinosulfuron, amidosulfuron, flazasulfuron, imazosulfuron, pyrazosulfuron, pyrazosulfuron ethyl, halosulfuron, azimsulfuron, cyclosulfuron, ethoxysulfuron, flupyrsulfuron, flupyrsulfuron methyl, flupyrsulfuron-methyl-sodium, foramsulfuron, iodosulfuron, sulfometuron, sulfometuron methyl, sulfometuron 3-oxetanyl ester or oxasulfuron, mesosulfuron, mesosulfuron-methyl, prosulfuron, sulfosulfuron, trifloxysulfuron, tritosulfuron, or a derivative thereof.

    8. The method of claim 7, wherein the sulfonylurea herbicide is a mesosulfuron.

    9. The method of any one of claims 1-8, further comprising applying one or more of an imidazolinone herbicide, a sulfonylurea herbicide, a triazolopyrimidine herbicide, a pyrimidinyloxybenzoate herbicide, and a sulfonylaminocarbonyltriazolinone herbicide.

    10. The method of claim 9, wherein the imidazolinone herbicide comprises one or more of imazethapyr, imazapic, imazamox, imazaquin, imazethabenz, and imazapyr.

    11. The method of claim 9, wherein the imidazolinone herbicide comprises one or more of 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-nicotinic acid, 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-3-quinolinecarboxylic acid, 5-ethyl-2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-nicotinic acid, 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-5-(methoxymethyl)-nicotinic acid, 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-5-methylnicotinic acid, mixtures of methyl 6-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-m-toluate, and methyl 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-p-toluate.

    12. The method of claim 9, wherein the triazolopyrimidine herbicide comprises one or more of cloransulam, diclosulam, florasulam, flumetsulam, metosulam, and penoxsulam.

    13. The method of claim 9, wherein the pyrimidinyloxybenzoate herbicide comprises one or more of bispyribac, pyrithiobac, pyriminobac, pyribenzoxim and pyriftalid.

    14. The method of claim 9, wherein the sulfonylamino-carbonyltriazolinone herbicide comprises one or more of flucarbazone and propoxycarbazone.

    15. A method for treating rice, comprising: providing a rice crop plant and at least one sulfonyl carboxamide herbicide; applying an effective amount of the at least one sulfonyl carboxamide herbicide to the rice crop plant, post-emergence; thereby creating a treated rice plant; and growing the resulting treated rice plant.

    16. The method of claim 15, further comprising harvesting seed from the treated rice plant.

    17. The method of claim 15 or 16, wherein the rice crop plant comprises an acetohydroxyacid synthase large subunit (AHASL) polynucleotide encoding a herbicide-tolerant AHASL polypeptide comprising a leucine substitution at a position corresponding to position 171 of SEQ ID NO:26.

    18. The method of any one of claims 15-17, wherein the rice crop plant comprises an AHASL polypeptide comprising a leucine substitution at the position corresponding to position 171 of SEQ ID NO:26.

    19. The method of any one of claims 15-18, wherein the rice crop plant comprises the herbicide tolerance characteristics of a plant of line IMINTA 15.

    20. The method of any one of claims 15-19, wherein the rice crop plant: (a) is a plant of line IMINTA 15; (b) is a progeny of a plant of line IMINTA 15; (c) is a mutant or recombinant plant of line IMINTA 15; or (d) is a progeny of any one of the plants of (a)-(c).

    21. The method of claim 15, wherein the at least one sulfonyl carboxamide herbicide comprises 2-acetamido-2,3-dimethyl-N-(p-tolylsulfonyl)-butyramide.

    Description

    BRIEF DESCRIPTION OF THE DRAWING(S)

    [0037] FIG. 1 is a nucleotide sequence alignment of the herbicide-resistant rice AHASL1 gene of the present invention (SEQ ID NO. 1) with some known plant AHASL nucleotide sequences. The C-to-T transition (relative to wild-type) at nucleotide 542 in SEQ ID NO. 1 is indicated by white type within a black box. The start and stop codons are represented in bold-face type. The names of the other AHASL sequences in the figure are defined as follows: OsAHASL1.1 is a wild-type AHASL1 nucleotide sequence from El Paso rice background; OsAHASL1.2 is a wild-type AHASL1 nucleotide sequence from IRGA rice background; OsAHASL1.4 is a rice AHASL1 nucleotide sequence (Accession No. AB049822); OsAHASL1.6 is a rice AHASL1 nucleotide sequence (Accession No. AB049823); ZmAHASL1 is a corn AHASL1 nucleotide sequence (Accession No. X63554); ZmAHASL2 is a corn AHASL2 nucleotide sequence (Accession No. X63553); OsAHASL2 is a rice AHASL2 nucleotide sequence (Accession No. AL731599); AtAHASL is an Arabidopsis thaliana AHASL nucleotide sequence (Accession No. AY124092).

    [0038] FIG. 2 is an amino acid sequence alignment of the herbicide-resistant rice AHASL1 protein of the present invention (SEQ ID NO. 2) with some known plant AHASL nucleotide sequences. The Ala-to-Val substitution (relative to wild-type) at position 179 in SEQ ID NO. 2 is indicated by white type within a black box. The initial methionine (M) is represented in bold-face type. The other names used in the figure refer to the amino acid sequences encoded by the nucleotide sequences indicated in the description of FIG. 1 above.

    [0039] FIG. 3 is an amino acid sequence alignment of the herbicide-resistant rice AHASL1 proteins with a P197L substitution (SEQ ID NOs: 26 and 27) with corresponding wild-type rice AHASL1 proteins (SEQ ID NOs: 24 and 25, respectively). The proline to leucine substitution (relative to wild-type) at position 171 of SEQ ID NOs: 26 and 27 is indicated by a black box.

    [0040] FIG. 4 shows imidazolinone tolerance of IMINTA 15 (AHAS-P197L rice) and wild-type rice 21 days after treatment.

    [0041] FIG. 5 shows a comparison of phytotoxicity between rice lines IMINTA 15 and IRGA417 three weeks after whole plant spray with Imazethapyr.

    SEQUENCE LISTING

    [0042] The nucleotide and amino acid sequences listed in the accompanying sequence listing are shown using standard letter abbreviations for nucleotide bases, and three-letter code for amino acids. The nucleotide sequences follow the standard convention of beginning at the 5 end of the sequence and proceeding forward (i.e., from left to right in each line) to the 3 end. Only one strand of each nucleic acid sequence is shown, but the complementary strand is understood to be included by any reference to the displayed strand. The amino acid sequences follow the standard convention of beginning at the amino terminus of the sequence and proceeding forward (i.e., from left to right in each line) to the carboxyl terminus.

    [0043] SEQ ID NO: 1 sets forth the nucleotide sequence encoding an imidazolinone-resistant AHASL1 protein from rice with the Alain-to-Val substitution. The coding region of SEQ ID NO. 1 corresponds to nucleotides 7 to 1938.

    [0044] SEQ ID NO: 2 sets forth the amino acid sequence of an imidazolinone-resistant AHASL1 protein from rice with the Ala179-to-Val substitution that is encoded by the nucleotide sequence set forth in SEQ ID NO. 1.

    [0045] SEQ ID NO: 3 sets forth the nucleotide sequence of the coding region of SEQ ID NO. 1.

    [0046] SEQ ID NOs: 4-18 set forth the nucleotide sequences of primers used for the PCR amplification and DNA sequencing of the AHASL1 gene of the invention as described in Example 2 below (see, Table 2).

    [0047] SEQ ID NO: 24 sets forth the amino acid sequence for N. American Japonica AHASL Subtype (wild-type for cv. Don Juan). The putative chloroplast transit peptide sequence is underlined.

    TABLE-US-00001 (SEQIDNO:24) MATTAAAAAATLSAAATAKTGRKNHQRHHVLPARGRVGAAAVRCSAVSPV TPPSPAPPATPLRPWGPAEPRKGADILVEALERCGVSDVFAYPGGASMEI HQALTRSPVITNHLFRHEQGEAFAASGYARASGRVGVCVATSGPGATNLV SALADALLDSVPMVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVL DVEDIPRVIQEAFFLASSGRPGPVLVDIPKDIQQQMAVPVWDTSMNLPGY IARLPKPPATELLEQVLRLVGESRRPILYVGGGCSASGDELRRFVELTGI PVTTTLMGLGNFPSDDPLSLRMLGMHGTVYANYAVDKADLLLAFGVRFDD RVTGKIEAFASRAKIVHIDIDPAEIGKNKQPHVSICADVKLALQGLNALL DQSTTKTSSDFSAWHNELDQQKREFPLGYKTFGEEIPPQYAIQVLDELTK GEAIIATGVGQHQMWAAQYYTYKRPRQWLSSAGLGAMGFGLPAAAGASVA NPGVTVVDIDGDGSFLMNIQELALIRIENLPVKVMVLNNQHLGMVVQWED RFYKANRAHTYLGNPECESEIYPDFVTIAKGFNIPAVRVTKKSEVRAAIK KMLETPGPYLLDIIVPHQEHVLPMIPSGGAFKDMILDGDGRTMY

    [0048] SEQ ID NO: 25 sets forth the amino acid sequence for S. American Indica AHASL Subtype (wild-type for cv. El Paso 144). The putative chloroplast transit peptide sequence is underlined.

    TABLE-US-00002 (SEQIDNO:25) MATTAAAAAATLSAAATAKTGRKNHQRHHVFPARGRVGAAAVRCSAVSPV TPPSPAPPATPLRPWGPAEPRKGADILVEALERCGVSDVFAYPGGASMEI HQALTRSPVITNHLFRHEQGEAFAASGYARASGRVGVCVATSGPGATNLV SALADALLDSVPMVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVL DVEDIPRVIQEAFFLASSGRPGPVLVDIPKDIQQQMAVPVWDTSMNLPGY IARLPKPPATELLEQVLRLVGESRRPILYVGGGCSASGDELRRFVELTGI PVTTTLMGLGNFPSDDPLSLRMLGMHGTVYANYAVDKADLLLAFGVRFDD RVTGKIEAFASRAKIVHIDIDPAEIGKNKQPHVSICADVKLALQGLNALL DQSTTKTSSDFSAWHNELDQQKREFPLGYKTFGEEIPPQYAIQVLDELTK GEAIIATGVGQHQMWAAQYYTYKRPRQWLSSAGLGAMGFGLPAAAGASVA NPGVTVVDIDGDGSFLMNIQELALIRIENLPVKVMVLNNQHLGMVVQWED RFYKANRAHTYLGNPECESEIYPDFVTIAKGFNIPAVRVTKKSEVRAAIK KMLDTPGPYLLDIIVPHQEHVLPMIPSGGAFKDMILDGDGRTVY

    [0049] SEQ ID NO: 26 sets forth the amino acid sequence of an imidazolinone-resistant AHASL1 protein from rice with the P197L for N. American Japonica AHASL Subtype (line IMINTA 15). The putative chloroplast transit peptide sequence is underlined.

    TABLE-US-00003 (SEQIDNO:26) MATTAAAAAATLSAAATAKTGRKNHQRHHVLPARGRVGAAAVRCSAVSPV TPPSPAPPATPLRPWGPAEPRKGADILVEALERCGVSDVFAYPGGASMEI HQALTRSPVITNHLFRHEQGEAFAASGYARASGRVGVCVATSGPGATNLV SALADALLDSVPMVAITGQVLRRMIGTDAFQETPIVEVTRSITKHNYLVL DVEDIPRVIQEAFFLASSGRPGPVLVDIPKDIQQQMAVPVWDTSMNLPGY IARLPKPPATELLEQVLRLVGESRRPILYVGGGCSASGDELRRFVELTGI PVTTTLMGLGNFPSDDPLSLRMLGMHGTVYANYAVDKADLLLAFGVRFDD RVTGKIEAFASRAKIVHIDIDPAEIGKNKQPHVSICADVKLALQGLNALL DQSTTKTSSDFSAWHNELDQQKREFPLGYKTFGEEIPPQYAIQVLDELTK GEAIIATGVGQHQMWAAQYYTYKRPRQWLSSAGLGAMGFGLPAAAGASVA NPGVTVVDIDGDGSFLMNIQELALIRIENLPVKVMVLNNQHLGMVVQWED RFYKANRAHTYLGNPECESEIYPDFVTIAKGFNIPAVRVTKKSEVRAAIK KMLETPGPYLLDIIVPHQEHVLPMIPSGGAFKDMILDGDGRTMY

    [0050] SEQ ID NO: 27 sets forth the amino acid sequence of an imidazolinone-resistant AHASL1 protein from rice with the P197L for S. American Indica AHASL Subtype (line El Paso 2). The putative chloroplast transit peptide sequence is underlined.

    TABLE-US-00004 (SEQIDNO:27) MATTAAAAAATLSAAATAKTGRKNHQRHHVFPARGRVGAAAVRCSAVSPV TPPSPAPPATPLRPWGPAEPRKGADILVEALERCGVSDVFAYPGGASMEI HQALTRSPVITNHLFRHEQGEAFAASGYARASGRVGVCVATSGPGATNLV SALADALLDSVPMVAITGQVLRRMIGTDAFQETPIVEVTRSITKHNYLVL DVEDIPRVIQEAFFLASSGRPGPVLVDIPKDIQQQMAVPVWDTSMNLPGY IARLPKPPATELLEQVLRLVGESRRPILYVGGGCSASGDELRRFVELTGI PVTTTLMGLGNFPSDDPLSLRMLGMHGTVYANYAVDKADLLLAFGVRFDD RVTGKIEAFASRAKIVHIDIDPAEIGKNKQPHVSICADVKLALQGLNALL DQSTTKTSSDFSAWHNELDQQKREFPLGYKTFGEEIPPQYAIQVLDELTK GEAIIATGVGQHQMWAAQYYTYKRPRQWLSSAGLGAMGFGLPAAAGASVA NPGVTVVDIDGDGSFLMNIQELALIRIENLPVKVMVLNNQHLGMVVQWED RFYKANRAHTYLGNPECESEIYPDFVTIAKGFNIPAVRVTKKSEVRAAIK KMLDTPGPYLLDIIVPHQEHVLPMIPSGGAFKDMILDGDGRTVY

    [0051] SEQ ID NO: 28 sets forth the amino acid sequence for consensus sequence for wild-type Rice AHASL. The putative chloroplast transit peptide sequence is underlined.

    TABLE-US-00005 (SEQIDNO:28) MATTAAAAAATLSAAATAKTGRKNHQRHHVXPARGRVGAAAVRCSAVSPV TPPSPAPPATPLRPWGPAEPRKGADILVEALERCGVSDVFAYPGGASMEI HQALTRSPVITNHLFRHEQGEAFAASGYARASGRVGVCVATSGPGATNLV SALADALLDSVPMVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVL DVEDIPRVIQEAFFLASSGRPGPVLVDIPKDIQQQMAVPVWDTSMNLPGY IARLPKPPATELLEQVLRLVGESRRPILYVGGGCSASGDELRRFVELTGI PVTTTLMGLGNFPSDDPLSLRMLGMHGTVYANYAVDKADLLLAFGVRFDD RVTGKIEAFASRAKIVHIDIDPAEIGKNKQPHVSICADVKLALQGLNALL XQSTTKTSSDFSAWHNELDQQKREFPLGYKTFGEEIPPQYAIQVLDELTK GEAIIATGVGQHQMWAAQYYTYKRPRQWLSSAGLGAMGFGLPAAAGASVA NPGVTVVDIDGDGSFLMNIQELALIRIENLPVKVMVLNNQHLGMVVQWED RFYKANRAHTYLGNPECESEIYPDFVTIAKGFNIPAVRVTKKSEVRAAIK KMLXTPGPYLLDIIVPHQEHVLPMIPSGGAFKDMILDGDGRTXY

    [0052] SEQ ID NO: 29 sets forth the amino acid sequence for consensus sequence for Rice AHASL with the P197L substitution. The putative chloroplast transit peptide sequence is underlined.

    TABLE-US-00006 (SEQIDNO:29) MATTAAAAAATLSAAATAKTGRKNHQRHHVXPARGRVGAAAVRCSAVSPV TPPSPAPPATPLRPWGPAEPRKGADILVEALERCGVSDVFAYPGGASMEI HQALTRSPVITNHLFRHEQGEAFAASGYARASGRVGVCVATSGPGATNLV SALADALLDSVPMVAITGQVLRRMIGTDAFQETPIVEVTRSITKHNYLVL DVEDIPRVIQEAFFLASSGRPGPVLVDIPKDIQQQMAVPVWDTSMNLPGY IARLPKPPATELLEQVLRLVGESRRPILYVGGGCSASGDELRRFVELTGI PVTTTLMGLGNFPSDDPLSLRMLGMHGTVYANYAVDKADLLLAFGVRFDD RVTGKIEAFASRAKIVHIDIDPAEIGKNKQPHVSICADVKLALQGLNALL XQSTTKTSSDFSAWHNELDQQKREFPLGYKTFGEEIPPQYAIQVLDELTK GEAIIATGVGQHQMWAAQYYTYKRPRQWLSSAGLGAMGFGLPAAAGASVA NPGVTVVDIDGDGSFLMNIQELALIRIENLPVKVMVLNNQHLGMVVQWED RFYKANRAHTYLGNPECESEIYPDFVTIAKGFNIPAVRVTKKSEVRAAIK KMLXTPGPYLLDIIVPHQEHVLPMIPSGGAFKDMILDGDGRTXY

    [0053] Explanations for X positions in the consensus sequences (SEQ ID NO: 28 and 29):

    TABLE-US-00007 31 F or L (Phe or Leu) 401 D or Q (Asp or Gln) 604 D or E (Asp or Glu) 643 V or M (Val or Met)

    [0054] SEQ ID NO: 30 sets forth the amino acid sequence of Oryza sativa AHASL. The putative chloroplast transit peptide sequence is underlined.

    TABLE-US-00008 (SEQIDNO:30) MATTAAAAAATLSAAATAKTGRKNHQRHHVXPARGRVGAAAVRCSAVSPV TPPSPAPPATPLRPWGPAEPRKGADILVEALERCGVSDVFAYPGGASMEI HQALTRSPVITNHLFRHEQGEAFAASGYARASGRVGVCVATSGPGATNLV SALADALLDSVPMVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYLVL DVEDIPRVIQEAFFLASSGRPGPVLVDIPKDIQQQMAVPVWDTSMNLPGY IARLPKPPATELLEQVLRLVGESRRPILYVGGGCSASGDELRRFVELTGI PVTTTLMGLGNFPSDDPLSLRMLGMHGTVYANYAVDKADLLLAFGVRFDD RVTGKIEAFASRAKIVHIDIDPAEIGKNKQPHVSICADVKLALQGLNALL XQSTTKTSSDFSAWHNELDQQKREFPLGYKTFGEEIPPQYAIQVLDELTK GEATIATGVGQHQMWAAQYYTYKRPRQWLSSAGLGAMGFGLPAAAGASVA NPGVTVVDIDGDGSFLMNIQELALIRIENLPVKVMVLNNQHLGMVVQWED RFYKANRAHTYLGNPECESETYPDFVTIAKGFNIPAVRVTKKSEVRAAIK KMLXTPGPYLLDIIVPHQEHVLPMIPSGGAFKDMILDGDGRTXY

    [0055] Explanations for X positions in the Oryza sativa AHASL sequence:

    TABLE-US-00009 31 X = F or L Xaa = Phe or Leu 401 X = D or Q Xaa = Asp or Gln 604 X = D or E Xaa = Asp or Glu 643 X = V or M Xaa = Val or Met

    [0056] The mature versions of AHASL sequences for SEQ ID NOs: 24-30 do not contain the chloroplast transit peptide sequence and comprise amino acids 45 to 644 of SEQ ID NOs: 24-30, respectively.

