Isoform of anaplastic lymphoma kinase and its uses
10190104 ยท 2019-01-29
Assignee
Inventors
Cpc classification
G01N2333/912
PHYSICS
A61K31/545
HUMAN NECESSITIES
G01N33/57484
PHYSICS
A61K31/4545
HUMAN NECESSITIES
A61K31/5377
HUMAN NECESSITIES
C12Q2600/106
CHEMISTRY; METALLURGY
A61K31/506
HUMAN NECESSITIES
C12N9/12
CHEMISTRY; METALLURGY
G01N2800/52
PHYSICS
International classification
C12N9/12
CHEMISTRY; METALLURGY
A61K31/4545
HUMAN NECESSITIES
A61K31/545
HUMAN NECESSITIES
A61K31/5377
HUMAN NECESSITIES
A61K31/506
HUMAN NECESSITIES
Abstract
The present invention relates to a Truncated isoform of Anaplastic Lymphoma Kinase (TALK). Expression of this isoform is associated with malignancy and with responsiveness to ALK inhibitors. Detection of the isoform may be used in diagnostic and therapeutic methods. Because it arises as a result of variant transcription rather than genetic rearrangement, its presence would be undetected by genomic testing.
Claims
1. An isolated complementary DNA (cDNA) molecule comprising the nucleic acid sequence of exons 20-29 and a portion of intron 19 of an Anaplastic Lymphoma Kinase (ALK) gene, wherein the cDNA molecule does not comprise the nucleic acid sequence of exons 1-19 of the ALK gene, either individually or in any combination and wherein the portion of intron 19 of the ALK gene is about 400 bp in length located upstream of exon 20 of the ALK gene.
2. The isolated cDNA molecule of claim 1, wherein the ALK gene is a human ALK gene.
3. The isolated cDNA molecule of claim 1, comprising: (a) nucleic acids 405-2063 of the nucleotide sequence set forth in SEQ ID NO: 11; (b) nucleic acids 411-2063 of the nucleotide sequence set forth in SEQ ID NO: 11; or (c) nucleic acids 465-2063 of the nucleotide sequence set forth in SEQ ID NO: 11.
4. The isolated cDNA acid molecule of claim 1, wherein the cDNA molecule consists essentially of SEQ ID NO: 11.
5. A vector comprising the isolated nucleic acid molecule of claim 1.
6. A vector comprising the isolated cDNA molecule of claim 4.
7. A host cell comprising the vector of claim 5 or 6.
Description
BRIEF DESCRIPTION OF THE FIGURES
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
(13)
(14)
DETAILED DESCRIPTION OF THE INVENTION
(15) For clarity and not by way of limitation, the detailed description of the invention is divided into the following subsections:
(16) (i) Definitions
(17) (ii) TALKs;
(18) (iii) Detection of TALKs;
(19) (iv) Diagnostic methods;
(20) (v) Methods of treatment; and
(21) (vi) Kits.
Definitions
(22) As used herein, the term about or approximately means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, about can mean within 3 or more than 3 standard deviations, per the practice in the art. Alternatively, about can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.
(23) As used herein, the term antibody means not only intact antibody molecules, but also fragments of antibody molecules that retain immunogen-binding ability. Such fragments are also well known in the art and are regularly employed both in vitro and in vivo. Accordingly, as used herein, the term antibody means not only intact immunoglobulin molecules but also the well-known active fragments F(ab)2, and Fab. F(ab)2, and Fab fragments that lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983). The antibodies of the invention comprise whole native antibodies, bispecific antibodies; chimeric antibodies; Fab, Fab, single chain V region fragments (scFv), fusion polypeptides, humanized antibodies derived from a non-human antibody, and unconventional antibodies.
(24) As used herein, the term vector refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences into cells. Thus, the term includes cloning and expression vehicles, as well as viral vectors and plasmid vectors.
(25) As used herein, the term expression vector refers to a recombinant nucleic acid sequence, e.g., a recombinant DNA molecule, containing a desired coding sequence and appropriate nucleic acid sequences necessary for the expression of the operably linked coding sequence in a particular host organism. Nucleic acid sequences necessary for expression in prokaryotes usually include a promoter, an operator (optional), and a ribosome binding site, often along with other sequences. Eukaryotic cells are known to utilize promoters, enhancers, and termination and polyadenylation signals.
(26) As used herein, the term treating or treatment refers to clinical intervention in an attempt to alter the disease course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Therapeutic effects of treatment include, without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastases, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. By preventing progression of a disease or disorder, a treatment can prevent deterioration due to a disorder in an affected or diagnosed subject or a subject suspected of having the disorder, but also a treatment may prevent the onset of the disorder or a symptom of the disorder in a subject at risk for the disorder or suspected of having the disorder.
(27) An effective amount (or therapeutically effective amount) is an amount sufficient to affect a beneficial or desired clinical result upon treatment. An effective amount can be administered to a subject in one or more doses. In terms of treatment, an effective amount is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease (e.g., a cancer), or otherwise reduce the pathological consequences of the disease (e.g., a cancer). The effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art. Several factors are typically taken into account when determining an appropriate dosage to achieve an effective amount. These factors include age, sex and weight of the subject, the condition being treated, the severity of the condition and the form and effective concentration of the immunoresponsive cells administered.
(28) As used herein, the term subject refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, rodents, and the like (e.g., which is to be the recipient of a particular treatment, or from whom cells are harvested).
(29) As used herein, the term an anti-cancer effect means one or more of a reduction in aggregate cancer cell mass, a reduction in cancer cell growth rate, a reduction in cancer cell proliferation, a reduction in tumor mass, a reduction in tumor volume, a reduction in tumor cell proliferation, a reduction in tumor growth rate, a reduction in tumor metastasis and/or an increase in the proportion of senescent cancer cells.
TALKs
(30) The human anaplastic lymphoma kinase (ALK) gene is located at chr 2p23, contains 29 exons, and encodes a 1,620 amino acid, 220 kDa classical insulin superfamily tyrosine kinase. The mature human ALK protein undergoes post-translational N-linked glycosylation and consists of an extracellular ligand-binding domain, a transmembrane domain, and a single intracellular tyrosine kinase domain.
(31) The term TALK may be used to refer to the truncated isoforms of ALK referred to herein and the mRNA and corresponding cDNA molecule encoding them.
(32) In certain non-limiting embodiments, the present invention provides for an ALK isoform comprising exons 20-29 but lacking the transmembrane domain and/or extracellular domain. The TALK arises as a result of the establishment of a de novo alternative transcriptional initiation (ATI) site rather than a genomic rearrangement or a genomic aberration at the ALK locus. Thus, the TALK is termed as ALK.sup.ATI.
(33) In certain non-limiting embodiments, the ALK isoform is not comprised in fusion with a portion of another native protein, for example arising from a translocation event, for example, where the 3 portion of ALK is fused to a portion of the ATIC, C2orf44, CARS, CLTC, EML4, FN1, KIF5B, KLC1, MSN, NPM1, PPFIBP1, RANBP2, SEC31A, SQSTM1, STRN, TFG, TPM3, TPM4, or VCL protein (see the COMIC database, http://cancer.sanger.ac.uk/cancergenome/projects/cosmic/)
(34) In certain non-limiting embodiments, the present invention provides for an ALK isoform encoded by a mRNA transcript comprising exons 20-29 and a portion but not all of intron 19, but not exons comprised in the transmembrane domain and/or extracellular domain of ALK. In certain non-limiting embodiments, the present invention provides for an ALK isoform encoded by a mRNA transcript comprising exons 20-29 and a portion but not all of intron 19, but not exons 1-19, of the ALK gene, either individually or in any combination. In certain non-limiting embodiments, the present invention provides for a nucleic acid molecule comprising the transcript. In certain non-limiting embodiments, the size of the transcript is about 2300-2600 bases, or about 2500 bases, or about 2513 bases. Certain non-limiting embodiments of the transcript comprise about 400 bases of intron 19 upstream of exon 20. Certain non-limiting embodiments of the invention provide for a cDNA molecule corresponding to said mRNA transcript. Said cDNA molecule may optionally be operably linked to a promoter and/or incorporated into a nucleic acid vector. Said promoter may be positioned directly before the coding sequence. In certain non-limiting embodiments, the promoter is a heterologous promoter (that is to say, not the ALK promoter). In certain non-limiting embodiments, said mRNA transcript or cDNA molecule lacks nucleic acid sequence encoding at least a 10 or 20 amino acid long fragment of a protein other than ALK.
(35) In certain non-limiting embodiments, the ALK is human ALK.
(36) In certain non-limiting embodiments, the corresponding human ALK gene has a sequence as provided by NCBI Reference Sequence: NG_009445.1 Accession No. NG_009445 or an allelic variant thereof.
(37) In certain non-limiting embodiments, the human ALK protein has the amino acid sequence provided by NCBI Reference Sequence: NP_004295.2 Accession No. NP_004295 (provided below) or an allelic variant thereof.
(38) TABLE-US-00001 [SEQIDNO:1] 1 mgaigllwllplllstaavgsgmgtgqragspaagpplqpreplsysrlqrkslavdfvv 61 pslfrvyardlllppssselkagrpeargslaldcapllrllgpapgvswtagspapaea 121 rtlsrvlkggsvrklrrakqlvlelgeeailegcvgppgeaavgllqfnlselfswwirq 181 gegrlrirlmpekkasevgregrlsaairasqprllfqifgtghsslesptnmpspspdy 241 ftwnitwimkdsfpflshrsryglecsfdfpceleyspplhdlrnqswswrripseeasq 301 mdlldgpgaerskemprgsflllntsadskhtilspwmrsssehctlaysvhrhlqpsgr 361 yiaqllphneaareillmptpgkhgwtvlqgrigrpdnpfrvaleyissgnrslsavdff 421 alkncsegtspgskmalqssftcwngtvlqlgqacdfhqdcaggedesqmcrklpvgfyc 481 nfedgfcgwtqgtlsphtpqwqvrtlkdarfqdhqdhalllsttdvpasesatvtsatfp 541 apiksspcelrmswlirgvlrgnvslvlvenktgkeqgrmvwhvaayeglslwqwmvlpl 601 ldvsdrfwlqmvawwgqgsraivafdnisisldcyltisgedkilqntapksrnlfernp 661 nkelkpgensprqtpifdptvhwlfttcgasgphgptqaqcnnayqnsnlsvevgsegpl 721 kgiqiwkvpatdtysisgygaaggkggkntmmrshgvsvlgifnlekddmlyilvgqqge 781 dacpstngliqkvcigennvieeeirvnrsvhewaggggggggatyvfkmkdgvpvplii 841 aaggggraygaktdtfhperlennssvlglngnsgaagggggwndntsllwagkslgega 901 tgghscpqamkkwgwetrggfggggggcssggggggyiggnaasnndpemdgedgvsfis 961 plgilytpalkvmeghgevnikhylncshcevdechmdpeshkvicfcdhgtvlaedgvs 1021 civsptpephlplslilsvvtsalvaalvlafsgimivyrrkhgelqamqmelgspeykl 1081 sklrtstimtdynpnycfagktssisdlkevprknitlirglghgafgevyegqvsgmpn 1141 dpsplqvavktlpevcseqdeldflmealiiskfnhqnivrcigvslqslprfillelma 1201 ggdlksflretrprpsqpsslamldllhvardiacgcqyleenhfihrdiaarnclltcp 1261 gpgrvakigdfgmardiyrasyyrkggcamlpvkwmppeafmegiftsktdtwsfgvllw 1321 eifslgympypsksnqevlefvtsggrmdppkncpgpvyrimtqcwqhqpedrpnfaiil 1381 erieyctqdpdvintalpieygplveeeekvpvrpkdpegvppllvsqqakreeerspaa 1441 ppplpttssgkaakkptaaeisvrvprgpavegghvnmafsqsnppselhkvhgsrnkpt 1501 slwnptygswftekptkknnpiakkephdrgnlglegsctvppnvatgrlpgasllleps
(39) In certain non-limiting embodiments, the untruncated or wild type human ALK mRNA has the nucleotide sequence provided by NCBI Reference Sequence: NM_004304.4 Accession No. NM_004304 (provided below) or an allelic variant thereof.