    DETAILED DESCRIPTION OF THE INVENTION

    [0057] The present invention relates to rice plants having increased resistance to herbicides when compared to a wild-type rice plant. The herbicide resistant rice plants of the invention were produced as described herein below by exposing wild-type (with respect to herbicide resistance) rice seeds to a mutagen, sowing the seeds, allowing the plants to mature and reproduce, and selecting progeny plants that displayed enhanced resistance to imidazolinone herbicides, relative to the resistance of a wild-type rice plant. The invention provides the herbicide resistant rice line and plants thereof that are referred to herein IMINTA 16. Such herbicide resistant rice plants find use in methods for controlling weeds, particularly red rice and other weeds that are sensitive to imidazolinone and sulfonylurea herbicides.

    [0058] From the IMINTA 16 herbicide-resistant rice plants, the coding region of an acetohydroxyacid synthase large subunit 1 (AHASL1) gene was isolated by polymerase chain reaction (PCR) amplification and sequenced. By comparing the polynucleotide sequences of the herbicide resistant rice plants of the invention to a rice AHASL1 cDNA from a wild-type rice plant (GenBank Accession No. AB049822), it was discovered that the coding region of the AHASL1 polynucleotide sequence from IMINTA 16 differed from the wild-type rice AHASL1 cDNA sequence by a single nucleotide. For the AHASL1 polynucleotide sequence of IMINTA 16, there was a C-to-T transition at nucleotide 542 (SEQ ID NO. 1, FIG. 1). This C-to-T transition in the AHASL1 polynucleotide sequence results in a Ala-to-Val substitution at amino acid 179 in a conserved region of the predicted amino acid sequence of the AHASL1 protein, relative to the amino acid sequence of the wild-type AHASL1 protein (FIG. 2).

    [0059] The invention further relates to isolated polynucleotide molecules comprising nucleotide sequences that encode the herbicide-resistant AHASL1 proteins of IMINTA 16 rice plants and to such AHASL1 proteins. The invention discloses the isolation and nucleotide sequence of a polynucleotide encoding an herbicide-resistant rice AHASL1 protein from herbicide-resistant rice plant that was produced by chemical mutagenesis of wild-type rice plants. The herbicide-resistant AHASL1 proteins of the invention comprise an alanine-to-valine substitution at position 179 in their respective amino acid sequences, when compared to the corresponding wild-type AHASL1 amino acid sequence.

    [0060] The invention further provides the herbicide resistant rice line and plants thereof that are referred to herein IMINTA 15. Such herbicide resistant rice plants find use in methods for controlling weeds, particularly red rice and other weeds that are sensitive to imidazolinone and sulfonylurea herbicides. The acetohydroxyacid synthase large subunit 1 (AHASL1) protein of the herbicide resistant rice plants IMINTA 15 of the invention (SEQ ID NO:26) differs from a wild-type rice plant (N. American Japonica AHASL Subtype (wild-type for cv. Don Juan), SEQ ID NO:24) in that the AHASL1 protein of IMINTA 15 has a leucine at amino acid 171 in SEQ ID NO:26. In contrast, the corresponding wild-type AHASL1 protein has a proline at the same position.

    [0061] The present invention also provides progeny or derivative plants of the IMINTA 15 rice line. Such progeny or derivative plants can include mutant, recombinant, or genetically engineered derivatives of a plant of the IMINTA 15 rice line; or of any progeny of a plant of the IMINTA 15 rice line; or a plant that is a progeny of any of these plants; or a plant that comprises the herbicide resistance characteristics of IMINTA 15. The present invention also provides plants comprising the germplasm of a plant of the IMINTA 15 rice line.

    [0062] The invention further provides the herbicide resistant rice line and plants thereof that are referred to herein El Paso 2. Such herbicide resistant rice plants find use in methods for controlling weeds, particularly red rice and other weeds that are sensitive to imidazolinone and sulfonylurea herbicides. The acetohydroxyacid synthase large subunit 1 (AHASL1) protein of the herbicide resistant rice plants El Paso 2 of the invention (SEQ ID NO:27) differs from a wild-type rice plant (S. American Indica AHASL Subtype (wild-type for cv. El Paso 144), SEQ ID NO:25) in that the AHASL1 protein of IMINTA 15 has a leucine at amino acid 171 in SEQ ID NO:27. In contrast, the corresponding wild-type AHASL1 protein has a proline at the same position.

    [0063] The present invention also provides progeny or derivative plants of the El Paso 2 rice line. Such progeny or derivative plants can include mutant, recombinant, or a genetically engineered derivatives of a plant of the El Paso 2 rice line; or of any progeny of a plant of the El Paso 2 rice line; or a plant that is a progeny of any of these plants; or a plant that comprises the herbicide resistance characteristics of El Paso 2. The present invention also provides plants comprising the germplasm of a plant of the El Paso 2 rice line.

    [0064] In some embodiments, the rice plants disclosed herein comprise and express an endogenous non-transfected mutant AHASL1 nucleic acid whose sequence encodes an AHASL1 polypeptide containing a mutation that causes the AHASL1 to be tolerant to the AHAS-inhibiting herbicide, the nucleic acid thereby providing to the plant tolerance to the AHAS inhibiting herbicide. In some further embodiments, the mutation is selected from the group consisting of a valine or aspartate at amino acid position 179 of SEQ ID NO:2 or equivalent position, a leucine at amino acid position 171 of SEQ ID NO:26 or equivalent position, and a leucine at amino acid position 171 of SEQ ID NO:27 or equivalent position.

    [0065] The present invention provides also isolated polynucleotide molecules that encode herbicide resistant AHASL1 proteins from rice (Oryza sativa L.). Specifically, the invention provides isolated polynucleotide molecules comprising: the nucleotide sequences set forth in SEQ ID NOS: 1 and 3, nucleotide sequences encoding AHASL1 proteins comprising the amino acid sequence set forth in SEQ ID NO. 2, 26, or 27, and fragments and variants of such nucleotide sequences that encode functional AHASL1 proteins that comprise herbicide-resistant AHAS activity.

    [0066] The isolated herbicide-resistant AHASL1 polynucleotide molecules of the invention comprise nucleotide sequences that encode herbicide-resistant AHASL1 proteins. Such polynucleotide molecules can be used in polynucleotide constructs for the transformation of plants, particularly crop plants, to enhance the resistance of the plants to herbicides, particularly herbicides that are known to inhibit AHAS activity, more particularly imidazolinone and sulfonylurea herbicides. Such polynucleotide constructs can be used in expression cassettes, expression vectors, transformation vectors, plasmids and the like. The transgenic plants obtained following transformation with such polynucleotide constructs show increased resistance to AHAS-inhibiting herbicides such as, for example, imidazolinone and sulfonylurea herbicides.

    [0067] Compositions of the invention include polynucleotide molecules comprising nucleotide sequences that encode AHASL1 proteins. In particular, the present invention provides for isolated polynucleotide molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO. 2, 26, or 27, and fragments and variants thereof that encode polypeptides comprising AHAS activity. Further provided are polypeptides having an amino acid sequence encoded by a polynucleotide molecule described herein, for example those set forth in SEQ ID NOS: 1 and 3, and fragments and variants thereof that encode polypeptides comprising AHAS activity, particularly herbicide-resistant AHASL activity. The polynucleotides molecules of the invention further encompass nucleotide sequences that encode mature forms of the AHASL1 proteins described above. Such mature forms of AHASL1 proteins comprise AHAS activity, particularly herbicide-resistant AHAS activity, but lack the chloroplast transit peptide that is part of full-length AHASL1 proteins.

    [0068] The invention encompasses isolated or substantially purified nucleic acid or protein compositions. An isolated or purified polynucleotide molecule or protein, or biologically active portion thereof, is substantially or essentially free from components that normally accompany or interact with the polynucleotide molecule or protein as found in its naturally occurring environment. Thus, an isolated or purified polynucleotide molecule or protein is substantially free of other cellular material, or culture medium when produced by recombinant techniques, or substantially free of chemical precursors or other chemicals when chemically synthesized. Preferably, an isolated nucleic acid is free of sequences (preferably protein encoding sequences) that naturally flank the nucleic acid (i.e., sequences located at the 5 and 3 ends of the nucleic acid) in the genomic DNA of the organism from which the nucleic acid is derived. For example, in various embodiments, the isolated polynucleotide molecule can contain less than about 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb, or 0.1 kb of nucleotide sequences that naturally flank the polynucleotide molecule in genomic DNA of the cell from which the nucleic acid is derived. A protein that is substantially free of cellular material includes preparations of protein having less than about 30%, 20%, 10%, 5%, or 1% (by dry weight) of contaminating protein. When the protein of the invention or biologically active portion thereof is recombinantly produced, preferably culture medium represents less than about 30%, 20%, 10%, 5%, or 1% (by dry weight) of chemical precursors or non-protein-of-interest chemicals.

    [0069] The present invention provides isolated polypeptides comprising AHASL1 proteins. The isolated polypeptides comprise an amino acid sequence selected from the group consisting of the amino acid sequence set forth in SEQ ID NO. 2, 26, or 27, the amino acid sequences encoded by nucleotide sequences set forth in SEQ ID NOS: 1 and 3, and functional fragments and variants of said amino acid sequences that encode an AHASL1 polypeptide comprising AHAS activity. By functional fragments and variants is intended fragments and variants of the exemplified polypeptides that comprise AHAS activity.

    [0070] Additionally provided are isolated polypeptides comprising the mature forms of the AHASL1 proteins of the invention. Such mature forms of AHASL1 proteins comprise AHAS activity, particularly herbicide-resistant AHAS activity, but lack the chloroplast transit peptide that is part of full-length AHASL1 proteins.

    [0071] In certain embodiments of the invention, the methods involve the use of herbicide-tolerant or herbicide-resistant plants. By an herbicide-tolerant or herbicide-resistant plant, it is intended that a plant that is tolerant or resistant to at least one herbicide at a level that would normally kill, or inhibit the growth of, a normal or wild-type plant. In one embodiment of the invention, the herbicide-tolerant plants of the invention comprise an herbicide-tolerant or herbicide-resistant AHASL1 protein. By herbicide-tolerant AHASL1 protein or herbicide-resistant AHASL1 protein, it is intended that such an AHASL1 protein displays higher AHAS activity, relative to the AHAS activity of a wild-type AHASL1 protein, when in the presence of at least one herbicide that is known to interfere with AHAS activity and at a concentration or level of the herbicide that is to known to inhibit the AHAS activity of the wild-type AHASL1 protein. Furthermore, the AHAS activity of such an herbicide-tolerant or herbicide-resistant AHASL1 protein may be referred to herein as herbicide-tolerant or herbicide-resistant AHAS activity.

    [0072] For the present invention, the terms herbicide-tolerant and herbicide-resistant are used interchangeable and are intended to have an equivalent meaning and an equivalent scope. Similarly, the terms herbicide-tolerance and herbicide-resistance are used interchangeable and are intended to have an equivalent meaning and an equivalent scope. Likewise, the terms imidazolinone-resistant and imidazolinone-resistance are used interchangeable and are intended to be of an equivalent meaning and an equivalent scope as the terms imidazolinone-tolerant and imidazolinone-tolerance, respectively.

    [0073] The invention encompasses herbicide-resistant AHASL1 polynucleotides and herbicide-resistant AHASL1 proteins. By herbicide-resistant AHASL1 polynucleotide is intended a polynucleotide that encodes a protein comprising herbicide-resistant AHAS activity. By herbicide-resistant AHASL1 protein is intended a protein or polypeptide that comprises herbicide-resistant AHAS activity.

    [0074] Further, it is recognized that an herbicide-tolerant or herbicide-resistant AHASL1 protein can be introduced into a plant by transforming a plant or ancestor thereof with a nucleotide sequence encoding an herbicide-tolerant or herbicide-resistant AHASL1 protein. Such herbicide-tolerant or herbicide-resistant AHASL1 proteins are encoded by the herbicide-tolerant or herbicide-resistant AHASL1 polynucleotides. Alternatively, an herbicide-tolerant or herbicide-resistant AHASL1 protein may occur in a plant as a result of a naturally occurring or induced mutation in an endogenous AHASL1 gene in the genome of a plant or progenitor thereof.

    [0075] The present invention provides plants, plant tissues, plant cells, and host cells with increased resistance or tolerance to at least one herbicide, particularly an imidazolinone or sulfonylurea herbicide. The preferred amount or concentration of the herbicide is an effective amount or effective concentration. By effective amount and effective concentration is intended an amount and concentration, respectively, that is sufficient to kill or inhibit the growth of a similar, wild-type, plant, plant tissue, plant cell, or host cell, but that said amount does not kill or inhibit as severely the growth of the herbicide-resistant plants, plant tissues, plant cells, and host cells of the present invention. Typically, the effective amount of an herbicide is an amount that is routinely used in agricultural production systems to kill weeds of interest. Such an amount is known to those of ordinary skill in the art.

    [0076] By similar, wild-type, plant, plant tissue, plant cell or host cell is intended a plant, plant tissue, plant cell, or host cell, respectively, that lacks the herbicide-resistance characteristics and/or particular polynucleotide of the invention that are disclosed herein. The use of the term wild-type is not, therefore, intended to imply that a plant, plant tissue, plant cell, or other host cell lacks recombinant DNA in its genome, and/or does not possess herbicide resistant characteristics that are different from those disclosed herein.

    [0077] As used herein unless clearly indicated otherwise, the term plant intended to mean a plant any developmental stage, as well as any part or parts of a plant that may be attached to or separate from a whole intact plant. Such parts of a plant include, but are not limited to, organs, tissues, and cells of a plant. Examples of particular plant parts include a stem, a leaf, a root, an inflorescence, a flower, a floret, a fruit, a pedicle, a peduncle, a stamen, an anther, a stigma, a style, an ovary, a petal, a sepal, a carpel, a root tip, a root cap, a root hair, a leaf hair, a seed hair, a pollen grain, a microspore, a cotyledon, a hypocotyl, an epicotyl, xylem, phloem, parenchyma, endosperm, a companion cell, a guard cell, and any other known organs, tissues, and cells of a plant. Furthermore, it is recognized that a seed is a plant.

    [0078] The plants of the present invention include both non-transgenic plants and transgenic plants. By non-transgenic plant is intended mean a plant lacking recombinant DNA in its genome. By transgenic plant is intended to mean a plant comprising recombinant DNA in its genome. Such a transgenic plant can be produced by introducing recombinant DNA into the genome of the plant. When such recombinant DNA is incorporated into the genome of the transgenic plant, progeny of the plant can also comprise the recombinant DNA. A progeny plant that comprises at least a portion of the recombinant DNA of at least one progenitor transgenic plant is also a transgenic plant.

    [0079] As used herein in regard to mutant or mutagenized nucleic acids that encode herbicide-tolerant AHASL1 proteins, the term endogenous non-transfected is defined to mean: [0080] (1) that the nucleic acid is endogenous to the respective cell, seed, plant, or plant part and [0081] (2) that its nucleotide sequence is non-transfected in that [0082] (a) it contains herbicide-tolerance mutation(s) produced randomly by a technique involving no step of introducing exogenous nucleic acid(s) or nucleic acid analog(s), into a plant cell or into other plant material, and [0083] (b) it contains no mutation(s) produced by a technique involving a step of introducing exogenous nucleic acid(s) or nucleic acid analog(s), into a plant cell or into other plant material.

    [0084] Thus, techniques useful to produce such non-transfected nucleic acid sequences, as defined herein, include, e.g., traditional chemical mutagenesis using a chemical (i.e. non-nucleic-acid-or-analog-containing) mutagen, tissue culture mutagenesis involving somaclonal variation, radiation exposure, and other techniques for inducing mutations in endogenous plant gene(s) in a random or non-directed manner.

    [0085] Accordingly, as defined herein, endogenous non-transfected nucleic acids exclude both those mutant or mutagenized nucleic acids whose mutation-containing sequences have resulted without an applied technique and those that were produced by use of a technique involving introduction into a plant cell or into other plant material of an exogenous nucleic acid or nucleic acid analog, whether per se or as part of a heteromolecular construct or complex. Examples of techniques excluded under this definition include: genetic engineering, oligonucleotide-directed mutagenesis, DNA mismatch-repair oligonucleotide-based mutagenesis, and other mutation-producing processes in which exogenous nucleic acid (or nucleic acid analog) has been transiently or stably introduced into a plant cell or other plant material.

    [0086] As used in this definition of endogenous non-transfected, the term non-transfected is analogous to the term non-infected used to describe a physician's patient who, not having been infected with or exposed to a pathogen, is not a carrier of it. Thus, by analogy, a non-transfected nucleic acid is one that is not a carrier of any transfection product, i.e. of any mutation caused by a technique involving transient or stable introduction of exogenous nucleic acid or its analog.

    [0087] The present invention provides the herbicide-resistant rice line and plants thereof known as IMINTA 16. A deposit of at least 250 seeds of IMINTA 16 was made to the patent depository of NCIMB Ltd., Ferguson Building, Craibstone Estate Bucksburn, Aberdeen, AB21 9YA, Scotland, UK on Jan. 5, 2005 and assigned NCIMB Accession Number NCIMB 41262. Due to a shortage of seeds of the IMINTA 16 line at the time of filing, less than 2500 seeds of the IMINTA 16 line were submitted to NCIMB Ltd. prior to filing. Applicants will supply additional seeds of the IMINTA 16 line to reach a total of at least 2500 seeds as the seeds become available. These deposits will be maintained under the terms of the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the Purposes of Patent Procedure. The deposit of the seeds of IMINTA 16 was made for a term of at least 30 years and at least 5 years after the most recent request for the furnishing of a sample of that deposit is received by NCIMB Ltd. Additionally, Applicants have satisfied all the requirements of 37 C.F.R. 1.801-1.809, including providing an indication of the viability of the sample.

    [0088] The present invention provides herbicide-resistant rice plants of the IMINTA 16 line that were produced by a mutation breeding. Wild-type rice plants were mutagenized by exposing the plants to a mutagen, particularly a chemical mutagen, more particularly sodium azide. However, the present invention is not limited to herbicide-resistant rice plants that are produced by a mutagensis method involving the chemical mutagen sodium azide. Any mutagensis method known in the art may be used to produce the herbicide-resistant rice plants of the present invention. Such mutagensis methods can involve, for example, the use of any one or more of the following mutagens: radiation, such as X-rays, Gamma rays (e.g., cobalt 60 or cesium 137), neutrons, (e.g., product of nuclear fission by uranium 235 in an atomic reactor), Beta radiation (e.g., emitted from radioisotopes such as phosphorus 32 or carbon 14), and ultraviolet radiation (preferably from 2500 to 2900 nm), and chemical mutagens such as base analogues (e.g., 5-broino-uracil), related compounds (e.g., 8-ethoxy caffeine), antibiotics (e.g., streptonigrin), alkylating agents (e.g., sulfur mustards, nitrogen mustards, epoxides, ethylenamines, sulfates, sulfonates, sulfones, lactones), azide, hydroxylamine, nitrous acid, ethyl methanesulfonate (EMS), or acridines. Herbicide-resistant plants can also be produced by using tissue culture methods to select for plant cells comprising herbicide-resistance mutations and then regenerating herbicide-resistant plants therefrom. See, for example, U.S. Pat. Nos. 5,773,702 and 5,859,348, both of which are herein incorporated in their entirety by reference. Further details of mutation breeding can be found in Principals of Cultivar Development Fehr, 1993 Macmillan Publishing Company the disclosure of which is incorporated herein by reference.

    [0089] Analysis of the AHASL1 gene of the rice plants of IMINTA 16 line revealed a point mutation. In the AHASL1 gene from IMINTA 16, the point mutation results in the substitution of a valine for the alanine that is found at amino acid position 179 in the wild-type AHASL1 amino acid sequence of GenBank Accession No. AB049822. Thus, the present invention discloses that substituting another amino acid for the alanine at amino acid position 179 of the rice AHASL1 protein can cause a rice plant to have enhanced resistance to an herbicide, particularly an imidazolinone and/or sulfonylurea herbicide. As disclosed in Example 3 below, alanine 179 is found in a conserved region of AHASL proteins and other amino acid substitutions for the alanine at 179 have been disclosed that are known to confer herbicide resistance on a plant that comprises such an AHASL protein. Accordingly, the herbicide-resistant rice plants of the invention include, but are not limited to those rice plants which comprise in their genomes at least one copy of an AHASL1 polynucleotide that encodes an herbicide-resistant AHASL1 protein that comprises an aspartate or valine at amino acid position 179 or equivalent position.

    [0090] The rice plants of the invention additionally include plants that comprise, relative to the wild-type AHASL1 protein, an aspartate or valine at amino acid position 179 or equivalent position and one or more additional amino acid substitutions in the AHASL1 protein relative to the wild-type AHASL1 protein, wherein such a rice plant has increased resistance to at least one herbicide when compared to a wild-type rice plant. Such additional amino acid substitutions include, but are not limited to: a threonine at amino acid position 96 or equivalent position; an alanine, threonine, histidine, leucine, arginine, isoleucine, glutamine, or serine at amino acid position 171 or equivalent position; a leucine at amino acid position 548 or equivalent position; and an asparagine, threonine, or phenylalanine at amino acid position 627 or equivalent position.

    [0091] The present invention provides AHASL1 proteins with amino acid substitutions at particular amino acid positions within conserved regions of the rice AHASL1 proteins disclosed herein. Unless otherwise indicated herein, particular amino acid positions refer to the position of that amino acid in the full-length rice AHASL1 amino acid sequences set forth in SEQ ID NO. 2. Furthermore, those of ordinary skill in the art will recognize that such amino acid positions can vary depending on whether amino acids are added or removed from, for example, the N-terminal end of an amino acid sequence. Thus, the invention encompasses the amino substitutions at the recited position or equivalent position (e.g., amino acid position 179 or equivalent position). By equivalent position is intended to mean a position that is within the same conserved region as the exemplified amino acid position. Examples of such conserved regions are provided in Table 3 below.

    [0092] In addition, the present invention provides rice AHASL1 polypeptides comprising an aspartate or valine at amino acid position 179 or equivalent position and one or more additional amino acid substitutions in the AHASL1 protein, relative to the wild-type AHASL1 protein, wherein AHASL1 polypeptide comprises herbicide tolerant AHAS activity, when compared to the AHAS activity of a wild-type AHASL1. These amino acid substitutions include, but are not limited, to those that are known to confer resistance on a plant to at least one herbicide, particularly an imidazolinone herbicide and/or a sulfonylurea herbicide. Such additional amino acid substitutions include, but are not limited to: a threonine at amino acid position 96 or equivalent position; an alanine, threonine, histidine, leucine, arginine, isoleucine, glutamine, or serine at amino acid position 171 or equivalent position; a leucine at amino acid position 548 or equivalent position; and an asparagine, threonine, or phenylalanine at amino acid position 627 or equivalent position. The invention further provides isolated polynucleotides encoding such AHASL1 polypeptides, as well as expression cassettes, transformation vectors, transformed host cells, transformed plants, and methods comprising such polynucleotides.

    [0093] The present invention further relates to rice plants having increased resistance to sulfonylurea herbicides when compared to a wild-type rice plant. The herbicide resistant rice plants of the invention were produced as described herein below by exposing wild-type (with respect to herbicide resistance) rice seeds to a mutagen, sowing the seeds, allowing the plants to mature and reproduce, and selecting progeny plants that displayed enhanced resistance to sulfonylurea herbicides, relative to the resistance of a wild-type rice plant. The invention provides the herbicide resistant rice line and plants thereof that are referred to herein IMINTA 15. Such herbicide resistant rice plants find use in methods for controlling weeds, particularly red rice and other weeds that are sensitive to AHAS-inhibiting herbicides (AIs), such as imidazolinone and sulfonylurea.

    [0094] From the IMINTA 15 herbicide-resistant rice plants, the coding region of an acetohydroxyacid synthase large subunit 1 (AHASL1) gene was isolated by polymerase chain reaction (PCR) amplification and sequenced. By comparing the polypeptide sequences of the herbicide resistant rice plants of the invention to a rice AHASL1 polypeptide from a wild-type rice plant, it was discovered that the polypeptide sequence of the herbicide-resistant rice plants differed from the wild-type rice AHASL1 polypeptide sequence by a single substitution. In particular, the herbicide-resistant AHASL1 proteins of the invention comprise a proline-to-leucine substitution at position 197 in their respective amino acid sequences, when compared to the corresponding wild-type AHASL1 amino acid sequence.

    [0095] The present invention therefore provides isolated polynucleotide molecules that encode herbicide resistant AHASL1 proteins from rice. Specifically, the invention provides isolated polynucleotide molecules comprising nucleotide sequences encoding AHASL1 proteins comprising the amino acid sequence set forth in SEQ ID NO: 26, and fragments and variants of such nucleotide sequences that encode functional AHASL1 proteins that comprise herbicide-resistant AHAS activity.

    [0096] The present invention further provides rice AHASL1 polypeptides comprising an proline or leucine at amino acid position 197 or equivalent position and one or more additional amino acid substitutions in the AHASL1 protein, relative to the wild-type AHASL1 protein, wherein AHASL1 polypeptide comprises herbicide tolerant AHAS activity, when compared to the AHAS activity of a wild-type AHASL1. The invention further provides isolated polynucleotides encoding such AHASL1 polypeptides, as well as expression cassettes, transformation vectors, transformed host cells, transformed plants, and methods comprising such polynucleotides.

    [0097] The present invention provides methods for enhancing the tolerance or resistance of a plant, plant tissue, plant cell, or other host cell to at least one herbicide that interferes with the activity of the AHAS enzyme. Preferably, such an AHAS-inhibiting herbicide is an imidazolinone herbicide, a sulfonylurea herbicide, a triazolopyrimidine herbicide, a pyrimidinyloxybenzoate herbicide, a sulfonylamino-carbonyltriazolinone herbicide, or mixture thereof. More preferably, such an herbicide is an imidazolinone herbicide, a sulfonylurea herbicide, or mixture thereof. For the present invention, the imidazolinone herbicides include, but are not limited to, PURSUIT (imazethapyr), CADRE (imazapic), RAPTOR (imazamox), SCEPTER (imazaquin), ASSERT (imazethabenz), ARSENAL (imazapyr), a derivative of any of the aforementioned herbicides, and a mixture of two or more of the aforementioned herbicides, for example, imazapyr/imazamox (ODYSSEY). More specifically, the imidazolinone herbicide can be selected from, but is not limited to, 2-(4-isopropyl-4-methyl-5-oxo-2-imidiazolin-2-yl)-nicotinic acid, [2-(4-isopropyl)-4-] [methyl-5-oxo-2-imidazolin-2-yl)-3-quinolinecarboxylic] acid, [5-ethyl-2-(4-isopropyl-] 4-methyl-5-oxo-2-imidazolin-2-yl)-nicotinic acid, 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-5-(methoxymethyl)-nicotinic acid, [2-(4-isopropyl-4-methyl-5-oxo-2-] imidazolin-2-yl)-5-methylnicotinic acid, and a mixture of methyl [6-(4-isopropyl-4-] methyl-5-oxo-2-imidazolin-2-yl)-m-toluate and methyl [2-(4-isopropyl-4-methyl-5-] oxo-2-imidazolin-2-yl)-p-toluate. The use of 5-ethyl-2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-nicotinic acid and [2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-] yl)-5-(methoxymethyl)-nicotinic acid is preferred. The use of [2-(4-isopropyl-4-] methyl-5-oxo-2-imidazolin-2-yl)-5-(methoxymethyl)-nicotinic acid is particularly preferred.

    [0098] For the present invention, the sulfonylurea herbicides include, but are not limited to, cyclosulfamuron, chlorsulfuron, metsulfuron, metsulfuron methyl, chlorimuron, chlorimuron ethyl, thifensulfuron, thifensulfuron methyl, tribenuron, tribenuron methyl, bensulfuron, bensulfuron methyl, nicosulfuron, ethametsulfuron, ethametsulfuron methyl, rimsulfuron, triflusulfuron, triflusulfuron methyl, triasulfuron, primisulfuron, primisulfuron methyl, cinosulfuron, amidosulfuron, imazosulfuron, pyrazosulfuron, pyrazosulfuron ethyl, halosulfuron, azimsulfuron, cyclosulfuron, ethoxysulfuron, flazasulfuron, flupyrsulfuron, flupyrsulfuron methyl, flupyrsulfuron-methyl-sodium, foramsulfuron, iodosulfuron, sulfometuron, sulfometuron methyl, sulfometuron 3-oxetanyl ester (a/k/a oxasulfuron), mesosulfuron, mesosulfuron-methyl, prosulfuron, sulfosulfuron, trifloxysulfuron, tritosulfuron, a derivative of any of the aforementioned herbicides, and a mixture of two or more of the aforementioned herbicides. The triazolopyrimidine herbicides of the invention include, but are not limited to, cloransulam, diclosulam, florasulam, flumetsulam, metosulam, and penoxsulam. The pyrimidinyloxybenzoate herbicides of the invention include, but are not limited to, bispyribac, pyrithiobac, pyriminobac, pyribenzoxim and pyriftalid. The sulfonylamino-carbonyltriazolinone herbicides include, but are not limited to, flucarbazone and propoxycarbazone.

    [0099] It is recognized that pyrimidinyloxybenzoate herbicides are closely related to the pyrimidinylthiobenzoate herbicides and are generalized under the heading of the latter name by the Weed Science Society of America. Accordingly, the herbicides of the present invention further include pyrimidinylthiobenzoate herbicides, including, but not limited to, the pyrimidinyloxybenzoate herbicides described above.

    [0100] The present invention provides methods for enhancing AHAS activity in a plant comprising transforming a plant with a polynucleotide construct comprising a promoter operably linked to an AHASL1 nucleotide sequence of the invention. The methods involve introducing a polynucleotide construct of the invention into at least one plant cell and regenerating a transformed plant therefrom. The methods involve the use of a promoter that is capable of driving gene expression in a plant cell. Preferably, such a promoter is a constitutive promoter or a tissue-preferred promoter. The methods find use in enhancing or increasing the resistance of a plant to at least one herbicide that interferes with the catalytic activity of the AHAS enzyme, particularly an imidazolinone or sulfonylurea herbicide.

    [0101] The present invention provides expression cassettes for expressing the polynucleotides of the invention in plants, plant tissues, plant cells, and other host cells. The expression cassettes comprise a promoter expressible in the plant, plant tissue, plant cell, or other host cells of interest operably linked to a polynucleotide of the invention that comprises a nucleotide sequence encoding either a full-length (i.e. including the chloroplast transit peptide) or mature AHASL1 protein (i.e. without the chloroplast transit peptide). If expression is desired in the plastids or chloroplasts of plants or plant cells, the expression cassette may also comprise an operably linked chloroplast-targeting sequence that encodes a chloroplast transit peptide.

    [0102] The expression cassettes of the invention find use in a method for enhancing the herbicide tolerance of a plant or a host cell. The method involves transforming the plant or host cell with an expression cassette of the invention, wherein the expression cassette comprises a promoter that is expressible in the plant or host cell of interest and the promoter is operably linked to a polynucleotide of the invention that comprises a nucleotide sequence encoding an imidazolinone-resistant AHASL1 protein of the invention.

    [0103] The use of the term polynucleotide constructs herein is not intended to limit the present invention to polynucleotide constructs comprising DNA. Those of ordinary skill in the art will recognize that polynucleotide constructs, particularly polynucleotides and oligonucleotides, comprised of ribonucleotides and combinations of ribonucleotides and deoxyribonucleotides may also be employed in the methods disclosed herein. Thus, the polynucleotide constructs of the present invention encompass all polynucleotide constructs that can be employed in the methods of the present invention for transforming plants including, but not limited to, those comprised of deoxyribonucleotides, ribonucleotides, and combinations thereof. Such deoxyribonucleotides and ribonucleotides include both naturally occurring molecules and synthetic analogues. The polynucleotide constructs of the invention also encompass all forms of polynucleotide constructs including, but not limited to, single-stranded forms, double-stranded forms, hairpins, stem-and-loop structures, and the like. Furthermore, it is understood by those of ordinary skill the art that each nucleotide sequences disclosed herein also encompasses the complement of that exemplified nucleotide sequence.

    [0104] Furthermore, it is recognized that the methods of the invention may employ a polynucleotide construct that is capable of directing, in a transformed plant, the expression of at least one protein, or at least one RNA, such as, for example, an antisense RNA that is complementary to at least a portion of an mRNA. Typically such a polynucleotide construct is comprised of a coding sequence for a protein or RNA operably linked to 5 and 3 transcriptional regulatory regions. Alternatively, it is also recognized that the methods of the invention may employ a polynucleotide construct that is not capable of directing, in a transformed plant, the expression of a protein or RNA.

    [0105] Further, it is recognized that, for expression of a polynucleotides of the invention in a host cell of interest, the polynucleotide is typically operably linked to a promoter that is capable of driving gene expression in the host cell of interest. The methods of the invention for expressing the polynucleotides in host cells do not depend on particular promoter. The methods encompass the use of any promoter that is known in the art and that is capable of driving gene expression in the host cell of interest.

    [0106] The present invention encompasses AHASL1 polynucleotide molecules and fragments and variants thereof. Polynucleotide molecules that are fragments of these nucleotide sequences are also encompassed by the present invention. By fragment is intended a portion of the nucleotide sequence encoding an AHASL1 protein of the invention. A fragment of an AHASL1 nucleotide sequence of the invention may encode a biologically active portion of an AHASL1 protein, or it may be a fragment that can be used as a hybridization probe or PCR primer using methods disclosed below. A biologically active portion of an AHASL1 protein can be prepared by isolating a portion of one of the AHASL1 nucleotide sequences of the invention, expressing the encoded portion of the AHASL1 protein (e.g., by recombinant expression in vitro), and assessing the activity of the encoded portion of the AHASL1 protein. Polynucleotide molecules that are fragments of an AHASL1 nucleotide sequence comprise at least about 15, 20, 50, 75, 100, 200, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1500, 1600, 1700, 1800, 1900, or 1950 nucleotides, or up to the number of nucleotides present in a full-length nucleotide sequence disclosed herein (for example, 1961 and 1932 nucleotides for SEQ ID NOS: 1 and 3, respectively) depending upon the intended use.

    [0107] A fragment of an AHASL1 nucleotide sequence that encodes a biologically active portion of an AHASL1 protein of the invention will encode at least about 15, 25, 30, 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 450, 500, 550, 600, or 625 contiguous amino acids, or up to the total number of amino acids present in a full-length AHASL1 protein of the invention (for example, 644 amino acids for SEQ ID NO: 2, 26, or 27). Fragments of an AHASL1 nucleotide sequence that are useful as hybridization probes for PCR primers generally need not encode a biologically active portion of an AHASL1 protein. Polynucleotide molecules that are variants of the nucleotide sequences disclosed herein are also encompassed by the present invention. Variants of the AHASL1 nucleotide sequences of the invention include those sequences that encode the AHASL1 proteins disclosed herein but that differ conservatively because of the degeneracy of the genetic code. These naturally occurring allelic variants can be identified with the use of well-known molecular biology techniques, such as polymerase chain reaction (PCR) and hybridization techniques as outlined below. Variant nucleotide sequences also include synthetically derived nucleotide sequences that have been generated, for example, by using site-directed mutagenesis but which still encode the AHASL1 protein disclosed in the present invention as discussed below. Generally, nucleotide sequence variants of the invention will have at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to a particular nucleotide sequence disclosed herein. A variant AHASL1 nucleotide sequence will encode an AHASL1 protein, respectively, that has an amino acid sequence having at least about 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to the amino acid sequence of an AHASL1 protein disclosed herein.

    [0108] In addition, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequences of the invention thereby leading to changes in the amino acid sequence of the encoded AHASL1 proteins without altering the biological activity of the AHASL1 proteins. Thus, an isolated polynucleotide molecule encoding an AHASL1 protein having a sequence that differs from that of SEQ ID NOS: 1 or 3, respectively, can be created by introducing one or more nucleotide substitutions, additions, or deletions into the corresponding nucleotide sequence disclosed herein, such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein. Mutations can be introduced by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Such variant nucleotide sequences are also encompassed by the present invention.

    [0109] For example, preferably, conservative amino acid substitutions may be made at one or more predicted, preferably nonessential amino acid residues. A nonessential amino acid residue is a residue that can be altered from the wild-type sequence of an AHASL1 protein (e.g., the sequence of SEQ ID NO: 2, 26, or 27) without altering the biological activity, whereas an essential amino acid residue is required for biological activity. A conservative amino acid substitution is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Such substitutions would not be made for conserved amino acid residues, or for amino acid residues residing within a conserved motif.

    [0110] The proteins of the invention may be altered in various ways including amino acid substitutions, deletions, truncations, and insertions. Methods for such manipulations are generally known in the art. For example, amino acid sequence variants of the AHASL1 proteins can be prepared by mutations in the DNA. Methods for mutagenesis and nucleotide sequence alterations are well known in the art. See, for example, Kunkel (1985) Proc. Natl. Acad. Sci. USA 82:488-492; Kunkel et al. (1987) Methods in Enzymol. 154:367-382; U.S. Pat. No. 4,873,192; Walker and Gaastra, eds. (1983) Techniques in Molecular Biology (MacMillan Publishing Company, New York) and the references cited therein. Guidance as to appropriate amino acid substitutions that do not affect biological activity of the protein of interest may be found in the model of Dayhoff et al. (1978) Atlas of Protein Sequence and Structure (Natl. Biomed. Res. Found., Washington, D.C.), herein incorporated by reference. Conservative substitutions, such as exchanging one amino acid with another having similar properties, may be preferable.

    [0111] Alternatively, variant AHASL1 nucleotide sequences can be made by introducing mutations randomly along all or part of an AHASL1 coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for AHAS activity to identify mutants that retain AHAS activity, including herbicide-resistant AHAS activity. Following mutagenesis, the encoded protein can be expressed recombinantly, and the activity of the protein can be determined using standard assay techniques.

    [0112] Thus, the nucleotide sequences of the invention include the sequences disclosed herein as well as fragments and variants thereof. The AHASL1 nucleotide sequences of the invention, and fragments and variants thereof, can be used as probes and/or primers to identify and/or clone AHASL homologues in other plants. Such probes can be used to detect transcripts or genomic sequences encoding the same or identical proteins.