(40) TABLE-US-00002 [SEQIDNO:2] 1 agctgcaagtggcgggcgcccaggcagatgcgatccagcggctctgggggcggcagcggt 61 ggtagcagctggtacctcccgccgcctctgttcggagggtcgcggggcaccgaggtgctt 121 tccggccgccctctggtcggccacccaaagccgcgggcgctgatgatgggtgaggagggg 181 gcggcaagatttcgggcgcccctgccctgaacgccctcagctgctgccgccggggccgct 241 ccagtgcctgcgaactctgaggagccgaggcgccggtgagagcaaggacgctgcaaactt 301 gcgcagcgcgggggctgggattcacgcccagaagttcagcaggcagacagtccgaagcct 361 tcccgcagcggagagatagcttgagggtgcgcaagacggcagcctccgccctcggttccc 421 gcccagaccgggcagaagagcttggaggagccaaaaggaacgcaaaaggcggccaggaca 481 gcgtgcagcagctgggagccgccgttctcagccttaaaagttgcagagattggaggctgc 541 cccgagaggggacagaccccagctccgactgcggggggcaggagaggacggtacccaact 601 gccacctcccttcaaccatagtagttcctctgtaccgagcgcagcgagctacagacgggg 661 gcgcggcactcggcgcggagagcgggaggctcaaggtcccagccagtgagcccagtgtgc 721 ttgagtgtctctggactcgcccctgagcttccaggtctgtttcatttagactcctgctcg 781 cctccgtgcagttgggggaaagcaagagacttgcgcgcacgcacagtcctctggagatca 841 ggtggaaggagccgctgggtaccaaggactgttcagagcctcttcccatctcggggagag 901 cgaagggtgaggctgggcccggagagcagtgtaaacggcctcctccggcgggatgggagc 961 catcgggctcctgtggctcctgccgctgctgctttccacggcagctgtgggctccgggat 1021 ggggaccggccagcgcgcgggctccccagctgcggggccgccgctgcagccccgggagcc 1081 actcagctactcgcgcctgcagaggaagagtctggcagttgacttcgtggtgccctcgct 1141 cttccgtgtctacgcccgggacctactgctgccaccatcctcctcggagctgaaggctgg 1201 caggcccgaggcccgcggctcgctagctctggactgcgccccgctgctcaggttgctggg 1261 gccggcgccgggggtctcctggaccgccggttcaccagccccggcagaggcccggacgct 1321 gtccagggtgctgaagggcggctccgtgcgcaagctccggcgtgccaagcagttggtgct 1381 ggagctgggcgaggaggcgatcttggagggttgcgtcgggccccccggggaggcggctgt 1441 ggggctgctccagttcaatctcagcgagctgttcagttggtggattcgccaaggcgaagg 1501 gcgactgaggatccgcctgatgcccgagaagaaggcgtcggaagtgggcagagagggaag 1561 gctgtccgcggcaattcgcgcctcccagccccgccttctcttccagatcttcgggactgg 1621 tcatagctccttggaatcaccaacaaacatgccttctccttctcctgattattttacatg 1681 gaatctcacctggataatgaaagactccttccctttcctgtctcatcgcagccgatatgg 1741 tctggagtgcagctttgacttcccctgtgagctggagtattcccctccactgcatgacct 1801 caggaaccagagctggtcctggcgccgcatcccctccgaggaggcctcccagatggactt 1861 gctggatgggcctggggcagagcgttctaaggagatgcccagaggctcctttctccttct 1921 caacacctcagctgactccaagcacaccatcctgagtccgtggatgaggagcagcagtga 1981 gcactgcacactggccgtctcggtgcacaggcacctgcagccctctggaaggtacattgc 2041 ccagctgctgccccacaacgaggctgcaagagagatcctcctgatgcccactccagggaa 2101 gcatggttggacagtgctccagggaagaatcgggcgtccagacaacccatttcgagtggc 2161 cctggaatacatctccagtggaaaccgcagcttgtctgcagtggacttctttgccctgaa 2221 gaactgcagtgaaggaacatccccaggctccaagatggccctgcagagctccttcacttg 2281 ttggaatgggacagtcctccagcttgggcaggcctgtgacttccaccaggactgtgccca 2341 gggagaagatgagagccagatgtgccggaaactgcctgtgggtttttactgcaactttga 2401 agatggcttctgtggctggacccaaggcacactgtcaccccacactcctcaatggcaggt 2461 caggaccctaaaggatgcccggttccaggaccaccaagaccatgctctattgctcagtac 2521 cactgatgtccccgcttctgaaagtgctacagtgaccagtgctacgtttcctgcaccgat 2581 caagagctctccatgtgagctccgaatgtcctggctcattcgtggagtcttgaggggaaa 2641 cgtgtccttggtgctagtggagaacaaaaccgggaaggagcaaggcaggatggtctggca 2701 tgtcgccgcctatgaaggcttgagcctgtggcagtggatggtgttgcctctcctcgatgt 2761 gtctgacaggttctggctgcagatggtcgcatggtggggacaaggatccagagccatcgt 2821 ggcttttgacaatatctccatcagcctggactgctacctcaccattagcggagaggacaa 2881 gatcctgcagaatacagcacccaaatcaagaaacctgtttgagagaaacccaaacaagga 2941 gctgaaacccggggaaaattcaccaagacagacccccatctttgaccctacagttcattg 3001 gctgttcaccacatgtggggccagcgggccccatggccccacccaggcacagtgcaacaa 3061 cgcctaccagaactccaacctgagcgtggaggtggggagcgagggccccctgaaaggcat 3121 ccagatctggaaggtgccagccaccgacacctacagcatctcgggctacggagctgctgg 3181 cgggaaaggcgggaagaacaccatgatgcggtcccacggcgtgtctgtgctgggcatctt 3241 caacctggagaaggatgacatgctgtacatcctggttgggcagcagggagaggacgcctg 3301 ccccagtacaaaccagttaatccagaaagtctgcattggagagaacaatgtgatagaaga 3361 agaaatccgtgtgaacagaagcgtgcatgagtgggcaggaggcggaggaggagggggtgg 3421 agccacctacgtatttaagatgaaggatggagtgccggtgcccctgatcattgcagccgg 3481 aggtggtggcagggcctacggggccaagacagacacgttccacccagagagactggagaa 3541 taactcctcggttctagggctaaacggcaattccggagccgcaggtggtggaggtggctg 3601 gaatgataacacttccttgctctgggccggaaaatctttgcaggagggtgccaccggagg 3661 acattcctgcccccaggccatgaagaagtgggggtgggagacaagagggggtttcggagg 3721 gggtggaggggggtgctcctcaggtggaggaggcggaggatatataggcggcaatgcagc 3781 ctcaaacaatgaccccgaaatggatggggaagatggggtttccttcatcagtccactggg 3841 catcctgtacaccccagctttaaaagtgatggaaggccacggggaagtgaatattaagca 3901 ttatctaaactgcagtcactgtgaggtagacgaatgtcacatggaccctgaaagccacaa 3961 ggtcatctgcttctgtgaccacgggacggtgctggctgaggatggcgtctcctgcattgt 4021 gtcacccaccccggagccacacctgccactctcgctgatcctctctgtggtgacctctgc 4081 cctcgtggccgccctggtcctggctttctccggcatcatgattgtgtaccgccggaagca 4141 ccaggagctgcaagccatgcagatggagctgcagagccctgagtacaagctgagcaagct 4201 ccgcacctcgaccatcatgaccgactacaaccccaactactgctttgctggcaagacctc 4261 ctccatcagtgacctgaaggaggtgccgcggaaaaacatcaccctcattcggggtctggg 4321 ccatggcgcctttggggaggtgtatgaaggccaggtgtccggaatgcccaacgacccaag 4381 ccccctgcaagtggctgtgaagacgctgcctgaagtgtgctctgaacaggacgaactgga 4441 tttcctcatggaagccctgatcatcagcaaattcaaccaccagaacattgttcgctgcat 4501 tggggtgagcctgcaatccctgccccggttcatcctgctggagctcatggcggggggaga 4561 cctcaagtccttcctccgagagacccgccctcgcccgagccagccctcctccctggccat 4621 gctggaccttctgcacgtggctcgggacattgcctgtggctgtcagtatttggaggaaaa 4681 ccacttcatccaccgagacattgctgccagaaactgcctcttgacctgtccaggccctgg 4741 aagagtggccaagattggagacttcgggatggcccgagacatctacagggcgagctacta 4801 tagaaagggaggctgtgccatgctgccagttaagtggatgcccccagaggccttcatgga 4861 aggaatattcacttctaaaacagacacatggtcctttggagtgctgctatgggaaatctt 4921 ttctcttggatatatgccataccccagcaaaagcaaccaggaagttctggagtttgtcac 4981 cagtggaggccggatggacccacccaagaactgccctgggcctgtataccggataatgac 5041 tcagtgctggcaacatcagcctgaagacaggcccaactttgccatcattttggagaggat 5101 tgaatactgcacccaggacccggatgtaatcaacaccgctttgccgatagaatatggtcc 5161 acttgtggaagaggaagagaaagtgcctgtgaggcccaaggaccctgagggggttcctcc 5221 tctcctggtctctcaacaggcaaaacgggaggaggagcgcagcccagctgccccaccacc 5281 tctgcctaccacctcctctggcaaggctgcaaagaaacccacagctgcagagatctctgt 5341 tcgagtccctagagggccggccgtggaagggggacacgtgaatatggcattctctcagtc 5401 caaccctccttcggagttgcacaaggtccacggatccagaaacaagcccaccagcttgtg 5461 gaacccaacgtacggctcctggtttacagagaaacccaccaaaaagaataatcctatagc 5521 aaagaaggagccacacgacaggggtaacctggggctggagggaagctgtactgtcccacc 5581 taacgttgcaactgggagacttccgggggcctcactgctcctagagccctcttcgctgac 5641 tgccaatatgaaggaggtacctctgttcaggctacgtcacttcccttgtgggaatgtcaa 5701 ttacggctaccagcaacagggcttgcccttagaagccgctactgcccctggagctggtca 5761 ttacgaggataccattctgaaaagcaagaatagcatgaaccagcctgggccctgagctcg 5821 gtcgcacactcacttctcttccttgggatccctaagaccgtggaggagagagaggcaatg 5881 gctccttcacaaaccagagaccaaatgtcacgttttgttttgtgccaacctattttgaag 5941 taccaccaaaaaagctgtattttgaaaatgctttagaaaggttttgagcatgggttcatc 6001 ctattctttcgaaagaagaaaatatcataaaaatgagtgataaatacaaggcccagatgt 6061 ggttgcataaggtttttatgcatgtttgttgtatacttccttatgcttctttcaaattgt 6121 gtgtgctctgcttcaatgtagtcagaattagctgcttctatgtttcatagttggggtcat 6181 agatgtttccttgccttgttgatgtggacatgagccatttgaggggagagggaacggaaa 6241 taaaggagttatttgtaatgactaaaa
(41) In certain non-limiting embodiments, the present invention provides for an isolated nucleic acid molecule comprising the nucleic acid sequence set forth in SEQ ID NO: 11 as shown in
(42) In certain non-limiting embodiments, the nucleic acid molecule comprises a nucleotide sequence encoding the amino acid sequence set forth in SEQ ID NO: 12 as shown in
(43) In certain non-limiting embodiments, the nucleic acid molecule comprises a nucleotide sequence encoding amino acids 3-552 of SEQ ID NO: 12 or a sequence that is at least 80%, at least 85%, at least 90%, or at least 95% homologous thereto, including sequences that are not identical to amino acids 3-552 of SEQ ID NO:12. In certain non-limiting embodiments, the nucleic acid molecule comprises a nucleotide sequence encoding an amino acid sequence that comprises at least one (e.g., no more than 2, no more than 3, no more than 4, no more than 5, no more than 6, no more than 7, no more than 8, no more than 9, no more than 10, no more than 11, no more than 12, no more than 13, no more than 14, no more than 15, no more than 16, no more than 17, no more than 18, no more than 19, or no more than 20) amino acid variation relative to amino acids 3-552 of SEQ ID NO: 12, where the resulting sequence is not found in a naturally occurring protein, e.g., a wild-type protein.