    [0113] In this manner, methods such as PCR, hybridization, and the like can be used to identify such sequences having substantial identity to the sequences of the invention. See, for example, Sambrook et al. (1989) Molecular Cloning: Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Plainview, N.Y.) and Innis, et al. (1990) PCR Protocols: A Guide to Methods and Applications (Academic Press, NY). AHASL nucleotide sequences isolated based on their sequence identity to the AHASL1 nucleotide sequences set forth herein or to fragments and variants thereof are encompassed by the present invention.

    [0114] In a hybridization method, all or part of a known AHASL1 nucleotide sequence can be used to screen cDNA or genomic libraries. Methods for construction of such cDNA and genomic libraries are generally known in the art and are disclosed in Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Plainview, N.Y.). The so-called hybridization probes may be genomic DNA fragments, cDNA fragments, RNA fragments, or other oligonucleotides, and may be labeled with a detectable group such as .sup.32P, or any other detectable marker, such as other radioisotopes, a fluorescent compound, an enzyme, or an enzyme co-factor. Probes for hybridization can be made by labeling synthetic oligonucleotides based on the known AHASL1 nucleotide sequence disclosed herein. Degenerate primers designed on the basis of conserved nucleotides or amino acid residues in a known AHASL1 nucleotide sequence or encoded amino acid sequence can additionally be used. The probe typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12, preferably about 25, more preferably about 50, 75, 100, 125, 150, 175, 200, 250, 300, 350, 400, 500, 600, 700, 800, 900, 1000, 1200, 1400, 1600, or 1800 consecutive nucleotides of an AHASL1 nucleotide sequence of the invention or a fragment or variant thereof. Preparation of probes for hybridization is generally known in the art and is disclosed in Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Plainview, N.Y.), herein incorporated by reference.

    [0115] For example, the entire AHASL1 sequence disclosed herein, or one or more portions thereof, may be used as a probe capable of specifically hybridizing to corresponding AHASL1 sequences and messenger RNAs. Hybridization techniques include hybridization screening of plated DNA libraries (either plaques or colonies; see, for example, Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Plainview, N.Y.).

    [0116] Hybridization of such sequences may be carried out under stringent conditions. By stringent conditions or stringent hybridization conditions is intended conditions under which a probe will hybridize to its target sequence to a detectably greater degree than to other sequences (e.g., at least 2-fold over background). Stringent conditions are sequence-dependent and will be different in different circumstances.

    [0117] Typically, stringent conditions will be those in which the salt concentration is less than about 1.5 M Na ion, typically about 0.01 to 1.0 M Na ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30 C. for short probes (e.g., 10 to 50 nucleotides) and at least about 60 C. for long probes (e.g., greater than 50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. Exemplary low stringency conditions include hybridization with a buffer solution of 30 to 35% formamide, 1 M NaCl, 1% SDS (sodium dodecyl sulphate) at 37 C., and a wash in 1 to 2SSC (20SSC=3.0 M NaCl/0.3 M trisodium citrate) at 50 to 55 C. Exemplary moderate stringency conditions include hybridization in 40 to 45% formamide, 1.0 M NaCl, 1% SDS at 37 C., and a wash in 0.5 to 1SSC at 55 to 60 C. Exemplary high stringency conditions include hybridization in 50% formamide, 1 M NaCl, 1% SDS at 37 C., and a wash in 0.1SSC at 60 to 65 C. Optionally, wash buffers may comprise about 0.1% to about 1% SDS. The duration of hybridization is generally less than about 24 hours, usually about 4 to about 12 hours.

    [0118] Specificity is typically the function of post-hybridization washes, the critical factors being the ionic strength and temperature of the final wash solution. For DNA-DNA hybrids, the Tm can be approximated from the equation of Meinkoth and Wahl (1984) Anal. Biochem. 138:267-284: T.sub.m=81.5 C.+16.6 (log M)0.41 (% GC)0.0.61 (% form)500/L; where M is the molarity of monovalent cations, % GC is the percentage of guanosine and cytosine nucleotides in the DNA, % form is the percentage of formamide in the hybridization solution, and L is the length of the hybrid in base pairs. The T.sub.m is the temperature (under defined ionic strength and pH) at which 50% of a complementary target sequence hybridizes to a perfectly matched probe. T.sub.m is reduced by about 1 C. for each 1% of mismatching; thus, T.sub.m, hybridization, and/or wash conditions can be adjusted to hybridize to sequences of the desired identity. For example, if sequences with >90% identity are sought, the T.sub.m can be decreased 10 C. Generally, stringent conditions are selected to be about 5 C. lower than the thermal melting point (T.sub.m) for the specific sequence and its complement at a defined ionic strength and pH. However, severely stringent conditions can utilize a hybridization and/or wash at 1, 2, 3, or 4 C. lower than the thermal melting point (T.sub.m); moderately stringent conditions can utilize a hybridization and/or wash at 6, 7, 8, 9, or 10 C. lower than the thermal melting point (T.sub.m); low stringency conditions can utilize a hybridization and/or wash at 11, 12, 13, 14, 15, or 20 C. lower than the thermal melting point (T.sub.m). Using the equation, hybridization and wash compositions, and desired Tm, those of ordinary skill will understand that variations in the stringency of hybridization and/or wash solutions are inherently described. If the desired degree of mismatching results in a T.sub.m of less than 45 C. (aqueous solution) or 32 C. (formamide solution), it is preferred to increase the SSC concentration so that a higher temperature can be used. An extensive guide to the hybridization of nucleic acids is found in Tijssen (1993) Laboratory Techniques in Biochemistry and Molecular BiologyHybridization with Nucleic Acid Probes, Part I, Chapter 2 (Elsevier, New York); and Ausubel et al., eds. (1995) Current Protocols in Molecular Biology, Chapter 2 (Greene Publishing and Wiley-Interscience, New York). See Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Plainview, N.Y.).

    [0119] It is recognized that the polynucleotide molecules and proteins of the invention encompass polynucleotide molecules and proteins comprising a nucleotide or an amino acid sequence that is sufficiently identical to the nucleotide sequence of SEQ ID NOS: 1, 3, 4, and/or 6, or to any of the amino acid sequence of SEQ ID NO: 2, 26, and/or 27. The term sufficiently identical is used herein to refer to a first amino acid or nucleotide sequence that contains a sufficient or minimum number of identical or equivalent (e.g., with a similar side chain) amino acid residues or nucleotides to a second amino acid or nucleotide sequence such that the first and second amino acid or nucleotide sequences have a common structural domain and/or common functional activity. For example, amino acid or nucleotide sequences that contain a common structural domain having at least about 45%, 55%, or 65% identity, preferably 75% identity, more preferably 85%, 95%, or 98% identity are defined herein as sufficiently identical.

    [0120] To determine the percent identity of two amino acid sequences or of two nucleic acids, the sequences are aligned for optimal comparison purposes. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., percent identity=number of identical positions/total number of positions (e.g., overlapping positions)100). In one embodiment, the two sequences are the same length. The percent identity between two sequences can be determined using techniques similar to those described below, with or without allowing gaps. In calculating percent identity, typically exact matches are counted.

    [0121] The determination of percent identity between two sequences can be accomplished using a mathematical algorithm. A preferred, nonlimiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul (1990) Proc. Natl. Acad. Sci. USA 87:2264, modified as in Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877. Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul et al. (1990) J. Mol. Biol. 215:403. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12, to obtain nucleotide sequences homologous to the polynucleotide molecules of the invention. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3, to obtain amino acid sequences homologous to protein molecules of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al. (1997) Nucleic Acids Res. 5:3389. Alternatively, PSI-Blast can be used to perform an iterated search that detects distant relationships between molecules. See Altschul et al. (1997) supra. When utilizing BLAST, Gapped BLAST, and PSI-Blast programs, the default parameters of the respective programs (e.g.,)(BLAST and NBLAST) can be used. See http://www.ncbi.nlm.nih.gov. Another preferred, non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller (1988) CABIOS 4:11-17. Such an algorithm is incorporated into the ALIGN program (version 2.0), which is part of the GCG sequence alignment software package. When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 can be used. Alignment may also be performed manually by inspection.

    [0122] Unless otherwise stated, sequence identity/similarity values provided herein refer to the value obtained using the full-length sequences of the invention and using multiple alignment by mean of the algorithm Clustal W(Nucleic Acid Research, 22(22):4673-4680, 1994) using the program AlignX included in the software package Vector NTI Suite Version 7 (InforMax, Inc., Bethesda, Md., USA) using the default parameters; or any equivalent program thereof. By equivalent program is intended any sequence comparison program that, for any two sequences in question, generates an alignment having identical nucleotide or amino acid residue matches and an identical percent sequence identity when compared to the corresponding alignment generated by AlignX in the software package Vector NTI Suite Version 7.

    [0123] The AHASL1 nucleotide sequences of the invention include both the naturally occurring sequences as well as mutant forms, particularly mutant forms that encode AHASL1 proteins comprising herbicide-resistant AHAS activity. Likewise, the proteins of the invention encompass both naturally occurring proteins as well as variations and modified forms thereof. Such variants will continue to possess the desired AHAS activity. Obviously, the mutations that will be made in the DNA encoding the variant must not place the sequence out of reading frame and preferably will not create complementary regions that could produce secondary mRNA structure. See, EP Patent Application Publication No. 75,444.

    [0124] The deletions, insertions, and substitutions of the protein sequences encompassed herein are not expected to produce radical changes in the characteristics of the protein. However, when it is difficult to predict the exact effect of the substitution, deletion, or insertion in advance of doing so, one skilled in the art will appreciate that the effect will be evaluated by routine screening assays. That is, the activity can be evaluated by AHAS activity assays. See, for example, Singh et al. (1988) Anal. Biocheni. 171:173-179, herein incorporated by reference.

    [0125] Variant nucleotide sequences and proteins also encompass sequences and proteins derived from a mutagenic and recombinogenic procedure such as DNA shuffling. With such a procedure, one or more different AHASL coding sequences can be manipulated to create a new AHASL protein possessing the desired properties. In this manner, libraries of recombinant polynucleotides are generated from a population of related sequence polynucleotides comprising sequence regions that have substantial sequence identity and can be homologously recombined in vitro or in vivo. For example, using this approach, sequence motifs encoding a domain of interest may be shuffled between the AHASL1 gene of the invention and other known AHASL genes to obtain a new gene coding for a protein with an improved property of interest, such as an increased K.sub.m in the case of an enzyme. Strategies for such DNA shuffling are known in the art. See, for example, Stemmer (1994) Proc. Natl. Acad. Sci. USA 91:10747-10751; Stemmer (1994) Nature 370:389-391; Crameri et al. (1997) Nature Biotech. 15:436-438; Moore et al. (1997) J. Mol. Biol. 272:336-347; Zhang et al. (1997) Proc. Natl. Acad. Sci. USA 94:4504-4509; Crameri et al. (1998) Nature 391:288-291; and U.S. Pat. Nos. 5,605,793 and 5,837,458.

    [0126] The nucleotide sequences of the invention can be used to isolate corresponding sequences from other organisms, particularly other plants, more particularly other dicots. In this manner, methods such as PCR, hybridization, and the like can be used to identify such sequences based on their sequence homology to the sequences set forth herein. Sequences isolated based on their sequence identity to the entire AHASL1 sequences set forth herein or to fragments thereof are encompassed by the present invention. Thus, isolated sequences that encode for an AHASL protein and which hybridize under stringent conditions to the sequence disclosed herein, or to fragments thereof, are encompassed by the present invention.

    [0127] In a PCR approach, oligonucleotide primers can be designed for use in PCR reactions to amplify corresponding DNA sequences from cDNA or genomic DNA extracted from any plant of interest. Methods for designing PCR primers and PCR cloning are generally known in the art and are disclosed in Sambrook et al. (1989) Molecular Cloning: A Laboratory Manual (2d ed., Cold Spring Harbor Laboratory Press, Plainview, N.Y.). See also Innis et al., eds. (1990) PCR Protocols: A Guide to Methods and Applications (Academic Press, New York); Innis and Gelfand, eds. (1995) PCR Strategies (Academic Press, New York); and Innis and Gelfand, eds. (1999) PCR Methods Manual (Academic Press, New York). Known methods of PCR include, but are not limited to, methods using paired primers, nested primers, single specific primers, degenerate primers, gene-specific primers, vector-specific primers, partially-mismatched primers, and the like.

    [0128] The AHASL1 polynucleotide sequences of the invention are provided in expression cassettes for expression in the plant of interest. The cassette will include 5 and 3 regulatory sequences operably linked to an AHASL1 polynucleotide sequence of the invention. By operably linked is intended a functional linkage between a promoter and a second sequence, wherein the promoter sequence initiates and mediates transcription of the DNA sequence corresponding to the second sequence. Generally, operably linked means that the nucleic acid sequences being linked are contiguous and, where necessary to join two protein coding regions, contiguous and in the same reading frame. The cassette may additionally contain at least one additional gene to be cotransformed into the organism. Alternatively, the additional gene(s) can be provided on multiple expression cassettes.

    [0129] Such an expression cassette is provided with a plurality of restriction sites for insertion of the AHASL1 polynucleotide sequence to be under the transcriptional regulation of the regulatory regions. The expression cassette may additionally contain selectable marker genes.

    [0130] The expression cassette will include in the 5-3 direction of transcription, a transcriptional and translational initiation region (i.e., a promoter), an AHASL1 polynucleotide sequence of the invention, and a transcriptional and translational termination region (i.e., termination region) functional in plants. The promoter may be native or analogous, or foreign or heterologous, to the plant host and/or to the AHASL1 polynucleotide sequence of the invention. Additionally, the promoter may be the natural sequence or alternatively a synthetic sequence. Where the promoter is foreign or heterologous to the plant host, it is intended that the promoter is not found in the native plant into which the promoter is introduced. Where the promoter is foreign or heterologous to the AHASL1 polynucleotide sequence of the invention, it is intended that the promoter is not the native or naturally occurring promoter for the operably linked AHASL1 polynucleotide sequence of the invention. As used herein, a chimeric gene comprises a coding sequence operably linked to a transcription initiation region that is heterologous to the coding sequence.

    [0131] While it may be preferable to express the AHASL1 polynucleotides of the invention using heterologous promoters, the native promoter sequences may be used. Such constructs would change expression levels of the AHASL1 protein in the plant or plant cell. Thus, the phenotype of the plant or plant cell is altered.

    [0132] The termination region may be native with the transcriptional initiation region, may be native with the operably linked AHASL1 sequence of interest, may be native with the plant host, or may be derived from another source (i.e., foreign or heterologous to the promoter, the AHASL1 polynucleotide sequence of interest, the plant host, or any combination thereof). Convenient termination regions are available from the Ti-plasmid of A. tuinefaciens, such as the octopine synthase and nopaline synthase termination regions. See also Guerineau et al. (1991) Mol. Gen. Genet. 262:141-144; Proudfoot (1991) Cell 64:671-674; Sanfacon et al. (1991) Genes Dev. 5:141-149; Mogen et al. (1990) Plant Cell 2:1261-1272; Munroe et al. (1990) Gene 91:151-158; Ballas et al. (1989) Nucleic Acids Res. 17:7891-7903; and Joshi et al. (1987) Nucleic Acid Res. 15:9627-9639.

    [0133] Where appropriate, the gene(s) may be optimized for increased expression in the transformed plant. That is, the genes can be synthesized using plant-preferred codons for improved expression. See, for example, Campbell and Gown (1990) Plant Physiol. 92:1-11 for a discussion of host-preferred codon usage. Methods are available in the art for synthesizing plant-preferred genes. See, for example, U.S. Pat. Nos. 5,380,831, and 5,436,391, and Murray et al. (1989) Nucleic Acids Res. 17:477-498, herein incorporated by reference.

    [0134] Additional sequence modifications are known to enhance gene expression in a cellular host. These include elimination of sequences encoding spurious polyadenylation signals, exon-intron splice site signals, transposon-like repeats, and other such well-characterized sequences that may be deleterious to gene expression. The G-C content of the sequence may be adjusted to levels average for a given cellular host, as calculated by reference to known genes expressed in the host cell. When possible, the sequence is modified to avoid predicted hairpin secondary mRNA structures.

    [0135] Nucleotide sequences for enhancing gene expression can also be used in the plant expression vectors. These include the introns of the maize Adhl, intronl gene (Callis et al. Genes and Development 1:1183-1200, 1987), and leader sequences, (W-sequence) from the Tobacco Mosaic virus (TMV), Maize Chlorotic Mottle Virus and Alfalfa Mosaic Virus (Gallie et al. Nucleic Acid Res. 15:8693-8711, 1987 and Skuzeski et al. Plant Mol. Biol. 15:65-79, 1990). The first intron from the shrunken-1 locus of maize, has been shown to increase expression of genes in chimeric gene constructs. U.S. Pat. Nos. 5,424,412 and 5,593,874 disclose the use of specific introns in gene expression constructs, and Gallie et al. (Plant Physiol. 106:929-939, 1994) also have shown that introns are useful for regulating gene expression on a tissue specific basis. To further enhance or to optimize AHAS small subunit gene expression, the plant expression vectors of the invention may also contain DNA sequences containing matrix attachment regions (MARs). Plant cells transformed with such modified expression systems, then, may exhibit overexpression or constitutive expression of a nucleotide sequence of the invention.

    [0136] The expression cassettes may additionally contain 5 leader sequences in the expression cassette construct. Such leader sequences can act to enhance translation. Translation leaders are known in the art and include: picornavirus leaders, for example, EMCV leader (Encephalomyocarditis 5 noncoding region) (Elroy-Stein et al. (1989) Proc. Natl. Acad. Sci. USA 86:6126-6130); potyvirus 65 leaders, for example, TEV leader (Tobacco Etch Virus) (Gallie et al. (1995) Gene 165(2):233-238), MDMV leader (Maize Dwarf Mosaic Virus) (Virology 154:9-20), and human immunoglobulin heavy-chain binding protein (BiP) (Macejak et al. (1991) Nature 353:90-94); untranslated leader from the coat protein mRNA of alfalfa mosaic virus (AMV RNA 4) (Jobling et al. (1987) Nature 325:622-625); tobacco mosaic virus leader (TMV) (Gallie et al. (1989) in Molecular Biology of RNA, ed. Cech (Liss, New York), pp. 237-256); and maize chlorotic mottle virus leader (MCMV) (Lommel et al. (1991) Virology 81:382-385). See also, Della-Cioppa et al. (1987) Plant Physiol. 84:965-968. Other methods known to enhance translation can also be utilized, for example, introns, and the like.

    [0137] In preparing the expression cassette, the various DNA fragments may be manipulated, so as to provide for the DNA sequences in the proper orientation and, as appropriate, in the proper reading frame. Toward this end, adapters or linkers may be employed to join the DNA fragments or other manipulations may be involved to provide for convenient restriction sites, removal of superfluous DNA, removal of restriction sites, or the like. For this purpose, in vitro mutagenesis, primer repair, restriction, annealing, resubstitutions, e.g., transitions and transversions, may be involved.

    [0138] A number of promoters can be used in the practice of the invention. The promoters can be selected based on the desired outcome. The nucleic acids can be combined with constitutive, tissue-preferred, or other promoters for expression in plants.

    [0139] Such constitutive promoters include, for example, the core promoter of the Rsyn7 promoter and other constitutive promoters disclosed in WO 99/43838 and U.S. Pat. No. 6,072,050; the core CaMV 35S promoter (Odell et al. (1985) Nature 313:810-812); rice actin (McElroy et al. (1990) Plant Cell 2:163-171); ubiquitin (Christensen et al. (1989) Plant Mol. Biol. 12:619-632 and Christensen et al. (1992) Plant Mol. Biol. 18:675-689); pEMU (Last et al. (1991) Theor. Appl Genet. 81:581-588); MAS (Velten et al. (1984) EMBO J. 3:2723-2730); ALS promoter (U.S. Pat. No. 5,659,026), and the like. Other constitutive promoters include, for example, U.S. Pat. Nos. 5,608,149; 5,608,144; 5,604,121; 5,569,597; 5,466,785; 5,399,680; 5,268,463; 5,608,142; and 6,177,611.

    [0140] Tissue-preferred promoters can be utilized to target enhanced AHASL1 expression within a particular plant tissue. Such tissue-preferred promoters include, but are not limited to, leaf-preferred promoters, root-preferred promoters, seed-preferred promoters, and stem-preferred promoters. Tissue-preferred promoters include Yamamoto et al. (1997) Plant J. 12(2):255-265; Kawamata et al. (1997) Plant Cell Physiol. 38(7):792-803; Hansen et al. (1997) Mol. Gen Genet. 254(3):337-343; Russell et al. (1997) Transgenic Res. 6(2):157-168; Rinehart et al. (1996) Plant Physiol. 112(3):1331-1341; Van Camp et al. (1996) Plant Physiol. 112(2):525-535; Canevascini et al. (1996) Plant Physiol. 112(2):513-524; Yamamoto et al. (1994) Plant Cell Physiol. 35(5):773-778; Lam (1994) Results Probl. Cell Differ. 20:181-196; Orozco et al. (1993) Plant Mol Biol. 23(6):1129-1138; Matsuoka et al. (1993) Proc Natl. Acad. Sci. USA 90(20):9586-9590; and Guevara-Garcia et al. (1993) Plant J. 4(3):495-505. Such promoters can be modified, if necessary, for weak expression.

    [0141] In one embodiment, the nucleic acids of interest are targeted to the chloroplast for expression. In this manner, where the nucleic acid of interest is not directly inserted into the chloroplast, the expression cassette will additionally contain a chloroplast-targeting sequence comprising a nucleotide sequence that encodes a chloroplast transit peptide to direct the gene product of interest to the chloroplasts. Such transit peptides are known in the art. With respect to chloroplast-targeting sequences, operably linked means that the nucleic acid sequence encoding a transit peptide (i.e., the chloroplast-targeting sequence) is linked to the AHASL1 polynucleotide of the invention such that the two sequences are contiguous and in the same reading frame. See, for example, Von Heijne et al. (1991) Plant Mol. Biol. Rep. 9:104-126; Clark et al. (1989) J. Biol. Chem. 264:17544-17550; Della-Cioppa et al. (1987) Plant Physiol. 84:965-968; Romer et al. (1993) Biochem. Biophys. Res. Comnzun. 196:1414-1421; and Shah et al. (1986) Science 233:478-481. While the AHASL1 proteins of the invention include a native chloroplast transit peptide, any chloroplast transit peptide known in art can be fused to the amino acid sequence of a mature AHASL1 protein of the invention by operably linking a choloroplast-targeting sequence to the 5-end of a nucleotide sequence encoding a mature AHASL1 protein of the invention.

    [0142] Chloroplast targeting sequences are known in the art and include the chloroplast small subunit of ribulose-1,5-bisphosphate carboxylase (Rubisco) (de Castro Silva Filho et al. (1996) Plant Mol Biol. 30:769-780; Schnell et al. (1991) J. Biol. Chem. 266(5):3335-3342); 5-(enolpyruvyl)shikimate-3-phosphate synthase (EPSPS) (Archer et al. (1990) J. Bioenerg. Biomemb. 22(6):789-810); tryptophan synthase (Zhao et al. (1995) J. Biol. Chem. 270(11):6081-6087); plastocyanin (Lawrence et al. (1997) J. Biol. Chem. 272(33):20357-20363); chorismate synthase (Schmidt et al. (1993) J. Biol. Chem. 268(36):27447-27457); and the light harvesting chlorophyll a/b binding protein (LHBP) (Lamppa et al. (1988) J. Biol. Chem. 263:14996-14999). See also Von Heijne et al. (1991) Plant Mol Biol. Rep. 9:104-126; Clark et al. (1989) J. Biol. Chem. 264:17544-17550; Della-Cioppa et al. (1987) Plant Physiol 84:965-968; Romer et al. (1993) Biochein. Biophys. Res. Commun. 196:1414-1421; and Shah et al. (1986) Science 233:478-481.

    [0143] Methods for transformation of chloroplasts are known in the art. See, for example, Svab et al. (1990) Proc. Natl. Acad. Sci. USA 87:8526-8530; Svab and Maliga (1993) Proc. Natl. Acad. Sci. USA 90:913-917; Svab and Maliga (1993) EMBO J. 12:601-606. The method relies on particle gun delivery of DNA containing a selectable marker and targeting of the DNA to the plastid genome through homologous recombination. Additionally, plastid transformation can be accomplished by transactivation of a silent plastid-borne transgene by tissue-preferred expression of a nuclear-encoded and plastid-directed RNA polyinerase. Such a system has been reported in McBride et al. (1994) Proc. Natl. Acad. Sci. USA 91:7301-7305.

    [0144] The nucleic acids of interest to be targeted to the chloroplast may be optimized for expression in the chloroplast to account for differences in codon usage between the plant nucleus and this organelle. In this manner, the nucleic acids of interest may be synthesized using chloroplast-preferred codons. See, for example, U.S. Pat. No. 5,380,831, herein incorporated by reference.

    [0145] As disclosed herein, the AHASL1 nucleotide sequences of the invention find use in enhancing the herbicide tolerance of plants that comprise in their genomes a gene encoding an herbicide-tolerant AHASL1 protein. Such a gene may be an endogenous gene or a transgene. Additionally, in certain embodiments, the nucleic acid sequences of the present invention can be stacked with any combination of polynucleotide sequences of interest in order to create plants with a desired phenotype. For example, the polynucleotides of the present invention may be stacked with any other polynucleotides encoding polypeptides having pesticidal and/or insecticidal activity, such as, for example, the Bacillus thuringiensis toxin proteins (described in U.S. Pat. Nos. 5,366,892; 5,747,450; 5,737,514; 5,723,756; 5,593,881; and Geiser et al. (1986) Gene 48:109). The combinations generated can also include multiple copies of any one of the polynucleotides of interest.

    [0146] It is recognized that with these nucleotide sequences, antisense constructions, complementary to at least a portion of the messenger RNA (mRNA) for the AHASL1 polynucleotide sequences can be constructed. Antisense nucleotides are constructed to hybridize with the corresponding mRNA. Modifications of the antisense sequences may be made as long as the sequences hybridize to and interfere with expression of the corresponding mRNA. In this manner, antisense constructions having 70%, preferably 80%, more preferably 85% sequence identity to the corresponding antisensed sequences may be used. Furthermore, portions of the antisense nucleotides may be used to disrupt the expression of the target gene. Generally, sequences of at least 50 nucleotides, 100 nucleotides, 200 nucleotides, or greater may be used.

    [0147] The nucleotide sequences of the present invention may also be used in the sense orientation to suppress the expression of endogenous genes in plants. Methods for suppressing gene expression in plants using nucleotide sequences in the sense orientation are known in the art. The methods generally involve transforming plants with a DNA construct comprising a promoter that drives expression in a plant operably linked to at least a portion of a nucleotide sequence that corresponds to the transcript of the endogenous gene. Typically, such a nucleotide sequence has substantial sequence identity to the sequence of the transcript of the endogenous gene, preferably greater than about 65% sequence identity, more preferably greater than about 85% sequence identity, most preferably greater than about 95% sequence identity. See, U.S. Pat. Nos. 5,283,184 and 5,034,323; herein incorporated by reference.

    [0148] While the herbicide-resistant AHASL1 polynucleotides of the invention find use as selectable marker genes for plant transformation, the expression cassettes of the invention can include another selectable marker gene for the selection of transformed cells. Selectable marker genes, including those of the present invention, are utilized for the selection of transformed cells or tissues. Marker genes include, but are not limited to, genes encoding antibiotic resistance, such as those encoding neomycin phosphotransferase II(NEO) and hygromycin phosphotransferase (HPT), as well as genes conferring resistance to herbicidal compounds, such as glufosinate ammonium, bromoxynil, imidazolinones, and 2,4-dichlorophenoxyacetate (2,4-D). See generally, Yarranton (1992) Curr. Opin. Biotech. 3:506-511; Christopherson et al. (1992) Proc. Natl. Acad. Sci. USA 89:6314-6318; Yao et al. (1992) Cell 71:63-72; Reznikoff (1992) Mol. Microbiol. 6:2419-2422; Barkley et al. (1980) in The Operon, pp. 177-220; Hu et al. (1987) Cell 48:555-566; Brown et al. (1987) Cell 49:603-612; Figge et al. (1988) Cell 52:713-722; Deuschle et al. (1989) Proc. Natl. Acad. Aci. USA 86:5400-5404; Fuerst et al. (1989) Proc. Natl. Acad. Sci. USA 86:2549-2553; Deuschle et al. (1990) Science 248:480-483; Gossen (1993) Ph.D. Thesis, University of Heidelberg; Reines et al. (1993) Proc. Natl. Acad. Sci. USA 90:1917-1921; Labow et al. (1990) Mol. Cell. Biol. 10:3343-3356; Zambretti et al. (1992) Proc. Natl. Acad. Sci. USA 89:3952-3956; Balm et al. (1991) Proc. Natl. Acad. Sci. USA 88:5072-5076; Wyborski et al. (1991) Nucleic Acids Res. 19:4647-4653; Hillenand-Wissman (1989) Topics Mol. Struc. Biol. 10:143-162; Degenkolb et al. (1991) Antimicrob. Agents Chemother. 35:1591-1595; Kleinschnidt et al. (1988) Biochemistiy 27:1094-1104; Bonin (1993) Ph.D. Thesis, University of Heidelberg; Gossen et al. (1992) Proc. Natl. Acad. Sci. USA 89:5547-5551; Oliva et al. (1992) Antimicrob. Agents Chemother. 36:913-919; Hlavka et al. (1985) Handbook of Experimental Pharmacology, Vol. 78 (Springer-Verlag, Berlin); Gill et al. (1988) Nature 334:721-724. Such disclosures are herein incorporated by reference.

    [0149] The above list of selectable marker genes is not meant to be limiting. Any selectable marker gene can be used in the present invention.

    [0150] The isolated polynucleotide molecules comprising nucleotide sequence that encode the AHASL1 proteins of the invention can be used in vectors to transform plants so, that the plants created have enhanced resistant to herbicides, particularly imidazolinone herbicides. The isolated AHASL1 polynucleotide molecules of the invention can be used in vectors alone or in combination with a nucleotide sequence encoding the small subunit of the AHAS (AHASS) enzyme in conferring herbicide resistance in plants. See, U.S. Pat. No. 6,348,643; which is herein incorporated by reference.

    [0151] The invention also relates to a plant expression vector comprising a promoter that drives expression in a plant operably linked to an isolated polynucleotide molecule of the invention.

    [0152] The isolated polynucleotide molecule comprises a nucleotide sequence encoding an AHASL1 protein, particularly an AHASL1 protein comprising an amino sequence that is set forth in SEQ ID NO. 2, 26, or 27, or a functional fragment and variant thereof. The plant expression vector of the invention does not depend on a particular promoter, only that such a promoter is capable of driving gene expression in a plant cell. Preferred promoters include constitutive promoters and tissue-preferred promoters.

    [0153] The transformation vectors of the invention can be used to produce plants transformed with a gene of interest. The transformation vector will comprise a selectable marker gene of the invention and a gene of interest to be introduced and typically expressed in the transformed plant. Such a selectable marker gene comprises an herbicide-resistant AHASL1 polynucleotide of the invention operably linked to a promoter that drives expression in a host cell. For use in plants and plant cells, the transformation vector comprises a selectable marker gene comprising an herbicide-resistant AHASL1 polynucleotide of the invention operably linked to a promoter that drives expression in a plant cell.

    [0154] The genes of interest of the invention vary depending on the desired outcome. For example, various changes in phenotype can be of interest including modifying the fatty acid composition in a plant, altering the amino acid content of a plant, altering a plant's insect and/or pathogen defense mechanisms, and the like. These results can be achieved by providing expression of heterologous products or increased expression of endogenous products in plants. Alternatively, the results can be achieved by providing for a reduction of expression of one or more endogenous products, particularly enzymes or cofactors in the plant. These changes result in a change in phenotype of the transformed plant.

    [0155] In one embodiment of the invention, the genes of interest include insect resistance genes such as, for example, Bacillus thuringiensis toxin protein genes (U.S. Pat. Nos. 5,366,892; 5,747,450; 5,736,514; 5,723,756; 5,593,881; and Geiser et al. (1986) Gene 48:109).

    [0156] The AHASL1 proteins or polypeptides of the invention can be purified from, for example, rice plants and can be used in compositions. Also, an isolated polynucleotide molecule encoding an AHASL1 protein of the invention can be used to express an AHASL1 protein of the invention in a microbe such as E. coli or a yeast. The expressed AHASL1 protein can be purified from extracts of E. coli or yeast by any method known to those or ordinary skill in the art.

    [0157] The invention also relates to a method for creating a transgenic plant that is resistant to herbicides, comprising transforming a plant with a plant expression vector comprising a promoter that drives expression in a plant operably linked to an isolated polynucleotide molecule of the invention. The isolated polynucleotide molecule comprises a nucleotide sequence encoding an AHASL1 protein of the invention, particularly an AHASL1 protein comprising: an amino sequence that is set forth in SEQ ID NO. 2, 26, or 27, an amino acid sequence encoded by SEQ ID NO. 1 or 3, or a functional fragment and variant of said amino acid sequences.

    [0158] The invention also relates to the non-transgenic rice plants, transgenic plants produced by the methods of the invention, and progeny and other descendants of such non-transgenic and transgenic plants, which plants exhibit enhanced or increased resistance to herbicides that interfere with the AHAS enzyme, particularly imidazolinone and sulfonylurea herbicides.

    [0159] The AHASL1 polynucleotides of the invention, particularly those encoding herbicide-resistant AHASL1 proteins, find use in methods for enhancing the resistance of herbicide-tolerant plants. In one embodiment of the invention, the herbicide-tolerant plants comprise an herbicide-tolerant or herbicide resistant AHASL1 protein. The herbicide-tolerant plants include both plants transformed with an herbicide-tolerant AHASL1 nucleotide sequences and plants that comprise in their genomes an endogenous gene that encodes an herbicide-tolerant AHASL1 protein. Nucleotide sequences encoding herbicide-tolerant AHASL1 proteins and herbicide-tolerant plants comprising an endogenous gene that encodes an herbicide-tolerant AHASL1 protein include the polynucleotides and plants of the present invention and those that are known in the art. See, for example, U.S. Pat. Nos. 5,013,659, 5,731,180, 5,767,361, 5,545,822, 5,736,629, 5,773,703, 5,773,704, 5,952,553 and 6,274,796; all of which are herein incorporated by reference. Such methods for enhancing the resistance of herbicide-tolerant plants comprise transforming an herbicide-tolerant plant with at least one polynucleotide construction comprising a promoter that drives expression in a plant cell that is operably linked to an herbicide resistant AHASL1 polynucleotide of the invention, particularly the polynucleotide encoding an herbicide-resistant AHASL1 protein as set forth in SEQ ID NO. 1 or 3, or polynucleotides encoding the amino acid sequence set forth in SEQ ID NO. 2, 26, or 27, and fragments and variants said polynucleotides that encode polypeptides comprising herbicide-resistant AHAS activity.

    [0160] Numerous plant transformation vectors and methods for transforming plants are available. See, for example, An, G. et al. (1986) Plant Pysiol., 81:301-305; Fry, J., et al. (1987) Plant Cell Rep. 6:321-325; Block, M. (1988) Theor. Appl. Genet. 76:767-774; Hinchee, et al. (1990) Stadler. Genet. Symp. 203212.203-212; Cousins, et al. (1991) Aust. J. Plant Physiol. 18:481-494; Chee, P. P. and Slightom, J. L. (1992) Gene. 118:255-260; Christou, et al. (1992) Trends. Biotechnol. 10:239-246; D'Halluin, et al. (1992) Bio/Technol. 10:309-314; Dhir, et al. (1992) Plant Physiol. 99:81-88; Casas et al. (1993) Proc. Nat. Acad Sci. USA 90:11212-11216; Christou, P. (1993) In Vitro Cell. Dev. Biol.-Plant; 29P:119-124; Davies, et al. (1993) Plant Cell Rep. 12:180-183; Dong, J. A. and Mchughen, A (1993) Plant Sci. 91:139-148; Franklin, C. and Trieu, T. N. (1993) Plant. Physiol. 102:167; Golovkin, et al. (1993) Plant Sci. 90:41-52; Guo Chin Sci. Bull. 38:2072-2078; Asano, et al. (1994) Plant Cell Rep. 13; Ayeres N. M. and Park, W. D. (1994) Crit. Rev. Plant. Sci. 13:219-239; Barcelo, et al. (1994) Plant. J. 5:583-592; Becker, et al. (1994) Plant. I 5:299-307; Borkowska et al. (1994) Acta. Physiol Plant. 16:225-230; Christou, P. (1994) Agro. Food. Ind. Hi Tech. 5: 17-27; Eapen et al. (1994) Plant Cell Rep. 13:582-586; Hartman, et al. (1994) Bio-Technology 12: 919923; Ritala, et al. (1994) Plant. Mol. Biol. 24:317-325; and Wan, Y. C. and Lemaux, P. G. (1994) Plant Physiol. 104:3748.

    [0161] The methods of the invention involve introducing a polynucleotide construct into a plant. By introducing is intended presenting to the plant the polynucleotide construct in such a manner that the construct gains access to the interior of a cell of the plant. The methods of the invention do not depend on a particular method for introducing a polynucleotide construct to a plant, only that the polynucleotide construct gains access to the interior of at least one cell of the plant. Methods for introducing polynucleotide constructs into plants are known in the art including, but not limited to, stable transformation methods, transient transformation methods, and virus-mediated methods.

    [0162] By stable transformation is intended that the polynucleotide construct introduced into a plant integrates into the genome of the plant and is capable of being inherited by progeny thereof. By transient transformation is intended that a polynucleotide construct introduced into a plant does not integrate into the genome of the plant.

    [0163] For the transformation of plants and plant cells, the nucleotide sequences of the invention are inserted using standard techniques into any vector known in the art that is suitable for expression of the nucleotide sequences in a plant or plant cell. The selection of the vector depends on the preferred transformation technique and the target plant species to be transformed. In an embodiment of the invention, an AHASL1 nucleotide sequence is operably linked to a plant promoter that is known for high-level expression in a plant cell, and this construct is then introduced into a plant that that is susceptible to an imidazolinone herbicide and a transformed plant it regenerated. The transformed plant is tolerant to exposure to a level of an imidazolinone herbicide that would kill or significantly injure an untransformed plant. This method can be applied to any plant species; however, it is most beneficial when applied to crop plants, particularly crop plants that are typically grown in the presence of at least one herbicide, particularly an imidazolinone herbicide.