(44) In certain non-limiting embodiments, the nucleic acid molecule comprises a nucleotide sequence encoding amino acids 21-552 of SEQ ID NO: 12 or a sequence that is at least 80%, at least 85%, at least 90%, or at least 95% homologous thereto, including sequences that are not identical to amino acids 21-552 of SEQ ID NO:12. In certain non-limiting embodiments, the nucleic acid molecule comprises a nucleotide sequence encoding an amino acid sequence that comprises at least one (e.g., no more than 2, no more than 3, no more than 4, no more than 5, no more than 6, no more than 7, no more than 8, no more than 9, no more than 10, no more than 11, no more than 12, no more than 13, no more than 14, no more than 15, no more than 16, no more than 17, no more than 18, no more than 19, or no more than 20) amino acid variation relative to amino acids 21-552 of SEQ ID NO: 12, where the resulting sequence is not found in a naturally occurring protein, e.g., a wild-type protein.
(45) In certain non-limiting embodiments, the amino acid sequence has altered glycosylation patterns compared to a naturally occurring protein, including but not limited to, an amino acid sequence produced in non-human cells, e.g., yeast cells, insect cells, CHO cells, etc.
(46) In certain non-limiting embodiments, the present invention provides for an isolated nucleic acid molecule, which is a cDNA molecule, comprises nucleic acids 405-2063 of the nucleic acid sequence set forth in SEQ ID NO: 11 as shown in
(47) In certain non-limiting embodiments, the present invention provides for an isolated nucleic acid molecule, which is a cDNA molecule, comprises nucleic acids 411-2063 of the nucleic acid sequence set forth in SEQ ID NO: 11 as shown in
(48) In certain non-limiting embodiments, the present invention provides for an isolated nucleic acid molecule, which is a cDNA molecule, comprises nucleic acids 465-2063 of the nucleic acid sequence set forth in SEQ ID NO: 11 as shown in
(49) In certain non-limiting embodiments, said nucleic acid molecule is operably linked to a promoter, which may be a heterologous promoter. In certain non-limiting embodiments, the nucleic acid molecule comprises a cDNA molecule. In certain non-limiting embodiments, the isolated nucleic acid molecule is comprised in a vector which may, for example, be an expression vector or a virus.
(50) In certain non-limiting embodiments, the present invention provides for a host cell comprising a vector that comprises the nucleic acid molecules described herein.
(51) Sequence homology or sequence identity may be measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e-3 and e-100 indicating a closely related sequence.
(52) In certain non-limiting embodiments, the present invention provides for an isolated polypeptide encoded by any of the nucleic acid molecules described herein, including cDNA molecules.
(53) In certain non-limiting embodiments, the present invention provides for an isolated polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 12 as shown in
(54) TABLE-US-00003 [SEQIDNO:3] MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPL SYSRLQRKSLAVDEVVPSLERVYARDLLLPPSSSELKAGRPEAR GSLALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSV RKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSW WIRQGEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIF GTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGL ECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPG AERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVH RHLQPSGRYIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRP DNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSS FTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYCNFED GFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPA SESATVTSATFPAPIKSSPCELRMSWLIRGVLRGNVSLVLVENK TGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDREWLQMVAWWG QGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNP NKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNA YQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAGGKGGK NTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQK VCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPV PLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGG GGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGGG GGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTP ALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGT VLAEDGVSCIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIM IVYRRKHQELQA
(55) In certain non-limiting embodiments, the present invention provides for an isolated polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 12 as shown in
(56) TABLE-US-00004 [SEQIDNO:4] MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPL SYSRLQRKSLAVDFVVPSLFRVYARDLLLPPSSSELKAGRPEAR GSLALDCAPLLRLLGPAPGVSWTAGSPAPAEARTLSRVLKGGSV RKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSW WIRQGEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIF GTGHSSLESPTNMPSPSPDYFTWNLTWIMKDSFPFLSHRSRYGL ECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQMDLLDGPG AERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVH RHLQPSGRYIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRP DNPFRVALEYISSGNRSLSAVDFFALKNCSEGTSPGSKMALQSS FTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYCNFED GFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPA SESATVTSATFPAPIKSSPCELRMSWLIRGVLRGNVSLVLVENK TGKEQGRMVWHVAAYEGLSLWQWMVLPLLDVSDRFWLQMVAWWG QGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNP NKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNA YQNSNLSVEVGSEGPLKGIQIWKVPATDTYSISGYGAAGGKGGK NTMMRSHGVSVLGIFNLEKDDMLYILVGQQGEDACPSTNQLIQK VCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPV PLIIAAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGG GGWNDNTSLLWAGKSLQEGATGGHSCPQAMKKWGWETRGGFGGG GGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFISPLGILYTP ALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGT VLAEDGVSCIVSPTPEPHLPLSLILSVVTSA
(57) In certain non-limiting embodiments, the polypeptide comprises amino acids 3 to 552 of SEQ ID NO: 12. In certain non-limiting embodiments, the polypeptide comprises amino acids 21 to 552 of SEQ ID NO: 12.
(58) In certain non-limiting embodiments, the isolated polypeptide comprises an amino acid sequence that comprises at least one (e.g., no more than 2, no more than 3, no more than 4, no more than 5, no more than 6, no more than 7, no more than 8, no more than 9, no more than 10, no more than 11, no more than 12, no more than 13, no more than 14, no more than 15, no more than 16, no more than 17, no more than 18, no more than 19, or no more than 20) amino acid variation relative to SEQ ID NO: 12, where the resulting sequence is not found in a naturally occurring protein, e.g., a wild-type protein. In certain embodiments, the amino acid sequence comprises at least one amino acid variation relative to SEQ ID NO: 12 but lacks the amino acid sequence set forth in SEQ ID NO: 3. In certain embodiments, the amino acid sequence comprises at least one amino acid variation relative to SEQ ID NO: 12 but lacks the amino acid sequence set forth in SEQ ID NO: 4.
(59) In certain non-limiting embodiments, the amino acid sequence has altered glycosylation patterns compared to a naturally occurring protein, including but not limited to, an amino acid sequence produced in non-human cells, e.g., yeast cells, insect cells, CHO cells, etc.
(60) Amino acid variations or modifications may include amino acid substitutions, additions and/or deletions. Variations or modifications may be introduced by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. In certain embodiments, the at least one amino acid variation comprises at least one amino acid conservative modification. Amino acids can be classified into groups according to their physicochemical properties such as charge and polarity. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid within the same group. For example, amino acids can be classified by charge: positively-charged amino acids include lysine, arginine, histidine, negatively-charged amino acids include aspartic acid, glutamic acid, neutral charge amino acids include alanine, asparagine, cysteine, glutamine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine. In addition, amino acids can be classified by polarity: polar amino acids include arginine (basic polar), asparagine, aspartic acid (acidic polar), glutamic acid (acidic polar), glutamine, histidine (basic polar), lysine (basic polar), serine, threonine, and tyrosine; non-polar amino acids include alanine, cysteine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, and valine.
(61) In certain non-limiting embodiments, the polypeptide comprises amino acids 3 to 552 of SEQ ID NO: 12. In certain non-limiting embodiments, the polypeptide comprises amino acids 21 to 552 of SEQ ID NO: 12.
(62) In certain non-limiting embodiments, the present invention provides for an isolated polypeptide comprising the amino acid sequence set forth in residues 1-552 of SEQ ID NO: 12 as shown in
(63) In certain non-limiting embodiments, the present invention provides for an isolated polypeptide comprising the amino acid sequence set forth in residues 3-552 of SEQ ID NO: 12 as shown in
(64) In certain non-limiting embodiments, the present invention provides for an isolated polypeptide comprising the amino acid sequence set forth in residues 21-552 of SEQ ID NO: 12 as shown in
(65) In certain non-limiting embodiments, the polypeptide has an estimated molecular weight of between 58-64, e.g., about 61 kDa, or about 59 kDa.
(66) In certain non-limiting embodiments, the polypeptide is linked to a heterologous peptide tag of between about 2-20 amino acids, or between about 3-15 amino acids.
(67) In certain non-limiting embodiments, the polypeptide is detectably labeled.
(68) In certain non-limiting embodiments, the polypeptide contains at least one conservative amino acid substitution relative to the wild-type sequence.
(69) In certain non-limiting embodiments, the present invention provides for an antibody that binds to one of the above-described polypeptides, but that does not bind to a wild-type ALK polyeptide, e.g., one comprising the amino acid sequence set forth in SEQ ID NO: 1.
Detection of TALKs
(70) Detection of TALKs may be performed by any method known in the art. A TALK may be detected in the form of a mRNA transcript, a corresponding cDNA molecule, its encoded polypeptide, or an ATI site in intron 19 of ALK. In one non-limiting embodiment, the TALK is ALK.sup.ATI.