    [0164] Methodologies for constructing plant expression cassettes and introducing foreign nucleic acids into plants are generally known in the art and have been previously described. For example, foreign DNA can be introduced into plants, using tumor-inducing (Ti) plasmid vectors. Other methods utilized for foreign DNA delivery involve the use of PEG mediated protoplast transformation, electroporation, microinjection whiskers, and biolistics or microprojectile bombardment for direct DNA uptake. Such methods are known in the art. (U.S. Pat. No. 5,405,765 to Vasil et al.; Bilang et al. (1991) Gene 100: 247-250; Scheid et al., (1991) Mol. Gen. Genet., 228: 104-112; Guerche et al., (1987) Plant Science 52: 111-116; Neuhause et al., (1987) Theor. Appl Genet. 75: 30-36; Klein et al., (1987) Nature 327: 70-73; Howell et al., (1980) Science 208:1265; Horsch et al., (1985) Science 227: 1229-1231; DeBlock et al., (1989) Plant Physiology 91: 694-701; Methods for Plant Molecular Biology (Weissbach and Weissbach, eds.) Academic Press, Inc. (1988) and Methods in Plant Molecular Biology (Schuler and Zielinski, eds.) Academic Press, Inc. (1989). The method of transformation depends upon the plant cell to be transformed, stability of vectors used, expression level of gene products and other parameters.

    [0165] Other suitable methods of introducing nucleotide sequences into plant cells and subsequent insertion into the plant genome include microinjection as Crossway et al. (1986) Biotechniques 4:320-334, electroporation as described by Riggs et al. (1986) Proc. Natl. Acad. Sci. USA 83:5602-5606, Agrobacterium-mediated transformation as described by Townsend et al., U.S. Pat. No. 5,563,055, Zhao et al., U.S. Pat. No. 5,981,840, direct gene transfer as described by Paszkowski et al. (1984) EMBO J 3:2717-2722, and ballistic particle acceleration as described in, for example, Sanford et al., U.S. Pat. No. 4,945,050; Tomes et al., U.S. Pat. No. 5,879,918; Tomes et al., U.S. Pat. No. 5,886,244; Bidney et al., U.S. Pat. No. 5,932,782; Tomes et al. (1995) Direct DNA Transfer into Intact Plant Cells via Microprojectile Bombardment, in Plant Cell, Tissue, and Organ Culture: Fundamental Methods, ed. Gamborg and Phillips (Springer-Verlag, Berlin); McCabe et al. (1988) Biotechnology 6:923-926); and Lecl transformation (WO 00/28058). Also see, Weissinger et al. (1988) Ann. Rev. Genet. 22:421-477; Sanford et al. (1987) Particulate Science and Technology 5:27-37 (onion); Christou et al. (1988) Plant Physiol. 87:671-674 (soybean); McCabe et al. (1988) Bio/Technology 6:923-926 (soybean); Finer and McMullen (1991) In Vitro Cell Dev. Biol. 27P:175-182 (soybean); Singh et al. (1998) Theor. Appl. Genet. 96:319-324 (soybean); Datta et al. (1990) Biotechnology 8:736-740 (rice); Klein et al. (1988) Proc. Natl. Acad. Sci. USA 85:4305-4309 (maize); Klein et al. (1988) Biotechnology 6:559-563 (maize); Tomes, U.S. Pat. No. 5,240,855; Buising et al., U.S. Pat. Nos. 5,322,783 and 5,324,646; Tomes et al. (1995) Direct DNA Transfer into Intact Plant Cells via Microprojectile Bombardment, in Plant Cell, Tissue, and Organ Culture: Fundamental Methods, ed. Gamborg (Springer-Verlag, Berlin) (maize); Klein et al. (1988) Plant Physiol. 91:440-444 (maize); Fromm et al. (1990) Biotechnology 8:833-839 (maize); Hooykaas-Van Slogteren et al. (1984) Nature (London) 311:763-764; Bowen et al., U.S. Pat. No. 5,736,369 (cereals); Bytebier et al. (1987) Proc. Natl. Acad. Sci. USA 84:5345-5349 (Liliaceae); De Wet et al. (1985) in The Experimental Manipulation of Ovule Tissues, ed. Chapman et al. (Longman, N.Y.), pp. 197-209 (pollen); Kaeppler et al. (1990) Plant Cell Reports 9:415-418 and Kaeppler et al. (1992) Theor. Appl. Genet. 84:560-566 (whisker-mediated transformation); D'Halluin et al. (1992) Plant Cell 4:1495-1505 (electroporation); Li et al. (1993) Plant Cell Reports 12:250-255 and Christou and Ford (1995) Annals of Botany 75:407-413 (rice); Osjoda et al. (1996) Nature Biotechnology 14:745-750 (maize via Agrobacterium tumefaciens); all of which are herein incorporated by reference.

    [0166] The polynucleotides of the invention may be introduced into plants by contacting plants with a virus or viral nucleic acids. Generally, such methods involve incorporating a polynucleotide construct of the invention within a viral DNA or RNA molecule. It is recognized that the an AHASL1 protein of the invention may be initially synthesized as part of a viral polyprotein, which later may be processed by proteolysis in vivo or in vitro to produce the desired recombinant protein. Further, it is recognized that promoters of the invention also encompass promoters utilized for transcription by viral RNA polymerases. Methods for introducing polynucleotide constructs into plants and expressing a protein encoded therein, involving viral DNA or RNA molecules, are known in the art. See, for example, U.S. Pat. Nos. 5,889,191, 5,889,190, 5,866,785, 5,589,367 and 5,316,931; herein incorporated by reference.

    [0167] The cells that have been transformed may be grown into plants in accordance with conventional ways. See, for example, McCormick et al. (1986) Plant Cell Reports 5:81-84. These plants may then be grown, and either pollinated with the same transformed strain or different strains, and the resulting hybrid having constitutive expression of the desired phenotypic characteristic identified. Two or more generations may be grown to ensure that expression of the desired phenotypic characteristic is stably maintained and inherited and then seeds harvested to ensure expression of the desired phenotypic characteristic has been achieved. In this manner, the present invention provides transformed seed (also referred to as transgenic seed) having a polynucleotide construct of the invention, for example, an expression cassette of the invention, stably incorporated into their genome.

    [0168] The present invention may be used for transformation of any plant species, including, but not limited to, monocots and dicots. Examples of plant species of interest include, but are not limited to, corn or maize (Zea mays), Brassica sp. (e.g., B. napus, B. rapa, B. juncea), particularly those Brassica species useful as sources of seed oil, alfalfa (Medicago sativa), rice (Oryza sativa), rye (Secale cereale), sorghum (Sorghum bicolor, Sorghum vulgare), millet (e.g., pearl millet (Pennisetunz glaucum), proso millet (Panicum miliaceunz), foxtail millet (Setaria italica), finger millet (Eleusine coracana), sunflower (Helianthus annuus), safflower (Carthamus tinctorius), wheat (Triticum aestivum, T. Turgidwn ssp. durum), soybean (Glycine max), tobacco (Nicotiana tabacum), potato (Solanum tuberosum), peanuts (Arachis hypogaea), cotton (Gossypium barbadense, Gossypium hirsutum), sweet potato (Ipomoea batatus), cassava (Manihot esculenta), coffee (Coffea spp.), coconut (Cocos nucifera), pineapple (Ananas comosus), citrus trees (Citrus spp.), cocoa (Theobrozna cacao), tea (Camellia sinensis), banana (Musa spp.), avocado (Persea americana), fig (Ficus casica), guava (Psidium guajava), mango (Mangifera indica), olive (Olea europaea), papaya (Carica papaya), cashew (Anacardium occidentale), macadamia (Macadamia integrifolia), almond (Prunus amygdalus), sugar beets (Beta vulgaris), sugarcane (Saccharum spp.), oats, barley, vegetables, ornamentals, and conifers. Preferably, plants of the present invention are crop plants (for example, sunflower, Brassica sp., cotton, sugar, beet, soybean, peanut, alfalfa, safflower, tobacco, corn, rice, wheat, rye, barley triticale, sorghum, millet, etc.).

    [0169] The herbicide resistant plants of the invention find use in methods for controlling weeds. Thus, the present invention further provides a method for controlling weeds in the vicinity of an herbicide-resistant plant of the invention. The method comprises applying an effective amount of an herbicide to the weeds and to the herbicide-resistant plant, wherein the plant has increased resistance to at least one herbicide, particularly an imidazolinone or sulfonylurea herbicide, when compared to a wild-type plant. In such a method for controlling weeds, the herbicide-resistant plants of the invention are preferably crop plants, including, but not limited to, rice, sunflower, alfalfa, Brassica sp., soybean, cotton, safflower, peanut, tobacco, tomato, potato, wheat, maize, sorghum, barley, rye, millet, and sorghum.

    [0170] By providing plants having increased resistance to herbicides, particularly imidazolinone and sulfonylurea herbicides, a wide variety of formulations can be employed for protecting plants from weeds, so as to enhance plant growth and reduce competition for nutrients. an herbicide can be used by itself for pre-emergence, post-emergence, pre-planting and at planting control of weeds in areas surrounding the plants described herein or an imidazolinone herbicide formulation can be used that contains other additives. The herbicide can also be used as a seed treatment. Additives found in an imidazolinone or sulfonylurea herbicide formulation include other herbicides, detergents, adjuvants, spreading agents, sticking agents, stabilizing agents, or the like. The herbicide formulation can be a wet or dry preparation and can include, but is not limited to, flowable powders, emulsifiable concentrates and liquid concentrates. The herbicide and herbicide formulations can be applied in accordance with conventional methods, for example, by spraying, irrigation, dusting, or the like.

    [0171] The present invention provides non-transgenic and transgenic seeds with increased tolerance to at least one herbicide, particularly an AHAS-inhibiting herbicide, more particularly an imidazolinone herbicide. Such seeds include, for example, non-transgenic rice seeds comprising the herbicide-tolerance characteristics of the plant with NCIMB Accession Number NCIMB 41262, and transgenic seeds comprising an IMI nucleic acid molecule of the invention that encodes an IMI protein.

    [0172] The present invention provides methods for producing an herbicide-resistant plant, particularly an herbicide-resistant rice plant, through conventional plant breeding involving sexual reproduction. The methods comprise crossing a first plant that is resistant to an herbicide to a second plant that is not resistant to the herbicide. The first plant can be any of the herbicide resistant plants of the present invention including, for example, transgenic plants comprising at least one of the polynucleotides of the present invention that encode an herbicide resistant IMI protein and non-transgenic rice plants that comprise the herbicide-tolerance characteristics of the rice plant with NCIMB Accession Number NCIMB 41262. The second plant can be any plant that is capable of producing viable progeny plants (i.e., seeds) when crossed with the first plant. Typically, but not necessarily, the first and second plants are of the same species. The methods of the invention can further involve one or more generations of backcrossing the progeny plants of the first cross to a plant of the same line or genotype as either the first or second plant. Alternatively, the progeny of the first cross or any subsequent cross can be crossed to a third plant that is of a different line or genotype than either the first or second plant. The methods of the invention can additionally involve selecting plants that comprise the herbicide tolerance characteristics of the first plant.

    [0173] The present invention further provides methods for increasing the herbicide-resistance of a plant, particularly an herbicide-resistant rice plant, through conventional plant breeding involving sexual reproduction. The methods comprise crossing a first plant that is resistant to an herbicide to a second plant that may or may not be resistant to the herbicide or may be resistant to different herbicide or herbicides than the first plant. The first plant can be any of the herbicide resistant plants of the present invention including, for example, transgenic plants comprising at least one of the IMI nucleic acids of the present invention that encode IMI protein and non-transgenic rice plants that comprise the herbicide-tolerance characteristics of the rice plant with NCIMB Accession Number NCIMB 41262. The second plant can be any plant that is capable of producing viable progeny plants (i.e., seeds) when crossed with the first plant. Typically, but not necessarily, the first and second plants are of the same species. The progeny plants produced by this method of the present invention have increased resistance to an herbicide when compared to either the first or second plant or both. When the first and second plants are resistant to different herbicides, the progeny plants will have the combined herbicide tolerance characteristics of the first and second plants. The methods of the invention can further involve one or more generations of backcrossing the progeny plants of the first cross to a plant of the same line or genotype as either the first or second plant. Alternatively, the progeny of the first cross or any subsequent cross can be crossed to a third plant that is of a different line or genotype than either the first or second plant. The methods of the invention can additionally involve selecting plants that comprise the herbicide tolerance characteristics of the first plant, the second plant, or both the first and the second plant.

    [0174] The plants of the present invention can be transgenic or non-transgenic. An example of a non-transgenic rice plant having increased resistance to imidazolinone is the rice plant PUNTA 16) having NCIMB Accession Number NCIMB 41262; or mutant, recombinant, or a genetically engineered derivative of the plant having NCIMB Accession Number NCIMB 41262; or of any progeny of the plant having NCIMB Accession Number NCIMB 41262; or a plant that is a progeny of any of these plants; or a plant that comprises the herbicide tolerance characteristics of the plant having NCIMB Accession Number NCIMB 41262.

    [0175] The present invention also provides plants, plant organs, plant tissues, plant cells, seeds, and non-human host cells that are transformed with the at least one polynucleotide molecule, expression cassette, or transformation vector of the invention. Such transformed plants, plant organs, plant tissues, plant cells, seeds, and non-human host cells have enhanced tolerance or resistance to at least one herbicide, at levels of the herbicide that kill or inhibit the growth of an untransformed plant, plant tissue, plant cell, or non-human host cell, respectively. Preferably, the transformed plants, plant tissues, plant cells, and seeds of the invention are Arabidopsis thaliana and crop plants.

    [0176] The present invention provides methods that involve the use of at least one AHAS-inhibiting herbicide selected from the group consisting of imidazolinone herbicides, sulfonylurea herbicides, triazolopyrimidine herbicides, pyrimidinyloxybenzoate herbicides, sulfonylamino-carbonyltriazolinone herbicides, and mixtures thereof. In these methods, the AHAS-inhibiting herbicide can be applied by any method known in the art including, but not limited to, seed treatment, soil treatment, and foliar treatment.

    [0177] Prior to application, the AHAS-inhibiting herbicide can be converted into the customary formulations, for example solutions, emulsions, suspensions, dusts, powders, pastes and granules. The use form depends on the particular intended purpose; in each case, it should ensure a fine and even distribution of the compound according to the invention.

    [0178] The formulations are prepared in a known manner (see e.g. for review U.S. Pat. No. 3,060,084, EP-A 707 445 (for liquid concentrates), Browning, Agglomeration, Chemical Engineering, Dec. 4, 1967, 147-48, Perry's Chemical Engineer's Handbook, 4th Ed., McGraw-Hill, New York, 1963, pages 8-57 and et seq. WO 91/13546, U.S. Pat. No. 4,172,714, U.S. Pat. No. 4,144,050, U.S. Pat. No. 3,920,442, U.S. Pat. No. 5,180,587, U.S. Pat. No. 5,232,701, U.S. Pat. No. 5,208,030, GB 2,095,558, U.S. Pat. No. 3,299,566, Klingman, Weed Control as a Science, John Wiley and Sons, Inc., New York, 1961, Hance et al., Weed Control Handbook, 8th Ed., Blackwell Scientific Publications, Oxford, 1989 and Mollet, H., Grubemann, A., Formulation technology, Wiley VCH Verlag GmbH, Weinheim (Germany), 2001, 2 D. A. Knowles, Chemistry and Technology of Agrochemical Formulations, Kluwer Academic Publishers, Dordrecht, 1998 (ISBN 0-7514-0443-8), for example by extending the active compound with auxiliaries suitable for the formulation of agrochemicals, such as solvents and/or carriers, if desired emulsifiers, surfactants and dispersants, preservatives, antifoaming agents, anti-freezing agents, for seed treatment formulation also optionally colorants and/or binders and/or gelling agents.

    [0179] Examples of suitable solvents are water, aromatic solvents (for example Solvesso products, xylene), paraffins (for example mineral oil fractions), alcohols (for example methanol, butanol, pentanol, benzyl alcohol), ketones (for example cyclohexanone, gamma-butyrolactone), pyrrolidones (NMP, NOP), acetates (glycol diacetate), glycols, fatty acid dimethylamides, fatty acids and fatty acid esters. In principle, solvent mixtures may also be used.

    [0180] Examples of suitable carriers are ground natural minerals (for example kaolins, clays, talc, chalk) and ground synthetic minerals (for example highly disperse silica, silicates).

    [0181] Suitable emulsifiers are nonionic and anionic emulsifiers (for example polyoxyethylene fatty alcohol ethers, alkylsulfonates and arylsulfonates).

    [0182] Examples of dispersants are lignin-sulfite waste liquors and methylcellulose.

    [0183] Suitable surfactants used are alkali metal, alkaline earth metal and ammonium salts of lignosulfonic acid, naphthalenesulfonic acid, phenolsulfonic acid, dibutylnaphthalenesulfonic acid, alkylarylsulfonates, alkyl sulfates, alkylsulfonates, fatty alcohol sulfates, fatty acids and sulfated fatty alcohol glycol ethers, furthermore condensates of sulfonated naphthalene and naphthalene derivatives with formaldehyde, condensates of naphthalene or of naphthalenesulfonic acid with phenol and formaldehyde, polyoxyethylene octylphenol ether, ethoxylated isooctylphenol, octylphenol, nonylphenol, alkylphenol polyglycol ethers, tributylphenyl polyglycol ether, tristearylphenyl polyglycol ether, alkylaryl polyether alcohols, alcohol and fatty alcohol ethylene oxide condensates, ethoxylated castor oil, polyoxyethylene alkyl ethers, ethoxylated polyoxypropylene, lauryl alcohol polyglycol ether acetal, sorbitol esters, lignosulfite waste liquors and methylcellulose.

    [0184] Substances which are suitable for the preparation of directly sprayable solutions, emulsions, pastes or oil dispersions are mineral oil fractions of medium to high boiling point, such as kerosene or diesel oil, furthermore coal tar oils and oils of vegetable or animal origin, aliphatic, cyclic and aromatic hydrocarbons, for example toluene, xylene, paraffin, tetrahydronaphthalene, alkylated naphthalenes or their derivatives, methanol, ethanol, propanol, butanol, cyclohexanol, cyclohexanone, isophorone, highly polar solvents, for example dimethyl sulfoxide, N-methylpyrrolidone or water.

    [0185] Also anti-freezing agents such as glycerin, ethylene glycol, propylene glycol and bactericides such as can be added to the formulation.

    [0186] Suitable antifoaming agents are for example antifoaming agents based on silicon or magnesium stearate.

    [0187] Suitable preservatives are for example Dichlorophen and enzylalkoholhemiformal.

    [0188] Seed Treatment formulations may additionally comprise binders and optionally colorants.

    [0189] Binders can be added to improve the adhesion of the active materials on the seeds after treatment. Suitable binders are block copolymers EO/PO surfactants but also polyvinylalcoholsl, polyvinylpyrrolidones, polyacrylates, polymethacrylates, polybutenes, polyisobutylenes, polystyrene, polyethyleneamines, polyethyleneamides, polyethyleneimines (Lupasol, Polymin), polyethers, polyurethans, polyvinylacetate, tylose and copolymers derived from these polymers.

    [0190] Optionally, also colorants can be included in the formulation. Suitable colorants or dyes for seed treatment formulations are Rhodamin B, C.I. Pigment Red 112, C.I. Solvent Red 1, pigment blue 15:4, pigment blue 15:3, pigment blue 15:2, pigment blue 15:1, pigment blue 80, pigment yellow 1, pigment yellow 13, pigment red 112, pigment red 48:2, pigment red 48:1, pigment red 57:1, pigment red 53:1, pigment orange 43, pigment orange 34, pigment orange 5, pigment green 36, pigment green 7, pigment white 6, pigment brown 25, basic violet 10, basic violet 49, acid red 51, acid red 52, acid red 14, acid blue 9, acid yellow 23, basic red 10, basic red 108.

    [0191] An example of a suitable gelling agent is carrageen)(Satiage1).

    [0192] Powders, materials for spreading, and dustable products can be prepared by mixing or concomitantly grinding the active substances with a solid carrier.

    [0193] Granules, for example coated granules, impregnated granules and homogeneous granules, can be prepared by binding the active compounds to solid carriers. Examples of solid carriers are mineral earths such as silica gels, silicates, talc, kaolin, attaclay, limestone, lime, chalk, bole, loess, clay, dolomite, diatomaceous earth, calcium sulfate, magnesium sulfate, magnesium oxide, ground synthetic materials, fertilizers, such as, for example, ammonium sulfate, ammonium phosphate, ammonium nitrate, ureas, and products of vegetable origin, such as cereal meal, tree bark meal, wood meal and nutshell meal, cellulose powders and other solid carriers.

    [0194] In general, the formulations comprise from 0.01 to 95% by weight, preferably from 0.1 to 90% by weight, of the AHAS-inhibiting herbicide. In this case, the AHAS-inhibiting herbicides are employed in a purity of from 90% to 100% by weight, preferably 95% to 100% by weight (according to NMR spectrum). For seed treatment purposes, respective formulations can be diluted 2-10 fold leading to concentrations in the ready to use preparations of 0.01 to 60% by weight active compound by weight, preferably 0.1 to 40% by weight.

    [0195] The AHAS-inhibiting herbicide can be used as such, in the form of their formulations or the use forms prepared therefrom, for example in the form of directly sprayable solutions, powders, suspensions or dispersions, emulsions, oil dispersions, pastes, dustable products, materials for spreading, or granules, by means of spraying, atomizing, dusting, spreading or pouring. The use forms depend entirely on the intended purposes; they are intended to ensure in each case the finest possible distribution of the AHAS-inhibiting herbicide according to the invention.

    [0196] Aqueous use forms can be prepared from emulsion concentrates, pastes or wettable powders (sprayable powders, oil dispersions) by adding water. To prepare emulsions, pastes or oil dispersions, the substances, as such or dissolved in an oil or solvent, can be homogenized in water by means of a wetter, tackifier, dispersant or emulsifier. However, it is also possible to prepare concentrates composed of active substance, wetter, tackifier, dispersant or emulsifier and, if appropriate, solvent or oil, and such concentrates are suitable for dilution with water.

    [0197] The active compound concentrations in the ready-to-use preparations can be varied within relatively wide ranges. In general, they are from 0.0001 to 10%, preferably from 0.01 to 1% per weight.

    [0198] The AHAS-inhibiting herbicide may also be used successfully in the ultra-low-volume process (ULV), it being possible to apply formulations comprising over 95% by weight of active compound, or even to apply the active compound without additives.

    [0199] The following are examples of formulations:

    [0200] 1. Products for dilution with water for foliar applications. For seed treatment purposes, such products may be applied to the seed diluted or undiluted.

    [0201] A) Water-soluble concentrates (SL, LS)

    [0202] Ten parts by weight of the AHAS-inhibiting herbicide are dissolved in 90 parts by weight of water or a water-soluble solvent. As an alternative, wetters or other auxiliaries are added. The AHAS-inhibiting herbicide dissolves upon dilution with water, whereby a formulation with 10% (w/w) of AHAS-inhibiting herbicide is obtained.

    [0203] B) Dispersible concentrates (DC)

    [0204] Twenty parts by weight of the AHAS-inhibiting herbicide are dissolved in 70 parts by weight of cyclohexanone with addition of 10 parts by weight of a dispersant, for example polyvinylpyrrolidone. Dilution with water gives a dispersion, whereby a formulation with 20% (w/w) of AHAS-inhibiting herbicide is obtained.

    [0205] C) Emulsifiable concentrates (EC)

    [0206] Fifteen parts by weight of the AHAS-inhibiting herbicide are dissolved in 7 parts by weight of xylene with addition of calcium dodecylbenzenesulfonate and castor oil ethoxylate (in each case 5 parts by weight). Dilution with water gives an emulsion, whereby a formulation with 15% (w/w) of AHAS-inhibiting herbicide is obtained.

    [0207] D) Emulsions (EW, EO, ES)

    [0208] Twenty-five parts by weight of the AHAS-inhibiting herbicide are dissolved in 35 parts by weight of xylene with addition of calcium dodecylbenzenesulfonate and castor oil ethoxylate (in each case 5 parts by weight). This mixture is introduced into 30 parts by weight of water by means of an emulsifier machine (e.g. Ultraturrax) and made into a homogeneous emulsion. Dilution with water gives an emulsion, whereby a formulation with 25% (w/w) of AHAS-inhibiting herbicide is obtained.

    [0209] E) Suspensions (SC, OD, FS)

    [0210] In an agitated ball mill, 20 parts by weight of the AHAS-inhibiting herbicide are comminuted with addition of 10 parts by weight of dispersants, wetters and 70 parts by weight of water or of an organic solvent to give a fine AHAS-inhibiting herbicide suspension. Dilution with water gives a stable suspension of the AHAS-inhibiting herbicide, whereby a formulation with 20% (w/w) of AHAS-inhibiting herbicide is obtained.

    [0211] F) Water-dispersible granules and water-soluble granules (WG, SG)

    [0212] Fifty parts by weight of the AHAS-inhibiting herbicide are ground finely with addition of 50 parts by weight of dispersants and wetters and made as water-dispersible or water-soluble granules by means of technical appliances (for example extrusion, spray tower, fluidized bed). Dilution with water gives a stable dispersion or solution of the AHAS-inhibiting herbicide, whereby a formulation with 50% (w/w) of AHAS-inhibiting herbicide is obtained.

    [0213] G) Water-dispersible powders and water-soluble powders (WP, SP, SS, WS)

    [0214] Seventy-five parts by weight of the AHAS-inhibiting herbicide are ground in a rotor-stator mill with addition of 25 parts by weight of dispersants, wetters and silica gel. Dilution with water gives a stable dispersion or solution of the AHAS-inhibiting herbicide, whereby a formulation with 75% (w/w) of AHAS-inhibiting herbicide is obtained.

    [0215] I) Gel-Formulation (GF)

    [0216] In an agitated ball mill, 20 parts by weight of the AHAS-inhibiting herbicide are comminuted with addition of 10 parts by weight of dispersants, 1 part by weight of a gelling agent wetters and 70 parts by weight of water or of an organic solvent to give a fine AHAS-inhibiting herbicide suspension. Dilution with water gives a stable suspension of the AHAS-inhibiting herbicide, whereby a formulation with 20% (w/w) of AHAS-inhibiting herbicide is obtained. This gel formulation is suitable for us as a seed treatment.

    [0217] 2. Products to be applied undiluted for foliar applications. For seed treatment purposes, such products may be applied to the seed diluted.

    [0218] A) Dustable powders (DP, DS)

    [0219] Five parts by weight of the AHAS-inhibiting herbicide are ground finely and mixed intimately with 95 parts by weight of finely divided kaolin. This gives a dustable product having 5% (w/w) of AHAS-inhibiting herbicide.

    [0220] B) Granules (GR, FG, GG, MG)

    [0221] One-half part by weight of the AHAS-inhibiting herbicide is ground finely and associated with 95.5 parts by weight of carriers, whereby a formulation with 0.5% (w/w) of AHAS-inhibiting herbicide is obtained. Current methods are extrusion, spray-drying or the fluidized bed. This gives granules to be applied undiluted for foliar use.

    [0222] Conventional seed treatment formulations include for example flowable concentrates FS, solutions LS, powders for dry treatment DS, water dispersible powders for slurry treatment WS, water-soluble powders SS and emulsion ES and EC and gel formulation GF. These formulations can be applied to the seed diluted or undiluted. Application to the seeds is carried out before sowing, either directly on the seeds.

    [0223] In a preferred embodiment, a FS formulation is used for seed treatment. Typcially, a FS formulation may comprise 1-800 g/l of active ingredient, 1-200 g/l Surfactant, 0 to 200 g/l antifreezing agent, 0 to 400 g/l of binder, 0 to 200 g/l of a pigment and up to 1 liter of a solvent, preferably water.

    [0224] The present invention also provides non-transgenic and transgenic seeds of the herbicide-resistant plants. Such seeds include, for example, non-transgenic rice seeds comprising the herbicide-tolerance characteristics of the plant with NCIMB Accession Number NCIMB 41262, and transgenic seeds comprising a polynucleotide molecule of the invention that encodes an IMI protein.

    [0225] For seed treatment, seeds of the herbicide resistant plants according of the present invention are treated with herbicides, preferably herbicides selected from the group consisting of AHAS-inhibiting herbicides such as, amidosulfuron, azimsulfuron, bensulfuron, bensulfuron methyl, chlorimuron, chlorimuron ethyl, chlorsulfuron, cyclosulfuron, cinosulfuron, cyclosulfamuron, ethametsulfuron, ethametsulfuron methyl, ethoxysulfuron, flazasulfuron, flupyrsulfuron, flupyrsulfuron methyl, flupyrsulfuron-methyl-sodium, foramsulfuron, halosulfuron, imazosulfuron, iodosulfuron, mesosulfuron, mesosulfuron-methyl, metsulfuron, metsulfuron methyl, nicosulfuron, primisulfuron, primisulfuron methyl, prosulfuron, pyrazosulfuron, pyrazosulfuron ethyl, rimsulfuron, sulfometuron, sulfometuron methyl, sulfometuron 3-oxetanyl ester (a/k/a oxasulfuron), sulfosulfuron, thifensulfuron, thifensulfuron methyl, triasulfuron, tribenuron, tribenuron methyl, trifloxysulfuron, triflusulfuron, triflusulfuron methyl, tritosulfuron, imazamethabenz, imazamox, imazapic, imazapyr, imazaquin, imazethapyr, cloransulam, diclosulam, florasulam, flumetsulam, metosulam, penoxsulam, bispyribac, pyriminobac, propoxycarbazone, flucarbazone, pyribenzoxim, pyriftalid, pyrithiobac, and mixtures thereof, or with a formulation comprising a AHAS-inhibiting herbicide.

    [0226] The term seed treatment comprises all suitable seed treatment techniques known in the art, such as seed dressing, seed coating, seed dusting, seed soaking, and seed pelleting.

    [0227] In accordance with one variant of the present invention, a further subject of the invention is a method of treating soil by the application, in particular into the seed drill: either of a granular formulation containing the AHAS-inhibiting herbicide as a composition/formulation (e.g. a granular formulation, with optionally one or more solid or liquid, agriculturally acceptable carriers and/or optionally with one or more agriculturally acceptable surfactants. This method is advantageously employed, for example, in seedbeds of cereals, maize, cotton, and sunflower.

    [0228] The present invention also comprises seeds coated with or containing with a seed treatment formulation comprising at least one AHAS-inhibiting herbicide selected from the group consisting of amidosulfuron, azimsulfuron, bensulfuron, bensulfuron methyl, chlorimuron, chlorimuron ethyl, chlorsulfuron, cyclosulfuron, cinosulfuron, cyclosulfamuron, ethametsulfuron, ethametsulfuron methyl, ethoxysulfuron, flazasulfuron, flupyrsulfuron, flupyrsulfuron methyl, flupyrsulfuron-methyl-sodium, foramsulfuron, halo sulfuron, imazosulfuron, iodosulfuron, mesosulfuron, mesosulfuron-methyl, metsulfuron, metsulfuron methyl, nicosulfuron, primisulfuron, primisulfuron methyl, prosulfuron, pyrazosulfuron, pyrazosulfuron ethyl, rimsulfuron, sulfometuron, sulfometuron methyl, sulfometuron 3-oxetanyl ester (a/k/a oxasulfuron), sulfosulfuron, thifensulfuron, thifensulfuron methyl, triasulfuron, tribenuron, tribenuron methyl, trifloxysulfuron, triflusulfuron, triflusulfuron methyl, tritosulfuron, imazamethabenz, imazamox, imazapic, imazapyr, imazaquin, imazethapyr, cloransulam, diclosulam, florasulam, flumetsulam, metosulam, penoxsulam, bispyribac, pyriminobac, propoxycarbazone, flucarbazone, pyribenzoxim, pyriftalid, pyrithiobac.

    [0229] The term seed embraces seeds and plant propagules of all kinds including but not limited to true seeds, seed pieces, suckers, corms, bulbs, fruit, tubers, grains, cuttings, cut shoots and the like and means in a preferred embodiment true seeds.

    [0230] The term coated with and/or containing generally signifies that the active ingredient is for the most part on the surface of the propagation product at the time of application, although a greater or lesser part of the ingredient may penetrate into the propagation product, depending on the method of application. When the said propagation product is (re)planted, it may absorb the active ingredient.

    [0231] The seed treatment application with the AHAS-inhibiting herbicide or with a formulation comprising the AHAS-inhibiting herbicide is carried out by spraying or dusting the seeds before sowing of the plants and before emergence of the plants.

    [0232] In the treatment of seeds, the corresponding formulations are applied by treating the seeds with an effective amount of the AHAS-inhibiting herbicide or a formulation comprising the AHAS-inhibiting herbicide. Herein, the application rates are generally from 0.1 g to 10 kg of the a.i. (or of the mixture of a.i. or of the formulation) per 100 kg of seed, preferably from 1 g to 5 kg per 100 kg of seed, in particular from 1 g to 2.5 kg per 100 kg of seed. For specific crops such as lettuce the rate can be higher.

    [0233] Table 1 provides treatment rates of several non-selective sulfonylurea herbicides when used in connection with controlling weeds in a rice crop. The parenthetical values in Table 1 are reported values, i.e., as commonly used approximate application rates, including in other cereal crops. A given use rate can, in practice, be substituted with an approximate rate, especially in the case of fractional rates. For example, a 1 rate for sulfometuron can be applied by treatment using 26.25, 26, or 27 g AI/ha.

    TABLE-US-00010 TABLE 1 Non-Selective Sulfonylurea Herbicide Rates for Use in Rice (g AI/ha) AI 1x 2x 3x 4x Chlorsulfuron 8.75 17.5 26.25 35 (8.8, 9) (18) (25, 26) (36) Flazasulfuron 25 50 75 100 Flucetosulfuron 10 20 30 40 Flupyrsulfuron 10 20 30 40 Foramsulfuron 35 70 105 140 Mesosulfuron 7.5 15 22.5 30 (8, 9, 9.9, 10) (18, 20) (24, 27, 30) (36, 40) Nicosulfuron 17.5 35 52.5 70 (18) (53, 54) Primisulfuron 20 40 60 80 Rimsulfuron 5 10 15 20 Sulfometuron 26.25 52.5 78.75 105 (26, 27, 30) (53) (79, 80) Sulfosulfuron 10 20 30 40

    [0234] Herbicides compositions comprising a blend of these AIs can be given a weighted average based on proportional amounts or concentrations to determine an applicable 1 rate for the AI blend. Further, if one of these SU AIs were combined with a different AI, then an effective rate for the SU AI could be below 1.

    [0235] The present invention provides a method for combating undesired vegetation or controlling weeds comprising contacting the seeds of the resistant plants according to the present invention before sowing and/or after pregermination with an AHAS-inhibiting herbicide. The method can further comprise sowing the seeds, for example, in soil in a field or in a potting medium in greenhouse. The method finds particular use in combating undesired vegetation or controlling weeds in the immediate vicinity of the seed.

    [0236] The control of undesired vegetation is understood as meaning the killing of weeds and/or otherwise retarding or inhibiting the normal growth of the weeds. Weeds, in the broadest sense, are understood as meaning all those plants which grow in locations where they are undesired.

    [0237] The weeds of the present invention include, for example, dicotyledonous and monocotyledonous weeds. Dicotyledonous weeds include, but are not limited to, weeds of the genera: Sinapis, Lepidium, Galium, Stellaria, Matricaria, Anthemis, Galinsoga, Chenopodium, Urtica, Senecio, Amaranthus, Portulaca, Xanthium, Convolvulus, Ipomoea, Polygonum, Sesbania, Ambrosia, Cirsium, Carduus, Sonchus, Solanum, Rorippa, Rotala, Lindernia, Lamium, Veronica, Abutilon, Emex, Datura, Viola, Galeopsis, Papaver, Centaurea, Trifolium, Ranunculus, and Taraxacum. Monocotyledonous weeds include, but are not limited to, weeds of the genera: Echinochloa, Setaria, Panicum, Digitaria, Phleum, Poa, Festuca, Eleusine, Brachiaria, Lolium, Bromus, Avena, Cyperus, Sorghum, Agropyron, Cynodon, Monochoria, Fimbristyslis, Sagittaria, Eleocharis, Scirpus, Paspalum, Ischaemum, Sphenoclea, Dactyloctenium, Agrostis, Alopecurus, and Apera.

    [0238] In addition, the weeds of the present invention can include, for example, crop plants that are growing in an undesired location. For example, a volunteer maize plant that is in a field that predominantly comprises soybean plants can be considered a weed, if the maize plant is undesired in the field of soybean plants.

    [0239] The present invention further provides methods for treating rice. For example, in one embodiment, the method comprises providing a rice crop plant and at least one sulfonylurea herbicide; applying an effective amount of the at least one sulfonylurea herbicide to the rice crop plant, post-emergence; thereby creating a treated rice plant; and growing the resulting treated rice plant. In another embodiment, the method for treating rice comprises: providing a rice crop plant and at least one sulfonyl carboxamide herbicide; applying an effective amount of the at least one sulfonyl carbetamide herbicide to the rice crop plant, post-emergence; thereby creating a treated rice plant; and growing the resulting treated rice plant.

    [0240] The methods may further comprise harvesting seed from the treated rice plant.

    [0241] The sulfonylurea herbicide of the methods comprises one or more of cyclosulfamuron, chlorsulfuron, metsulfuron, metsulfuron methyl, chlorimuron, chlorimuron ethyl, thifensulfuron, thifensulfuron methyl, tribenuron, tribenuron methyl, bensulfuron, bensulfuron methyl, nicosulfuron, ethametsulfuron, ethametsulfuron methyl, rimsulfuron, triflusulfuron, triflusulfuron methyl, triasulfuron, primisulfuron, primisulfuron methyl, cinosulfuron, amidosulfuron, flazasulfuron, imazosulfuron, pyrazosulfuron, pyrazosulfuron ethyl, halosulfuron, azimsulfuron, cyclosulfuron, ethoxysulfuron, flupyrsulfuron, flupyrsulfuron methyl, flupyrsulfuron-methyl-sodium, foramsulfuron, iodosulfuron, sulfometuron, sulfometuron methyl, sulfometuron 3-oxetanyl ester or oxasulfuron, mesosulfuron, mesosulfuron-methyl, prosulfuron, sulfosulfuron, trifloxysulfuron, tritosulfuron, or a derivative thereof. In one embodiment, the sulfonylurea herbicide is a mesosulfuron.