(71) In certain non-limiting embodiments, a mRNA transcript encoding a TALK may be detected by a method comprising probe hybridization (e.g., probe-based NanoString nCounter assay), amplification, reverse transcription, polymerase chain reaction (PCR, e.g., reverse transcription polymerase chain reaction (RT-PCR), quantitative reverse transcriptase PCR, real-time PCR, quantitative real-time PCR), Northern blot, sequencing, microarray, or a combination thereof.
(72) In certain non-limiting embodiments, a TALK polypeptide may be detected by a method comprising antibody binding, immunohistochemistry, Western blot, functional (e.g., kinase) assay, enzyme linked immunosorbent assays (ELISAs), radioimmunoassays (RIA), enzyme immunoassays (EIA), mass spectrometry, 1-D or 2-D gel-based analysis systems (e.g., Polyacrylamide gel electrophoresis (PAGE)), immunoprecipitation, or a combination thereof.
(73) In certain non-limiting embodiments, a TALK cDNA molecule may be detected by PCR.
(74) In certain non-limiting embodiments, an ATI site in intron 19 of an ALK gene imay be detected by a method comprising Northern blot, Chromatin immunoprecipitation (ChIP)-seq, ChIP-qPCR, Rapid Amplification of cDNA Ends (RACE)-PCR, or a combination thereof.
(75) A detection method may be practiced in a cell or tissue or cell lysate collected from a subject. The cell may be collected as a sample, for example a sample of a tumor or neoplasm or other lesion. The sample may be a peripheral blood sample or other fluid sample (e.g., pleural effusion).
(76) In one particular non-limiting embodiment of the invention, the transcriptional start site and 5-end of a TALK transcript, for example the ALK.sup.ATI transcript, may be ascertained using the 5-RACE technique. For example, a tobacco-acid-pyrophosphatase 5-RACE technique may be performed according to the manufactures protocol (ExactSTART Eukaryotic mRNA RACE Kit, #ES80910, Epicentre) using the following primers: 5-TCATACACATACGATTTAGGTGACACTATAGAGCGGCCGCCTGCAGGAAA-3 [SEQ ID NO: 5]; reverse 5-CAGGTCACTGATGGAGGAGGTCTTGCCAGCAAAGCA-3 [SEQ ID NO: 6]. The 5-RACE products may then be sequenced, for example using an Illumina MiSeq System with a 150 bp paired-end protocol according to the manufactures protocol. Alternatively, the following reverse primers may be used: forward primer 5-CTAATACGACTCACTATAGGGC-3 [SEQ ID NO: 7], reverse primer 5-ACACCTGGCCTTCATACACCTCC-3 [SEQ ID NO: 8].
(77) In another particular non-limiting embodiment of the invention, a cDNA molecule of a TALK (e.g., the ALK.sup.ATI) transcript may be amplified using the ALK specific primers 5-CACCATCCCATCTCCAGTCTGCTTC-3 [SEQ ID NO: 9] and 5-AGAGAAGTGAGTGTGCGACC-3 [SEQ ID NO: 10].
(78) In other particular non-limiting embodiments of the invention, the presence of a TALK may be detected using an ALK-specific antibody as well as a technique that demonstrates a molecular weight lower than wild-type protein, such as but not limited to polyacrylamide gel electrophoresis and Western blot. Non-limiting examples of antibodies that may be used include Anti--Tubulin antibody (#T9026-.5ML), Anti-V5 (#MA1-81617), and anti-HA3F10 (#12158167001), Phospho-ALK (Tyr1278/1282/1283) Rabbit mAb (#3983), Phospho-ALK (Tyr1604) Rabbit mAb (#3341), ALK (D5F3) Rabbit mAb (#3633), Phospho-Akt (Ser473) (#4060), Akt (#4685), Phospho-Stat3 (Tyr705) (#9145), Stat3 (#4904), Phospho-S6 (Ser235/236) (#4858), S6 (#2217), Phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) (#4370), p44/42 MAPK (Erk1/2) (#4695), Phospho-MEK1/2 (Ser221) (#2338), MEK1/2 (#9122).
(79) In certain non-limiting embodiments, a TALK may be detected via the presence of an ATI site in intron 19 of ALK, for example using ChIP-seq and ChIP-qPCR. The chromatin marks trimethylated histone H3 lysine 4 (H3K4me3) and RNApol-II are well characterized to enrich at poised and actively transcribed ATI site..sup.17-19
(80) In certain non-limiting embodiments, a NanoString nCounter assay with probe sets in ALK exons 1-19, exons 20-29 and intron 19 may be used (see, for
(81) In certain non-limiting embodiments, a TALK may be detected via its cellular localization, in that TALK has a greater presence in the nucleus relative to wild-type ALK. Such studies may be performed, for example, using immunohistochemistry and primary or secondary fluorescent antibody probes.
Diagnostic Methods
(82) The present invention provides for a method of diagnosing a cell as a cancer cell comprising detecting the presence of a TALK in a cell, where the presence of a TALK indicates that the cell is a cancer cell. The cell may be in a sample collected from a subject. In certain non-limiting embodiments, a sample includes, but is not limited to, a clinical sample, cells in culture, cell supernatants, cell lysates, serum, blood plasma, biological fluid (e.g., lymphatic fluid) and tissue samples. The source of the sample may be solid tissue (e.g., from a fresh, frozen, and/or preserved organ, tissue sample, biopsy or aspirate), blood or any blood constituents, bodily fluids (such as, e.g., urine, lymph, cerebral spinal fluid, amniotic fluid, peritoneal fluid or interstitial fluid), or cells from the individual, including circulating tumor cells.
(83) In certain non-limiting embodiments, where a TALK is found in a cell, the cell or another cell from the same subject (for example one or more additional cells from the same sample) may be tested for other markers indicative of a diagnosis of cancer, as are known in the art.
(84) Non-limiting examples of cancers which may be indicated by the presence of a TALK include melanoma, thyroid carcinoma (e.g., anaplastic thyroid carcinoma), lung adenocarcinoma, lung squamous cell carcinoma, renal clear cell carcinoma, and breast cancer. In one particular non-limiting embodiment, the cancer is melanoma.
(85) In certain non-limiting embodiments, the present invention provides a method of determining whether an anti-cancer effect is likely to be produced in a cancer by an ALK inhibitor, comprising determining whether one or more cell of the cancer contains a detectable
(86) TALK, wherein the presence of a detectable TALK in the cell indicates that an ALK inhibitor would have an anti-cancer effect on the cancer.
(87) In certain non-limiting embodiments, the present invention provides for a method of determining the likelihood that a subject having a cancer may obtain therapeutic benefit from therapy with an ALK inhibitor, comprising determining whether a cancer cell of the subject contains a detectable TALK, where the presence of a detectable TALK indicates that the subject is more likely to benefit from ALK inhibitor therapy than a subject who lacks TALK or an activating genetic mutation of ALK.
(88) In certain embodiments, the presence of a detectable TALK comprises the presence of a detectable TALK mRNA transcript, a detectable TALK cDNA molecule corresponding thereto, a detectable TALK polypeptide encoded thereby, and/or a detectable ATI site in intron 19 of an ALK gene in the cell.
(89) In certain non-limiting embodiments, a cancer cell of a subject may have a wild-type (or normal) ALK locus and yet express a TALK, and therefore would not be identified as having an activated ALK by genomic testing.
Methods of Treatment
(90) In certain non-limiting embodiments, the invention provides for a method of treating a subject suffering from a cancer, comprising (i) determining the likelihood that the subject would obtain therapeutic benefit from therapy with an ALK inhibitor, comprising determining whether a cancer cell of the subject contains a detectable TALK, where the presence of a detectable TALK indicates that the subject is more likely to benefit from ALK inhibitor therapy than a subject who lacks TALK or an activating genetic mutation of ALK; (ii) where the subject is determined to be more likely to benefit from ALK inhibitor therapy, treating the subject with an ALK inhibitor, and (iii) where the subject is determined to not be more likely to benefit from ALK inhibitor therapy, treating the subject with an alternative therapy which is not an ALK inhibitor but which may be surgical treatment, radiation therapy, or chemotherapy.
(91) Non-limiting examples of cancers which may be treated by the above method include melanoma, thyroid carcinoma (e.g., anaplastic thyroid carcinoma), lung adenocarcinoma, lung squamous cell carcinoma, renal clear cell carcinoma, thyroid cancer, and breast cancer. In one particular non-limiting embodiment, the cancer is melanoma.
(92) Non-limiting examples of ALK inhibitors which may be used in the above method include crizotinib (Xalkori; (Pfizer); ceritinib (Zykadia, also known as LDK-378; Novartis), NVP-TAE684 (Novartis), alectinib (Chugai); AP26113 (Ariad); ASP-3026 (Astellas); CEP-37440 (Teva); NMS-E628 (Nerviano); PF-06463922 (Pfizer); TSR-011 (Tesoro); RXDX-101 (Ignyta Inc.), and X-396 (Xcovery). In one particular non-limiting embodiment, the ALK inhibitor is crizotinib.
(93) Subjects treated according to the invention with one or more ALK inhibitor may further be treated with one or more additional cancer treatment, including but not limited to, one or more BRAF inhibitor, one or more MEK inhibitor, one or more immunologic inhibitor (e.g., an anti-CTLA-4 antibody, an anti-PD1 antibody, an anti-PD-L1 antibody), one or more CDK4 inhibitor, one or more CDK6 inhibitor, one or more alklyating agent, one or more topoisomerase inhibitor, one or more anti-metabolite, one or more anti-microtubule agent, one or more cytotoxic antibiotic, radiation therapy, chemotherapy, or a combination thereof. In one particular non-limiting embodiment, the subject receives a combination of an anti-CTLA-4 antibody and an PD-1 antibody in addition to an ALK inhibitor. In one non-limiting embodiment, the subject has been treated with a combination of an anti-CTLA-4 antibody and an anti-PD-1 antibody prior to the treatment with an ALK inhibitor. In certain embodiments, the subject further receives radiation and/or chemotherapy.
Kits
(94) In certain non-limiting embodiments, the present invention provides for a kit comprising a means for detecting a TALK as described above, optionally together with written disclosure of one or more method set forth above, and optionally together with a positive control molecule such as a TALK protein and/or nucleic acid.
(95) In certain embodiments, the kit comprises means for determining the level of a TALK mRNA transcript, a TALK cDNA molecule corresponding thereto, and/or a TALK polypeptide encoded thereby. The means for determining the level of a TALK mRNA transcript may be probe hybridization (e.g., probe-based NanoString nCounter assay), polymerase chain reaction (PCR, e.g., RT-PCR, quantitative reverse transcriptase PCR, real-time PCR, or quantitative real-time PCR), Northern blot, sequencing, microarray, or a combination thereof.
(96) In certain embodiments, the means for determining the level of a TALK cDNA molecule may be PCR.
(97) In certain embodiments, the means for determining the level of a TALK polypeptide may be antibody binding, immunohistochemistry, Western blot, a functional (e.g., kinase) assay, enzyme linked immunosorbent assays (ELISAs), radioimmunoassays (MA), enzyme immunoassays (EIA), mass spectrometry, 1-D or 2-D gel-based analysis systems (e.g., Polyacrylamide gel electrophoresis (PAGE)), immunoprecipitation, or a combination thereof.