    [0242] In certain embodiments, the method for treating rice further comprises applying one or more of an imidazolinone herbicide, a sulfonylurea herbicide, a triazolopyrimidine herbicide, a pyrimidinyloxybenzoate herbicide, and a sulfonylaminocarbonyltriazolinone herbicide. In one embodiment, the imidazolinone herbicide comprises one or more of imazethapyr, imazapic, imazamox, imazaquin, imazethabenz, and imazapyr. In one embodiment, the imidazolinone herbicide comprises one or more of 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-nicotinic acid, 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-3-quinolinecarboxylic acid, 5-ethyl-2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-nicotinic acid, 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-5-(methoxymethyl)-nicotinic acid, 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-5-methylnicotinic acid, mixtures of methyl 6-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-m-toluate, and methyl 2-(4-isopropyl-4-methyl-5-oxo-2-imidazolin-2-yl)-p-toluate. In one embodiment, the triazolopyrimidine herbicide comprises one or more of cloransulam, diclosulam, florasulam, flumetsulam, metosulam, and penoxsulam. In one embodiment, the pyrimidinyloxybenzoate herbicide comprises one or more of bispyribac, pyrithiobac, pyriminobac, pyribenzoxim and pyriftalid. In one embodiment, the sulfonylamino-carbonyltriazolinone herbicide comprises one or more of flucarbazone and propoxycarbazone.

    [0243] Further, the herbicide used in the methods for treating rice can be sulfonyl carboxamide derivatives and their physiologically acceptable salts and physiologically functional derivatives. In one embodiment, the sulfonyl carboxamide herbicide is 2-acetamido-2,3-dimethyl-N-(p-tolylsulfonyl)-butyramide.

    [0244] The rice crop plants encompassed in the present invention have increased resistance to herbicides when compared to a wild-type rice plant. For example, the rice crop plant comprises an acetohydroxyacid synthase large subunit (AHASL) polynucleotide encoding a herbicide-tolerant AHASL polypeptide comprising a leucine substitution at a position corresponding to position 171 of SEQ ID NO:26. In one embodiment, wherein the rice crop plant comprises an AHASL polypeptide comprising a leucine substitution at the position corresponding to position 171 of SEQ ID NO:26. In one embodiment, the rice crop plant comprises the herbicide tolerance characteristics of a plant of line IMINTA 15. In certain embodiments, the rice crop plant of method is (a) a plant of line IMINTA 15; (b) a plant of line IMINTA 15; (c) a mutant or recombinant plant of line IMINTA 15; or (d) a progeny of any one of the plants of (a) to (c).

    [0245] The articles a and an are used herein to refer to one or more than one (i.e., to at least one) of the grammatical object of the article. By way of example, an element means one or more elements.

    [0246] As used herein, the word comprising, or variations such as comprises or comprising, will be understood to imply the inclusion of a stated element, integer or step, or group of elements, integers or steps, but not the exclusion of any other element, integer or step, or group of elements, integers or steps.

    [0247] The following examples are offered by way of illustration and not by way of limitation.

    Example 1: Production of an Imidazolinone-Resistant Rice Line

    [0248] AHASL is a nuclear encoded enzyme and its gene, in different species, has been sequenced in its wild form and other forms showing sites of mutation that confer resistance to sulfonylurea and imidazolinone herbicides. In order to produce rice plants with herbicide-resistant AHAS enzymes, rice seeds were treated with a chemical mutagen in an attempt to induce small changes at the active site of interaction with the herbicide in order to prevent inhibition. Leading rice varieties and elite rice lines were selected in order to generate a new mutation that is resistant to the most active imidazolinones in excellent germplasm. Selection pressure was based on exposure of four-leaf stage plants to two of the most active imidazolinone herbicides applied in one application during several generations until homozygous highly resistant lines were obtained. The imidazolinone-resistance rice lines were produced as described below.

    [0249] In the late spring of growing season number 1, two samples of seeds (600 g each) of the rice cultivar IRGA 417 were treated with a 0.001 M sodium azide aqueous solution at pH 3 (phosphate buffer 0.067M). This treatment was applied by soaking each seed-sample in a two-liter Erlenmeyer containing one liter of the sodium azide solution, under constant shaking, for 18 hours, at room temperature. After treatment, the seeds were rinsed in tap water and, later on, they were partially dried-aerated on blotting paper sheets in order to extract the moisture from the seeds surface. Afterwards, treated seeds were directly sown at the field nursery in Concepcion del Uruguay, E.R., Argentina.

    [0250] Treated (M.sub.1) and untreated control seeds of the rice cultivar IRGA 417 were planting in the field nursery a rate of 50 plants per square meter. The plants were grown under flooded conditions until maturity (26% grain moisture) and bulk harvested. Seeds (M.sub.2) of the plants were collected and dried in a convector drier for 14 h at 45 C. They were kept in close storage until next growing season.

    [0251] In the late spring of growing season number 2, M.sub.2 seeds were planted with an experimental seed planter for large areas at a rate of 50 kg/ha in at the field nursery in Concepcion del Uruguay, E.R., Argentina. An area of 3 ha was established comprising a population of approximately 610.sup.6 M.sub.2 plants. IRGA 417 (wild type) was also planted as a control. The entire area was subjected to a selection pressure with a mixture of two imidazolinone herbicides. Three separate applications were done with a commercial sprayer in different directions to prevent any escape and resulting in a 3 treatment. A total volume of 222 L/ha was sprayed at 50 psi, with Teejets 8002 nozzles, in each application. The rate of the 1 treatment was a mixture of Arsenal (Imazapir 75 cc a.i/ha) and Cadre (Imazapic 24.85 cc a.i/ha) in a water solution with a non-ionic surfactant (Citowett) at the rate of 0.25%. The applications were done at the four leaf-stage of the rice plants. No rainfall was registered during the 7 days after treatments.

    [0252] Observations at regular times were done to survey the entire herbicide-treated area. At 90 days after the herbicide treatment, the surviving individuals were labeled and transplanted to the greenhouse for asexual multiplication and seed production. A total of 10 individual plants were grown, and the seed was harvested and dried in a seed incubator for 7 days at 50 C. As expected, none of the control plants (IRGA 417) survived the herbicide treatment.

    [0253] Seeds (M.sub.3) from selected M.sub.2 plants were planted in individual pots under greenhouse conditions in Concepcion del Uruguay, E.R., Argentina during the winter immediately following the second season. A 2 treatment was applied with a backpack sprayer divided in two applications of a 1 rate of Arsenal (Imazapir 75 cc a.i/ha) and Cadre (Imazapic 24.85 cc a.i/ha) in a water solution with a non-ionic surfactant (Citowet) at the rate of 0.25%.

    [0254] Tillers from the herbicide-tolerant plants (e.g., plants that survived herbicide treatments) were grown until maturity (26% grain moisture) and hand harvested. The harvested seed (M.sub.4) was subjected to a dormancy breaking treatment of 7 days at 50 C. and prepared for the next growing season planting. Seeds from two herbicide-tolerant plants were kept separately. The seeds from were prepared for a late-season planting outdoors at Concepcion del Uruguay, E.R., Argentina.

    [0255] In the summer of growing season number 3, M.sub.4 seeds of an herbicide-tolerant M.sub.3 plant that was designated as IMINTA 16 were planted with at the rate of 50 kg/ha. A treatment of 2 of imidazolinone herbicides was applied at the four to five leaves stage of the rice plants as two applications of a 1 rate of Arsenal (Imazapir 75 cc a.i/ha) and Cadre (Imazapic 24.85 cc a.i/ha) in a water solution with a non-ionic surfactant (Citowet) at the rate of 0.25%. No phytotoxic symptoms were observed for plants of the IMINTA 16 line. No wild-type segregants (i.e., not tolerant to the herbicide treatment) were observed, and a highly homogenous population in agronomic and tolerance traits had been produced. Individual IMINTA 16 plants were transplanted into the greenhouse for seed production, and seeds (M.sub.5) were harvested later that year.

    Example 2: An Imidazoline-Resistant Rice Line with a Mutation in the AHASL1 Gene

    [0256] Genomic DNA was separately extracted from leaves of greenhouse-grown seedlings of the IMINTA 16 line described in Example 1 above and the AHASL1 gene was amplified by a polymerase chain reaction (PCR) method using the primers described below. The resulting products of the individual PCR amplifications were sequenced using standard methods. The primers used for PCR and sequencing are provided in Table 2. The primers were selected manually by visual inspection of the publicly known rice sequences for Oryza sativa Kinmaze, Oryza sativa japonica and Oryza sativa indica. The primers were nested approximately every 400-500 bp along the approximately 2000 bp of the AHAS gene. Several primers were designed for each 500 bp stretch to maximize the likelihood of success of amplification. No weight was given to conserved regions when choosing primers. The primer sequences were checked for hairpins and dimers via the website wwvv.mature.comioligonucleotide.html. Because there are no introns present in the AHASL1 gene, the entire gene represents coding sequence, and is therefore conserved. Primers were designed to have a GC content close to 50% and similar melting temperatures, approximately 54-58 C. The primer names in Table 2 reflect the exact starting base position according to public AHASL1 nucleotide sequences for rice (e.g., GenBank Accession No. AB049822). U136851 refers to a region upstream of the start codon in the AHAS gene and was designed from a BAC clone (OSJNBa0053B21), accession No. AL731599.

    TABLE-US-00011 TABLE2 PrimersforPCRAmplificationandDNASequencing oftheRiceAHASL1GeneinIMINTA16 Primer MeltingTemp. GCcontent Name Sequence5 to3 ( C.) (%) Pair1 U136851 GACATATGGGGCCCACTGT(SEQIDNO.4) 58.8 58 L789 GTAGATTCATCGAGGTGTC(SEQIDNO.5) 54.5 47.4 Pair2 U642* GTCCTTGATGTGGAGGACAT(SEQIDNO.6) 57.3 50 L1369 CATATTGCGGTGGGATCTCT(SEQIDNO.7) 57.3 50 Pair3 U1229 GGGCTTGAATGCTCTGCTAC(SEQIDNO.8) 59.4 55 L1742 CGGGTTGCCCAAGTATGTAT(SEQIDNO.9) 57.3 50 Pair4 U1633 ACCTCCCTGTGAAGGTGATG(SEQIDNO:10) 59.4 55 L2155* AGGATTACCATGCCAAGCAC(SEQIDNO:11) 57.3 50 AlternatePCRprimersandsequencingprimers U037 CACCACCCACCATGGCTA(SEQIDNO.12) 58.2 61.1 U114 GTAAGAACCACCAGCGAC(SEQIDNO.13) 56 55.6 U1109 GTGGATAAGGCTGACCTGT(SEQIDNO.14) 56.7 52.6 U1166 GGGAAAATTGAGGCTTTTGCA(SEQIDNO:15) 55.9 42.9 L1299 CTCATTGTGCCATGCACTAA(SEQIDNO.16) 55.3 45 U1721 GCATACATACTTGGGCAAC(SEQIDNO.17) 54 47 L2054 CATACCACTCTTTATGGGTC(SEQIDNO.18) 52 45 *Also used U642 and L2155 as a PCR pair.

    [0257] When the PCR-amplified genomic DNA from the IMINTA 16 seedlings was examined, a single base change (i.e., transition, C to T) was identified in the coding region of the gene that caused an amino acid substitution in the AHASL1 protein at amino acid position 179 from Ala in the wild type line to Val in the IMINTA 16 line. The site of this substitution corresponds to position 205 in the Arabidopsis thaliana AHASL protein (see, Table 3 below). The Ala205Val substitution in the Arabidopsis thaliana AHASL protein is known to confer on plants that express this protein tolerance to imidazolinone herbicides.

    Example 3: Herbicide-Resistant Rice AHASL1 Proteins

    [0258] The present invention discloses both the nucleotide and amino acid sequences for herbicide resistant rice AHASL1 polypeptides. Plants comprising herbicide-resistant AHASL1 polypeptides have been previously identified, and a number of conserved regions of AHASL1 polypeptides that are the sites of amino acids substitutions that confer herbicide resistance have been described. See, Devine and Eberlein (1997) Physiological, biochemical and molecular aspects of herbicide resistance based on altered target sites. In: Herbicide Activity: Toxicology, Biochemistry and Molecular Biology, Roe et al. (eds.), pp. 159-185, IOS Press, Amsterdam; and Devine and Shukla, (2000) Crop Protection 19:881-889.

    [0259] Using the AHASL1 polynucleotide molecules of the invention and methods known to those of ordinary skill in art, one can produce additional polynucleotide molecules encoding herbicide resistant AHASL1 polypeptides having one, two, three, or more amino acid substitutions at the identified sites in these conserved regions. Table 3 provides the conserved regions of AHASL1 proteins, the amino acid substitutions known to confer herbicide resistance within these conserved regions, and the corresponding amino acids in the rice AHASL1 protein set forth in SEQ ID NO. 2.

    TABLE-US-00012 TABLE3 AminoAcidSubstitutionsinConservedRegionsof AHASLPolypeptidesthatareKnowntoConferHerbicide-Resistance andtheirEquivalentPositioninRiceAHASL1Polypeptides Aminoacid Conservedregion.sup.1 Mutation.sup.2 Reference positioninrice VFAYPGGASMEIHQALTRS.sup.3 Ala.sup.122toThr Bernasconietal..sup.4 Ala.sup.96 (SEQIDNO:19) AITGQVPRRMIGT.sup.3 Pro.sub.197toAla Boutsalisetal..sup.5 Pro.sub.171.sup.12 (SEQIDNO:20) Pro.sub.197toThr Guttierietal..sup.6 Pro.sub.197toHis Guttierietal..sup.7 Pro.sub.197toLeu Guttierietal..sup.6 Pro.sub.197toArg Guttierietal..sup.6 Pro.sub.197toIle Boutsalisetal..sup.6 Pro.sub.197toGln Guttierietal..sup.6 Pro.sub.197toSer Guttierietal..sup.6 AFQEPT.sup.3 Ala.sub.205toAsp Hartnettetal..sup.8 Ala.sub.179.sup.13 (SEQIDNO:21) Ala.sub.205toVal.sup.11 Simpson.sup.9 QWED.sup.3 Trp574toLeu Bruniard.sup.10 Trp.sup.548 (SEQIDNO:22) Boutsalisetal..sup.5 IPSGG.sup.3 Ser.sup.653toAsn Chang&Dubbleby.sup.12 Ser.sub.627 (SEQIDNO:23) Ser.sup.653toThr Leeetal..sup.13 Ser.sup.653toPhe .sup.1Concerved regions from Devine and Eberlein (1997) Physiological, biochemical and molecular aspects of herbicide resistance based on altered target sites. In: Herbicide Activity: Toxicology, Biochemistry and Molecular Biology, Roe et al. (eds.), pp. 159-185, IOS Press, Amsterdam and Devine and Shukla, (2000) Crop Protection 19: 881-889. .sup.2Amino acid numbering corresponds to the amino acid sequence of the Arabidopsis thaliana AHASLS polypeptide. .sup.3The rice AHASL1 protein of the invention (SEQ ID NO. 2) has the same conserved regions. .sup.4Bernasconi et al. (1995) J. Biol. Chem. 270(29): 17381-17385. .sup.5Boutsalis et al. (1999) Pestic. Sci. 55: 507-516. .sup.6Guttieri et al. (1995) Weed Sci. 43: 143-178. .sup.7Guttieri et al. (1992) Weed Sci. 40: 670-678. .sup.8Hartnett et al. (1990) Herbicide-resistant plants carrying mutated acetolactate synthase genes, In: Managing Resistance to Argochemicals: Fundamental Research to Practical Strategies, Green et al. (eds.), American Chemical Soc. Symp., Series No. 421, Washington, DC, USA .sup.9Simpson (1998) Down to Earth 53(1): 26-35. .sup.10Bruniard (2001) Inheritance of imidazolinone resistance, characterization of cross-resistance pattern, and identificaiton of molecular markers in sunflower (Helianthus annuus L.). Ph.D. Thesis, North Dakota State University, Fargo, ND, USA, pp 1-78. .sup.11The present invention discloses the amino acid sequence of an herbicide-resistant rice AHASL1 protein with the Ala179 to Val substitution (SEQ ID NO. 2) and a polynucleotide sequences encoding this herbicide resistant AHASL1 (SEQ ID NOS: 1 and 3). .sup.12Chang and Duggleby (1998) Biochem J. 333: 765-777. .sup.13Lee et al. (1999) FEBS Lett. 452: 341-345.

    Example 4: Tolerance to AHAS-inhibiting Herbicides Provided by IMINTA 15 in Comparison to Don Juan

    [0260] A trial was performed comparing the tolerance of IMINTA 15 to a wild-type rice variety, cv. Don Juan, which is the parent to line IMINTA 15. Wild-type and IMINTA 15 rice seed was dehulled, surface sterilized, and germinated in vitro, followed by transplanting to sterile soil in flats. Plants were then grown to the 3- to 5-leaf stage.

    [0261] Twelve days after transplanting, multiplicate wild-type and IMINTA 15 rice plants were sprayed with NewPath (imazethapyr herbicide) treatments. NewPath contains 2 pounds of AI per gallon. The herbicide treatments comprised NewPath plus 1% v/v crop oil concentrate (COC, an adjuvant). COC contains 85% mineral oil and 15% of emulsifier (a blend of polyol fatty acid esters and polyoxyalkylated fatty acid esters: C16-C18). Spray applications were made at the 0, 1, 2, and 4 herbicide treatment rates.

    [0262] Twenty-one days after treatment (dat), the plants were scored for phytotoxicity on a scale of 0 to 9, i.e. from zero injury to whole-plant necrosis. The results are shown in Table 4.

    TABLE-US-00013 TABLE 4 Phytotoxicity Results (21 dat) NewPath Imazethapyr Phytotox Score (out of 9) Rate oz/ac g/ha Wild-Type IMINTA 15 0 0 0.0 0.0 0.3 0.6 1x 6 105 5.2 1.0 0.3 0.5 2x 12 210 6.3 0.5 0.3 0.5 4x 24 420 6.5 0.5 0.7 0.8

    [0263] Imidazolinone tolerance of IMINTA 15 (AHAS-P197L rice) and wild-type rice is shown in FIG. 4. Twenty-one days after treatment, the AHAS-P197L rice showed 100% tolerance to imidazolinone at the 0, 1, and 2 herbicide treatment rates and greater 90% tolerance to imidazolinone at the 4 herbicide treatment rate. In contrast, the wild-type rice showed remarkably lower tolerance to imidazolinone. Specifically, the wild-type rice showed about 40% tolerance to imidazolinone at the 1 herbicide treatment rate, which decreased to about 30% at the 2 and 4 herbicide treatment rates.

    Example 5: Tolerance to AHAS-inhibiting Herbicides Provided by IMINTA 15 in Comparison to IRGA417

    [0264] A trial was also performed comparing the tolerance of IMINTA 15 to the IRGA417 plant, which has the S. American Indica AHAS subtype, using the same conditions provided in Example 4 above. As shown in FIG. 5, three weeks after treatment (wat), IMINTA 15 showed much less phytotoxicity than the IRGA417 plant. In particular, three weeks after whole plant spray with 1, 2, or 4 of imazethapyr, the IRGA417 plant exhibited a phytotoxicity score of approximately 7, 7, or 9, respectively. In contrast, IMINTA 15 had a phytotoxicity score of approximately 1 at 1 and 2 of imazethapyr treatment rates, and a phytotoxicity score of approximately 5 at 4 of imazethapyr treatment rate.

    [0265] All publications and patent applications mentioned in the specification are indicative of the level of those skilled in the art to which this invention pertains. All publications and patent applications are herein incorporated by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.

    [0266] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be obvious that certain changes and modifications may be practiced within the scope of the appended claims.