(98) In certain embodiments, the kit comprises means for determining the presence of an ATI site in intron 19 of an ALK gene in one or more cell of the cancer, which may be Northern blot, Chromatin immunoprecipitation (ChIP)-seq, ChIP-qPCR, Rapid Amplification of cDNA Ends (RACE)-PCR, or a combination thereof.
(99) The present invention further provides for a means for determining the presence of a detectable TALK for use in a method of determining whether an anti-cancer effect is likely to be produced in a cancer by an ALK inhibitor, the method characterized by determining whether one or more cell of the cancer contains a detectable TALK, where the presence of a detectable TALK in the cell indicates that an ALK inhibitor would have an anti-cancer effect on the cancer.
(100) Such a kit may therefore comprise one or more nucleic acid probe (e.g., that hybridizes with a TALK mRNA transcript (including a color coded probe pair used in a NanoString nCounter assay), or that hybridizes with a TALK cDNA molecule), primer, and/or primer pair (e.g., that hybridizes with a TALK mRNA transcript or a TALK cDNA molecule), and/or one or more antibody, antibody fragment, or single chain antibody (e.g., that binds specifically to a TALK polypeptide), any of which are optionally directly labeled with a chemical, fluorescent, enzymatic or radioactive marker. Alternatively, detection may be achieved via a secondary probe, enzyme, substrate, ligand, antibody, antibody fragment, single chain antibody, etc., using techniques known in the art.
(101) In a specific non-limiting embodiment, the kit comprises the primer pair: 5-TCATACACATACGATTTAGGTGACACTATAGAGCGGCCGCCTGCAGGAAA-3 [SEQ ID NO: 5]; reverse 5-CAGGTCACTGATGGAGGAGGTCTTGCCAGCAAAGCA-3 [SEQ ID NO: 6], for example, but not by way of limitation, for use in a 5-RACE technique.
(102) In a specific non-limiting embodiment, the kit comprises the primer pair: forward primer 5-CTAATACGACTCACTATAGGGC-3 [SEQ ID NO: 7], reverse primer 5-ACACCTGGCCTTCATACACCTCC-3 [SEQ ID NO: 8], for example, but not by way of limitation, for use in a 5-RACE technique.
(103) In a specific non-limiting embodiment, the kit comprises the primer pair: 5-CACCATCCCATCTCCAGTCTGCTTC-3 [SEQ ID NO: 9] and 5-AGAGAAGTGAGTGTGCGACC-3 [SEQ ID NO: 10].
(104) In a specific, non-limiting embodiment, the kit comprises an antibody or a fragment thereof that binds to ALK in a region comprised in exons 20-29 and optionally an antibody or a fragment thereof that binds to ALK in a region comprised in exons 1-19.
(105) In a specific, non-limiting embodiment, the kit comprises means to identify an ATI site in intron 19 of ALK.
(106) In a specific non-limiting embodiment, the kit comprises means to detect nuclear localization of TALK, for example a nucleic acid or antibody probe and a second nucleic acid or antibody probe that specifically binds to a binding partner in the nucleus or a chemical means of identifying or staining the nucleus.
EXAMPLE: ALTERNATIVE TRANSCRIPTIONAL INITIATION LEADS TO EXPRESSION OF A NOVEL AND METHODS
(107) Materials and Methods
(108) Human Tumor Samples.
(109) The study was approved by the Institutional Review Boards/Ethics Committees of Memorial Sloan-Kettering Cancer Center, New York, and was conducted according to the Declaration of Helsinki. Representative parts of excised tumors were snap frozen in liquid nitrogen or fixed in 4% neutral buffered formalin, embedded in paraffin, processed using routine histologic methods and stained with hematoxylin-eosin. Specimens with insufficient tissue amount or severely degraded nucleic acids were excluded.
(110) RNA Sequencing.
(111) Total RNA was extracted from fresh-frozen tissue sections (17 metastatic melanoma and 6 thyroid carcinoma) using Qiagen's RNeasy Mini Kit (#74104, Qiagen). The isolated RNA was processed using the TruSeq RNA sample Prep kit (#15026495, Illumina) according to the manufactures protocol. Briefly, the RNA was poly-a selected, reverse transcribed and the obtained cDNA underwent an end-repair process, A-tailing, ligation of the indexes & adapters, and PCR enrichment. The created libraries were sequenced on an Illumina HiSeq-2500 platform with 50, 75 or 100 bp paired-end reads to obtain on average 40 to 100 million reads per sample. Sequencing data were mapped to the human reference genome (hg19) using Bowtie or BWA and analyzed using publicly available software packages: SAMtools.sup.26, Tophat.sup.27, FusionSeq.sup.28, GATK.sup.29, Picard (http://picard.sourceforge.net) and IGV.sup.30.
(112) Screening for Aberrantly Expressed Kinases.
(113) For initial screening of RNA-seq data, candidate receptor tyrosine kinase genes (RTK) were defined by Gene Ontology annotation GO:0004714 as found in AmiGO.sup.31. DEXSeq.sup.9 was used to calculate exon level counts using RTK Ensembl Gene IDs. For each gene in each sample, the ratio of reads in the first half of the gene to the second half was calculated. ALK was identified as the top hit.
(114) Analysis of Public Datasets.
(115) RNA-seq data was downloaded from the Broad Institute GTEx Genotype-Tissue Expression Portal (http://www.broadinstitute.org/gtex/) 2013_09_23 run using exon_quantification data from illuminahiseq_rnaseqv2_unc_udu. ALK.sup.ATI candidates were identified as samples with an ALK expression level of RSEM 100, 500 total reads across all ALK exons, and 10 greater average expression (by exon-level RPKM) in exons 20-29 compared to exons 1-19. To confirm ALK.sup.ATI expression, candidates were manually examined in IGV.sup.30. ENCODE ChIP-seq data for H3K27ac, mapped to hg19 and converted to bigwig track format, was downloaded from http://genome.ucsc.edu/ENCODE/dataMatrix/encodeChipMatrixHuman.html.
(116) Promoter/Motif Analysis.
(117) The proximal cis-regulatory region, chr2:29,445,000-29,447,100, was scanned for transcription factor motifs using FIMO.sup.48 with default parameters against the known vertebrate transcription factor motifs in the JASPAR database.sup.52.
(118) 5-Rapid Amplification of cDNA Ends (5-RACE).
(119) Two independent 5-RACE techniques were used to map the ATI site and the 5-end of the ALK.sup.ATI transcript. A tobacco-acid-pyrophosphatase 5-RACE technique according to the manufacture's protocol (ExactSTART Eukaryotic mRNA RACE Kit, #ES80910, Epicentre) using the following primers: 5-TCATACACATACGATTTAGGTGACACTATAGAGCGGCCGCCTGCAGGAAA-3 [SEQ ID NO: 5]; reverse 5-CAGGTCACTGATGGAGGAGGTCTTGCCAGCAAAGCA-3 [SEQ ID NO: 6]. The 5-RACE products were sequenced on an Illumina MiSeq System with a 150 bp paired-end protocol according to the manufacture's protocol. The sequencing reads were mapped to the human reference genome (hg19) using BWA, analyzed using Tophat.sup.27 and visualized using IGV.sup.30. The continuous transcription starting in ALK intron 19 was confirmed with an independent oligonucleotide-based 5-RACE kit (SMARTer RACE cDNA Amplification Kit, #634923, Clontech) according to the manufacture's protocol using the following reverse primers: forward primer 5-CTAATACGACTCACTATAGGGC-3 [SEQ ID NO: 7], reverse primer 5-ACACCTGGCCTTCATACACCTCC-3 [SEQ ID NO: 8]. The RACE cDNA products were cloned into plasmids (Zero Blunt TOPO PCR Cloning Kit, #K2800-20, Invitrogen) and were analyzed with Sanger sequencing using standard procedures. Two lung cancer cell lines (H3122, H2228) with EML4-ALK translocations were used as controls, and as expected, both controls showed the EML4 gene next to ALK exon 20.
(120) Chromatin immunoprecipitation (ChIP)-seq and ChIP-qPCR. Chromatin was isolated from human tumor tissue and cell lines. Fresh-frozen human tumor tissue (MM-15, MM-74, ATC-28) was sectioned with a microtome and cross-linked in 1% paraformaldehyde for 15 min. The cross-linked tissue samples were quenched in 125 mM Glycine for 10 min, washed in PBS, re-suspended in lysis buffer, and dounced in a Tenbroeck-style tissue grinder and conicated..sup.32 Chromatin isolation from the cell-lines H3122 and SKMEL-524 cells and immunoprecipitation was performed as previously described.sup.32. Solubilized chromatin from human tumors and cell lines was immune-precipitated with antibodies against H3K4me3 (#39159, Active Motif), H3K27ac (#Ab4729, Abcam), and RNA-pol II (#39097, Active Motif).
(121) ChIP-seq was performed on an Illumina HiSeq2500 with 51-bp single reads. Reads were aligned to the human genome hg19 using the Bowtie alignment software within the Illumina Analysis Pipeline. Duplicate reads were eliminated for subsequent analysis. Peak calling was performed using MACS 1.4 comparing immune-precipitated chromatin with input chromatin..sup.33 ChIP-qPCR was performed on a ViiA 7 Real Time PCR System (Life Technologies) using Power SYBR Master Mix (#4367659, Life Technology). ChIP-qPCR primers were designed using primer blast (http://www.ncbi.nlm.nih.gov/tools/primer-blast) and are described in
(122) Ultra-deep targeted sequencing of the entire ALK locus. Targeted sequencing of the entire ALK locus was performed using custom hybridization capture probes tiling hg19 chr2:29400000-30300000 (RocheNimbleGen's SeqCap EZ). This region encompassed the entire genomic footprint of ALK as well as 150 kb of upstream sequence. After the genomic DNA was fragmented (E220, Covaris), barcoded sequence libraries (New England Biolabs, Kapa Biosystems) were prepared, and hybridization capture on barcoded pools was performed using custom probes (Nimblegen SeqCap). 250 ng of genomic DNA was used for library construction from 7 separate samples: 2 melanoma tumors (MM-15, MM-74), 1 anaplastic thyroid carcinoma (ATC-28), 2 lung cancer cell lines (H3122, H2228) with EML4-ALK translocations, 1 melanoma (SKMEL-28) and 1 control pool of 10 normal blood samples. Libraries were pooled at equimolar concentrations (100 ng per library) and used in the capture reaction as previously described..sup.34 To prevent off-target hybridization, we spiked in a pool of blocker oligonucleotides complementary to the full sequences of all barcoded adaptors. The captured libraries were sequenced on an Illumina HiSeq 2500 to generate 75-bp paired-end reads. Sequence data were de-multiplexed using CASAVA, and aligned to the reference human genome (hg19) using BWA..sup.35
(123) Local realignment and quality score recalibration were performed using the Genome Analysis Toolkit (GATK) according to GATK best practices..sup.36 A mean unique target sequence coverage of 1778 per sample (range: 1293x-2188x) was achieved. Sequence data were analyzed to identify single nucleotide variants, small insertions/deletions (indels), and structural rearrangements. Single nucleotide variants were called using muTect.sup.37 and were compared to the negative control pool (pooled normal blood samples). Variants were retained if the variant allele frequency in the tumor was >5 times than in the negative control and the frequency in the negative control was <0.02. Validated SNPs in the dbSNP database were filtered out. Indels were called using the SomaticIndelDetector tool in GATK.sup.36 and were retained if the tumor harbored >3 supporting reads and the frequency in the negative control was <0.02. DELLY was used to search for structural rearrangements..sup.38
(124) Bisulfite Sequencing of the Entire ALK Locus.
(125) Custom capture of the entire ALK locus was performed using custom hybridisation capture probes tiling the entire genomic footprint of ALK (900kb, chr2:29400000-30300000) followed by bisulfite sequencing. After fragmentation (E220, Covaris) of 3 g genomic DNA of each sample (MM-15, ATC-28, H3122 and SKMEL-28), libraries were prepared with the KAPA Hyper Prep Kit (#KR0961, Kapa Biosystems) without PCR amplification to preserve the methylation status. 1 g of each barcoded library was pooled at equimolar concentrations and captured according to the manufacturer's protocol (Roche/NimbleGen's SeqCap EZ). After washing the Dynabeads M-270 (#65306, Life Technologies), the non-biotinylated tumor/cell line DNA was dissociated from the biotinylated capture beads with 0.5M NaOH. The single stranded eluted DNA was used for bisulfite conversion using the EZ DNA Methylation-Gold Kit (#D5005, Zymo Research) according to the manufacturer's protocol, except for the 98 C. denaturation step. After bisulfite conversion, the KAPA HiFi Uracil PCR polymerase (#KK280, Kapa Biosystems) was used to amplify the library, the reaction with Agencourt AMPure XP beads (A63881, Beckman Coulter) was purified, and the library was sequenced on an Illumina MiSeq with a 150 bp paired-end protocol according to the manufacturer's instructions. Sequence data were aligned to hg19 and analyzed using BISMARK.sup.53. The methylation level at CpG sites was compared across all samples; no methylation was detected in the CHG and CHH contexts. Methylation was first computed as the number of methylated CpG reads vs. the number of total reads covering each CpG site (sites with <10 reads were excluded). A sliding window was used to determine the mean methylation level for every 250 bp region (with at least three CpGs) near the ALK promoter region (chr2:29,444,000-29,452,000). Differential methylation was evaluated using a Mann-Whitney test.
(126) Whole-Genome Sequencing.
(127) Whole-genome sequencing was performed at the New York Genome Center (New York). Briefly, genomic DNA libraries were prepared from MM-15 and ATC-28 (no matched normal DNA was available) using the Illumina PCR-free kit. Libraries were sequenced on a HiSeq 2500 using Illumina's 100 bp paired-end whole-genome sequencing protocol. Sequence reads were mapped using BWA.sup.35 and processed using GATK.sup.36. Genome-wide analyses of mutations (HaplotypeCaller.sup.36), copy number alterations (FREEC).sup.54, and structural variations (CREST).sup.55 were performed. Mutations were annotated with the Ensembl Variant Effect Predictor.sup.56 and filtered to 13 remove common polymorphisms. Non-synonymous mutations along with copy number alterations and structural variations were visualised using Circos.sup.57.
(128) Array CGH.
(129) Genomic DNA samples were labeled using a Bioprime Array CGH Genomic Labeling Kit (#18095-011, Life Technologies) according to the manufacturer's instructions. Briefly, 1 g tumor DNA and reference DNA (#G1471, Promega) were differentially labeled with dCTP-Cy5 (#45-001-291, GE Healthcare), and dCTP-Cy3 (#45-001-290, GE Healthcare). Genome-wide analysis of DNA copy number changes was conducted using an oligonucleotide SurePrint G3 Human CGH Microarray (#G4447A, Agilent) containing 1 million probes according to the manufacturer's protocol. Slides were scanned using Agilent's microarray scanner G2505B and analyzed using Agilent Genomic Workbench.
(130) Interphase Fluorescence In Situ Hybridization (FISH).
(131) A commercially available ALK break-apart probe (#06N38-020, Abbott) was used according to the manufacturer's protocol. The probes were hybridized on 5 m-thick tissue sections. The number and localization of the hybridization signals was assessed in a minimum of 100 interphase nuclei with well-delineated contours. At least 10% of neoplastic cells had to show a split signal to report an ALK rearrangement.
(132) Northern Blot.
(133) Total RNA was extracted from fresh-frozen tissue or cell lines using Qiagen's RNeasy Mini Kit (#74104, Qiagen). Up to 10 g RNA was used for running formaldehyde-based Northern analysis according to the manufacturer's protocol using the RNA Ambion NorthernMax Kit (#AM1940, Ambion). After hybridisation with a 32P labelled probe, consisting of ALK exon 20-29, the membrane was washed and visualised.
(134) NanoString.
(135) Details of the nCounter Analysis System (NanoString Technologies) were reported previously..sup.39 In brief, two sequence-specific probes were constructed for ALK exons 1-19, intron 19, and exons 20-29, respectively. Four control genes (RPS13, RPL27, RPS20, ACTB) were used for normalization. The probes were complementary to a 100 base pair region of the target mRNA and are listed in
(136) Cell Lines.
(137) NIH-3T3 mouse embryonic fibroblast cells were obtained from the American Type Culture Collection (#CRL-1658, ATCC) and were maintained in DMEM. The Interleukin 3 (IL-3) dependent murine pro B cell line, Ba/F3, was obtained from The Deutsche Sammlung von Mikroorganismen und Zellkulturen (#ACC-300, DSMZ) and was cultured in RPMI supplemented with Interleukin 3 (1 ng ml; #403-ML-010, R&D Systems). Melan-a cells were provided by Dr. Dorothy Bennett (St. George's Hospital, University of London, London, UK).sup.40 and were maintained in RPMI supplemented with 200 nM of 12-O-tetradecanoylphorbol-13-acetate (TPA; #4174, Cell Signaling). For retrovirus production, 293T cells (#631507, Clontech) were purchased and cultured in DMEM. All cell culture media contained 10% FBS, L-glutamine (2 mM), penicillin (100 U ml-1), and streptomycin (100 g ml-1). All cells were cultured at 37 C. in 5% CO.sub.2.
(138) Plasmids.
(139) To investigate the functional roles and the activation of oncogenic signaling pathways, ALK.sup.ATI, EML4-ALK and ALK.sup.F1174L expression constructs were generated. For the ALK.sup.ATI vector, RNA from MM-15 was reverse-transcribed with anchored oligo(dT) primers into cDNA (#04379012001, Roche), PCR amplified with ALK specific primers 5-CACCATCCCATCTCCAGTCTGCTTC-3 [SEQ ID NO: 9] and 5-AGAGAAGTGAGTGTGCGACC-3 [SEQ ID NO: 10], and the PCR product was cloned into a pENTR vector (#K2400-20, Life Technologies). The full-length ALK plasmid (HsCD00079531) was purchased from the DF/HCC DNA Resource Core (http://plasmid.med.harvard.edu), and EML4-ALKv1 was synthesized at GeneArt (Life Technologies). Site-directed mutagenesis was performed using QuikChange (#200523, Agilent): For kinase-dead ALK.sup.ATI (ALK.sup.ATI-KD), the lysine in the ATP-binding site of the kinase domain was mutated to methionine (p.K1150M) in ALK.sup.ATI, and for ALK.sup.F1174L, a p.F1174L mutation was introduced into ALK.sup.WT. Plasmids were sub-cloned into a pMIG-w vector.sup.41 (#12282, www.addgene.org), resulting in MSCV-ALK.sup.variant-IRES-GFP constructs, which were confirmed by digestion and sequencing. An empty pMIG-w vector with green-fluorescent-protein (GFP) was used as control for all ALK expression experiments. To confirm the start codons, the three start codons were mutated from ATG to AAG. For co-immuno-precipitation, ALK.sup.ATI was cloned into pcDNA3.1/nV5-Dest (#12290-010, Life Technologies) and MSCV N-HA FLAG-Dest (#41033, Addgene). For bioluminescence imaging, a triple modality retroviral reporter plasmid (red fluorescent protein (RFP)thymidine kinaseluciferase).sup.42 was used.
(140) Stable Gene Expression.
(141) Retrovirus were produced in 293T cells by standard methods using ecotropic or amphotropic packaging vector and XtremeGene 9 (#06365809001, Roche). We harvested the virus-containing supernatant were harvested for 48, 64, 64 h and 72 hours after transfection. The supernatant was pooled, filtered through a 0.45 m PVDF membrane, and used for transduction in the presence of polybrene (8 g ml-1). Transduced stably expressing eGFP+ or RFP+ cells were sorted with a FACSAria II (BD Biosciences).
(142) Co-Immunoprecipitation.
(143) V5-ALK.sup.ATI and HA-ALK.sup.ATI was transiently transfected into 293T cells and after 24 hours, cells were lysed in 10 mM Tris HCl pH 7.5, 1% Triton X-100, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, 1 mM PMSF, proteinase/phosphatase inhibitors. After incubation and centrifugation, 100 l supernatant was used as input, and 300 l for immunoprecipitation using the following antibodies: 2 g of anti-V5 antibody (#MA1-81617, Thermo Scientific), 10 l of EZview Red Anti-HA Affinity Gel (#E6779-1ML, Sigma), 2 g of anti-mouse IgG (#sc-2025, Santa Cruz). 20 l of Protein A/G UltraLink Resin (#53133, Thermo Scientific) were used for immunoprecipitation. The immune-precipitated material was eluted in 4 SDS loading buffer for immunoblotting.
(144) In Vitro Kinase Assay.
(145) Stably transduced NIH-3T3 cells were grown in a 15 cm dish, washed in PBS, and lysed in 20 mM Tris pH 8.0, 1% NP-40, 125 mM NaCl, 2.5 mM MgCl2, 1 mM EDTA with proteinase/phosphatase inhibitor. Lysates were incubated on ice, centrifuged, pre-cleared with 25 l Protein A/G UltraLink Resin (#53133, Thermo Scientific) for 30 min at 4 C. under rotation, and immunoprecipitated with 10 l ALK (D5F3) XP Rabbit mAb (#3633) and 25 l Protein A/G UltraLink Resin. After rotation for 120 min at 4 C., the immunoprecipitated material was washed and used according to the instructions of Universal Tyrosine Kinase Assay Kit (#MK410, Clontech). After the enzymatic reaction, the immunoprecipitated material was mixed with 4 SDS loading buffer for immunoblotting.
(146) Immunohistochemistry.
(147) Immunohistochemistry was performed on archival FFPE tumor specimens using a standard multimer/DAB detection protocol on a Discovery Ultra system (Roche/Ventana Medical Systems) with appropriate negative and positive controls. The following antibodies were purchased from Cell Signaling and were diluted in Signal Stain Antibody Diluent (#8112, Cell Signaling) as indicated: ALK (D5F3) XP Rabbit mAb (#3633) 1:250, Phospho-Akt (Ser473) (D9E) Rabbit mAb (#4060) 1:50, Phospho-Stat3 (Tyr705) (D3A7) Rabbit mAb (#9145) 1:400, Phospho-56 Ribosomal Protein (Ser235/236) (D57.2.2E) Rabbit mAb (#4858) 1:400, Phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) (D13. 14.4E) Rabbit mAb (#4370) 1:400, cleaved Caspase-3 (Asp175) Antibody (#9661) 1:400. The Anti-Ki67 antibody was purchased from Abcam (#ab15580) and was diluted 1:600.
(148) Immunofluorescence.
(149) Stably transduced NIH-3T3 cells were grown on coverslips, fixed in 4% formaldehyde, washed in PBS for 15 min at room temperature, washed in PBS for 10 min, and incubated in blocking solution (5% goat serum, 0.1% Triton X-100 in PBS) for 1 hour at room temperature. After aspirating blocking solution, cells were incubated with an ALK (D5F3) Rabbit mAb (#3633, Cell Signaling Technology) diluted 1:1000 in blocking buffer overnight at 4 C. After washing the cells 3 with 0.05% Tween 20 and PBS, cells were incubate with a secondary antibody (#A-11012, Life Technologies) diluted 1:500 in blocking buffer for 2 hours at room temperature. After washing in PBS, slides were mounted with Prolong Gold Antifade Reagent with DAPI (#8961, Cell Signaling Technology) and imaged with a Leica TCS SP5 II confocal microscope.
(150) Immunoblot.
(151) Cell lysates were prepared in RIPA buffer (#9806, Cell Signaling) supplemented with Halt protease and phosphatase inhibitor cocktail (#78440, Thermo Scientific). Equal amounts of protein, as measured by BCA protein assay (#23225, Thermo Scientific), were resolved in NuPAGE Novex 4-12% Bis-Tris Protein Gels (#NP0321BOX, Life Technologies) and transferred electrophoretically onto a Nitrocellulose 0.45 m membrane (#162-0115, BioRad). Membranes were blocked for 1 hour at room temperature in 50% Odyssey Blocking Buffer in PBS (#927-40000, LI-COR) and were incubated overnight at 4 C. with the primary antibodies diluted at 1:1000 in 50% Odyssey Blocking Buffer in PBS plus 0.1% Tween 20. Following primary antibodies were used: Anti-a-Tubulin antibody (#T9026-.5ML, Sigma-Aldrich), Anti-VS (#MA1-81617, Thermo Scientific), and anti-HA3F10 (#12158167001, Roche); Cell Signaling Technology: Phospho-ALK (Tyr1604) Rabbit mAb (#3341), ALK (D5F3) Rabbit mAb (#3633), Phospho-Akt (5er473) (D9E) Rabbit mAb (#4060), Akt (pan) (11E7) Rabbit mAb (#4685), Phospho-Stat3 (Tyr705) (D3A7) Rabbit mAb (#9145), Stat3 (79D7) Rabbit mAb (#4904), Phospho-56 Ribosomal Protein (5er235/236) (D57.2.2E) Rabbit mAb (#4858), S6 Ribosomal Protein (5G10) Rabbit mAb (#2217), Phospho-p44/42 MAPK (Erk1/2) (Thr202/Tyr204) (D13.14.4E) Rabbit mAb (#4370), p44/42 MAPK (Erk1/2) (137F5) Rabbit mAb (#4695), Phospho-MEK1/2 (5er221) (166F8) Rabbit mAb (#2338), MEK1/2 Antibody (#9122). After 4 washes of 5 minutes in PBST, membranes were incubated withsecondary antibodies (IRDye 800CW Goat anti-Rabbit #926-32211, 1:20,000, LI-COR; IRDye 680RD Goat anti-Mouse #926-68070, 1:20,000, LI-COR) in 50% Odyssey Blocking Buffer in PBS plus 0,1% Tween 20 for 45 minutes at room temperature. After another 4 washes in PBS-T and a final wash with PBS, membranes were scanned with a LI-COR Odyssey CLx scanner and adjusted using LI-COR Image Studio.
(152) Luciferase Reporter Assay.
(153) The long terminal repeat in ALK intron 19 at the ATI site (LTR16B2, chr2:29,446,649-29,447,062; 414 bp) was amplified using genomic DNA from patient MM-15 and 5-GTCCTCATGGCTCAGCTTGT-3 and 5-AGCACTACACAGGCCACTTC-3 primers. The PCR product (chr2:29,446,444-29,447,174; 731 bp) was cloned into pGL4.14-firefly luciferase vector (#E6691, Promega). To determine the promoter activity of LTR16B2, 10.sup.5 cells were transfected with 500m pGL4.14-LTR16B2 or vector alone; as internal control, 200 g pRL-TK Renilla luciferase reporter vector (#E2241, Promega) was co-transfected. Luciferase activity was measured using Dual-Glo Luciferase Assay System (#E2920, Promega) 48 hours after transfection. Promoter activity was calculated by normalising firefly luciferase activity to the control Renilla luciferase activity and compared between pGL4.14-LTR16B2 and vector alone.
(154) Flow Cytometry and Fluorescence-Activated Cell Sorting (FACS).
(155) Flow cytometry analysis for in vitro transformation assays with Ba/F3 cells was performed on a LSRFortessa (BD Biosciences). GFP- or RFP-positive cells were sorted using a FITC (blue laser) or PE (yellow laser) channel, respectively, on a FACSAria II configured with 5 lasers (BD Biosciences).
(156) In Vitro Transformation and Drug Treatment Assays.
(157) Ba/F3 cells were stably transduced with MSCV-ALK.sup.variant-IRES-GFP constructs with a multiplicity of infection (MOI) of 0.26. Based on the MOI calculations, 78% of cells were uninfected, 20% of cells were infected with one virus particle, and 2% of cells were infected by more than one viral particle. Stably transduced Ba/F3 cells were cultured in RPMI medium supplemented with IL-3 (1 ng ml-1) and the transduction rate of 20% was validated using flow cytometry for GFP, that was co-expressed with the ALK variants. For the cell proliferation assay, transduced Ba/F3 cells were transferred into IL-3 depleted RPMI medium and cell growth was quantified every 2-4 days with a luminescence assay (#G7571, Promega). For cell viability assays (ALK inhibitor)-dose response curve, 2000 Ba/F3 cells were plated in quadruplicates in wells of 96-well plates with increasing concentrations of the ALK inhibitors crizotinib (#C-7900, LC laboratories), TAE684 (#CT-TAE684, ChemieTek), or ceritinib (#CT-LDK378, ChemieTek) as indicated. All drugs were suspended in DMSO. The cell viability was assessed after 72 hours by a luminescence assay CellTiter-Glo (#G7571, Promega). Results were normalized to growth of cells in a medium containing an equivalent volume of DMSO. The inhibition curve was determined with GraphPad Prism 6.0 software using the log(inhibitor) vs. response variable slope non-linear regression model. For western blot analysis, 10 million Ba/F3 cells were harvested after 2 hours treatment with crizotinib, washed in ice-cold PBS and lysed in RIPA buffer (#9806, Cell Signaling).
(158) In Vivo Tumourigenicity and Drug Treatment Assays.
(159) All animal experiments were performed in accordance with a protocol approved by MSKCC Institutional Animal Care and Use Committee. 10.sup.6 cells stably transfected NIH-3T3 or melan-a cells were re-suspended in 50 l of 1:1 mix of PBS and Matrigel (#356237, BD Biosciences) and the cells were subcutaneously injected into the flanks of 6-8 weeks old female CB17-SCID mice (#CB17SC-F, Taconic). For tumor growth assays, 4 mice were injected with each cell line and 8 tumors were assessed. Tumor sizes were measured with calipers every 2 to 7 days for a period of up to 100 days. For in vivo drug sensitivity studies, 8 mice were injected with the stably transduced NIH-3T3 cells expressing a luciferase reporter construct and the indicated plasmids. When the tumors reached an average size of 200-250 mm.sup.3, mice were randomized in a vehicle and or treat group. Mice were orally gavaged once a day with crizotinib (100 mg/kg/d) or vehicle. 8 tumors were measured with calipers every 2 to 3 days and growth curves were visualized with Prism GraphPad 6.0. In parallel, tumor growth was monitored by bioluminescence imaging of anesthetized mice by retro-orbitally injecting d-luciferin (150 mg per kg body weight) and imaging with the IVIS Spectrum Xenogen machine (Caliper Life Sciences). After euthanizing the mice, tumors were explanted either lysed in RIPA buffer (#9806, Cell Signaling Technology), or fixed overnight in 4% paraformaldehyde, washed, embedded in paraffin, and sectioned for hematoxylin-and-eosin (RE) staining or immunohistochemistry.
(160) Statistics.
(161) All statistical comparisons between two groups were performed by GraphPad Prism software 6.0 using a two-tailed unpaired t test.
(162) Results and Discussion
(163) To identify novel mechanisms of oncogene activation, transcriptome analyses (RNA-seq) of metastatic melanoma and thyroid carcinoma were performed. An algorithm.sup.9 was used to investigate the differential expression of exons in receptor tyrosine kinases (RTKs). The analysis was focused on transcripts with a high expression of the kinase domain. A novel ALK transcript in two melanoma (MM-15, MM-74) and in one anaplastic thyroid carcinoma (ATC-28) was identified. The novel transcript contained the ALK exons 20-29 preceded by 400 base pairs of intron 19, but not exons 1-19 (
(164) To evaluate if the novel ALK transcript arises from alternative transcriptional initiation (ATI), a 5-rapid amplification of cDNA ends (5-RACE) was performed. The ATI site was mapped to a 25-bp region in intron 19 and the presence of the novel transcript was confirmed and termed as ALK.sup.ATI by Northern blot (
(165) To determine the prevalence of ALK.sup.ATI expression, more than 5000 samples from 15 different cancer types in the TCGA RNA-seq dataset were screened. ALK.sup.ATI was expressed in 11% of melanoma (38 of 334 tumors) and sporadically in other cancer types, including lung adenocarcinoma, lung squamous cell carcinoma, clear cell renal cell carcinoma, and breast carcinoma (
(166) To accurately quantify ALK.sup.ATI expression in clinical specimens, a NanoString nCounter assay with probe sets in ALK exons 1-19, intron 19, and exons 20-29 was developed.sup.51 (
(167) To determine whether somatic genomic aberrations at the ALK locus contribute to the establishment of the de novo ATI site, comprehensive genetic analyses including interphase fluorescence in situ hybridisation (FISH), genome-wide array-CGH, whole-genome sequencing, and ultra-deep sequencing of the entire ALK locus were performed, results of which are shown in
(168) The ALK ATI region contains transposable elements, including a long-terminal repeat
(169) (LTR) in intron 19 and a long-interspaced element (LINE) in intron 18, both of which can regulate transcription.sup.44,45 (
(170) 5-RACE (5-rapid amplification of cDNA ends) coupled with next-generation sequencing was used to determine the ALK.sup.ATI transcript. The ATI site was mapped to a 25 base pairs (bps) region in intron 19, approximately 400 bp upstream of ALK exon 20 (
(171) Immunoblots of two ALK-expressing neuroblastoma cell lines and two EML4-ALK variant-expressing lung cancer cell lines showed proteins at the expected MW of 220 kDa for ALK.sup.WT (and a smaller cleavage product lacking part of the extracellular region.sup.49) and of 120 kDa and 90 kDa for two EML4-ALK variants. ATKATI-expressing tumors revealed a double band at 60 kDa, suggesting that ALKATI is translated from more than one start codon (
(172) The ALK.sup.ATI proteins were phosphorylated in tumors with endogenous ALK.sup.ATI expression and in cells with exogenous ALK.sup.ATI expression (
(173) Based on the analysis of the GTEx RNA-seq dataset, ALK.sup.ATI is not expressed in normal tissues. To establish the functional consequences of ALK.sup.ATI expression, Ba/F3, NIH-3T3, and melan-a cells were stably transduced with ALK.sup.ATI, negative controls (ALK.sup.ATI, empty vector), and positive controls (the oncogenic ALK variants ALK.sup.F1174L, EML4-ALK, and ALK.sup.WT, which was previously shown to be sufficient to drive oncogenesis at high endogenous expression levels.sup.6,12,58-61). In Ba/F3 cells, ALK.sup.ATI expression led to IL-3-independent cell growth, as did the positive controls, but not the negative controls (
(174) In summary, all of the ALK-variant expressing cells (ALK.sup.ATI, ALK.sup.F1174L, EML4-ALK, ALK.sup.WT) were able to establish growth factor-independent proliferation and tumorigenesis, with similar growth rates once the tumors were established. Importantly, the observed oncogenic capacity of ALK.sup.WT is consistent with previous reports that high endogenous expression or amplification of ALK.sup.WT drives oncogenesis and confers sensitivity to ALK inhibitors in neuroblastomas.sup.10,12,58-61. To further explore the pathogenic role of ALK.sup.ATI expression levels, NIH-3T3 cells were stably transduced with either a low or high titre of ALK.sup.ATI resulting in cells expressing ALK.sup.ATI at either low or at high levels. It was found that a further increase in ALK.sup.ATI expression levels did not accelerate tumor graft formation and tumor growth indicating that ALKATI can drive tumourigenesis once a threshold of expression is reached (
(175) To examine the therapeutic responses to pharmacologic ALK inhibition, Ba/F3 cells stably expressing various ALK isoforms were treated with three different ALK inhibitors (crizotinib, ceritinib, TAE-684). All ALK inhibitors effectively inhibited IL-3-independent growth of ALK-transformed Ba/F3 cells, whereas they had no effect on growth in the presence of IL-3 (
(176) Based on this encouraging pre-clinical data, a patient with metastatic melanoma with ALK.sup.ATI expression was identified (
(177) Taken together, a novel ALK transcript, ALK.sup.ATI, which arises independently of genomic aberrations at the ALK locus through alternative transcriptional initiation, was identified. ALK.sup.ATI encodes shortened ALK proteins that are capable of driving oncogenesis in vitro and in vivo. ALK.sup.ATI-driven tumors are sensitive to ALK inhibitors, suggesting that patients harboring such tumors could potentially benefit from ALK inhibitor therapy, but may not be identified using current clinical genomic assays, particularly those based on DNA sequencing. Importantly, alternative transcriptional initiation was discovered as a novel mechanism for oncogene activation, in addition to well-established genetic mechanisms such as mutations, translocations or amplifications. Other oncogenes may be activated via similar mechanisms in other human malignancies and their identification may provide new insights into oncogenesis and opportunities for therapeutic intervention.
REFERENCES
(178) 1. Consortium, G. T. The Genotype-Tissue Expression (GTEx) project. Nat Genet 45, 580-5 (2013). 2. Lawrence, M. S. et al. Mutational heterogeneity in cancer and the search for new cancer-associated genes. Nature 499, 214-8 (2013). 3. Lawrence, M. S. et al. Discovery and saturation analysis of cancer genes across 21 tumor types. Nature 505, 495-501(2014). 4. Comprehensive molecular characterization of human colon and rectal cancer. Nature 487, 330-7 (2012). 5. Comprehensive genomic characterization of squamous cell lung cancers. Nature 489, 519-25 (2012). 6. Vogelstein, B. et al. Cancer genome landscapes. Science 339, 1546-58 (2013). 7. Imielinski, M. et al. Mapping the hallmarks of lung adenocarcinoma with massively parallel sequencing. Cell 150, 1107-20 (2012). 8. Weinstein, J. N. et al. The Cancer Genome Atlas Pan-Cancer analysis project. Nat Genet 45, 1113-20 (2013). 9. Anders, S., Reyes, A. & Huber, W. Detecting differential usage of exons from RNA-seq data. Genome Res 22, 2008-17 (2012). 10. Mosse, Y. P. et al. Identification of ALK as a major familial neuroblastoma predisposition gene. Nature 455, 930-5 (2008). 11. Chen, Y. et al. Oncogenic mutations of ALK kinase in neuroblastoma. Nature 455, 971-4 (2008). 12. Janoueix-Lerosey, I. et al. Somatic and germline activating mutations of the ALK kinase receptor in neuroblastoma. Nature 455, 967-70 (2008). 13. George, R. E. et al. Activating mutations in ALK provide a therapeutic target in neuroblastoma. Nature 455, 975-8 (2008). 14. Morris, S. W. et al. Fusion of a kinase gene, ALK, to a nucleolar protein gene, NPM, in non-Hodgkin's lymphoma. Science 263, 1281-4 (1994). 15. Soda, M. et al. Identification of the transforming EML4-ALK fusion gene in non-small-cell lung cancer. Nature 448, 561-6 (2007). 16. Lipson, D. et al. Identification of new ALK and RET gene fusions from colorectal and lung cancer biopsies. Nat Med 18, 382-4 (2012). 17. Kouzarides, T. Chromatin modifications and their function. Cell 128, 693-705 (2007). 18. Ram, O. et al. Combinatorial patterning of chromatin regulators uncovered by genome-wide location analysis in human cells. Cell 147, 1628-39 (2011). 19. Wang, Z. et al. Combinatorial patterns of histone acetylations and methylations in the human genome. Nat Genet 40, 897-903 (2008). 20. Mitelman, F., Johansson, B. & Mertens, F. The impact of translocations and gene fusions on cancer causation. Nature reviews. Cancer 7, 233-45 (2007). 21. Cazes, A. et al. Characterization of rearrangements involving the ALK gene reveals a novel truncated form associated with tumor aggressiveness in neuroblastoma. Cancer Res 73, 195-204 (2013). 22. Okubo, J. et al. Aberrant activation of ALK kinase by a novel truncated form ALK protein in neuroblastoma. Oncogene 31, 4667-76 (2012). 23. Horn, S. et al. TERT promoter mutations in familial and sporadic melanoma. Science 339, 959-61 (2013). 24. Huang, F. W. et al. Highly recurrent TERT promoter mutations in human melanoma. Science 339, 957-9 (2013). 25. Lappalainen, T. et al. Transcriptome and genome sequencing uncovers functional variation in humans. Nature 501, 506-11(2013). 26. Li, H. et al. The Sequence Alignment/Map format and SAMtools. Bioinformatics 25, 2078-9 (2009). 27. Trapnell, C., Pachter, L. & Salzberg, S. L. TopHat: discovering splice junctions with RNA-Seq. Bioinformatics 25, 1105-11(2009). 28. Sboner, A. et al. FusionSeq: a modular framework for finding gene fusions by analyzing paired-end RNA-sequencing data. Genome Biol 11, R104 (2010). 29. McKenna, A. et al. The Genome Analysis Toolkit: a MapReduce framework for analyzing next-generation DNA sequencing data. Genome Res 20, 1297-303 (2010). 30. Robinson, J. T. et al. Integrative genomics viewer. Nat Biotechnol 29, 24-6 (2011). 31. Carbon, S. et al. AmiGO: online access to ontology and annotation data. Bioinformatics 25, 288-9 (2009). 32. Chi, P. et al. ETV1 is a lineage survival factor that cooperates with KIT in gastrointestinal stromal tumors. Nature 467, 849-53 (2010). 33. Zhang, Y. et al. Model-based analysis of ChIP-Seq (MACS). Genome Biol 9, R137 (2008). 34. Won, H. H., Scott, S N., Brannon, A. R., Shah, R. H. & Berger, M. F. Detecting somatic genetic alterations in tumor specimens by exon capture and massively parallel sequencing. J Vis Exp, e50710 (2013). 35. Li, H. & Durbin, R. Fast and accurate short read alignment with Burrows-Wheeler transform. Bioinformatics 25, 1754-60 (2009). 36. DePristo, M. A. et al. A framework for variation discovery and genotyping using next-generation DNA sequencing data. Nat Genet 43, 491-8 (2011). 37. Cibulskis, K. et al. Sensitive detection of somatic point mutations in impure and heterogeneous cancer samples. Nat Biotechnol 31, 213-9 (2013). 38. Rausch, T. et al. DELLY: structural variant discovery by integrated paired-end and split-read analysis. Bioinformatics 28, i333-i339 (2012). 39. Geiss, G. K. et al. Direct multiplexed measurement of gene expression with color-coded probe pairs. Nat Biotechnol 26, 317-25 (2008). 40. Bennett, D. C., Cooper, P. J. & Hart, I. R. A line of non-tumorigenic mouse melanocytes, syngeneic with the B16 melanoma and requiring a tumor promoter for growth. Int J Cancer 39, 414-8 (1987). 41. Refaeli, Y., Van Parijs, L., Alexander, S. I. & Abbas, A. K. Interferon gamma is required for activation-induced death of T lymphocytes. J Exp Med 196, 999-1005 (2002). 42. Ponomarev, V. et al. A novel triple-modality reporter gene for whole-body fluorescent, bioluminescent, and nuclear noninvasive imaging. Eur J Nucl Med Mol Imaging 31, 740-51 (2004). 43. Northcott, P. A. et al. Enhancer hijacking activates GFI1 family oncogenes in medulloblastoma. Nature 511, 428-434 (2014). 44. Karolchik, D. et al. The UCSC Table Browser data retrieval tool. Nucleic Acids Res 32, D493-496 (2004). 45. Xie, M. et al. DNA hypomethylation within specific transposable element families associates with tissue-specific enhancer landscape. Nat Genet 45, 836-841 (2013). 46. Consortium, E. P. An integrated encyclopedia of DNA elements in the human genome. Nature 489, 57-74 (2012). 47. Cab, E. & Wysocka, J. Modification of enhancer chromatin: what, how, and why? Mol Cell 49, 825-837 (2013). 48. Grant, C. E., Bailey, T. L. & Noble, W. S. FIMO: scanning for occurrences of a given motif Bioinformatics 27, 1017-1018 (2011). 49. Moog-Lutz, C. et al. Activation and inhibition of anaplastic lymphoma kinase receptor tyrosine kinase by monoclonal antibodies and absence of agonist activity of pleiotrophin. J Biol Chem 280, 26039-26048 (2005). 50. Lemmon, M. A. & Schlessinger, J. Cell signaling by receptor tyrosine kinases. Cell 141, 1117-1134 (2010). 51. Reis, P. P. et al. mRNA transcript quantification in archival samples using multiplexed, color-coded probes. BMC Biotechnol 11, 46 (2011). 52. Mathelier, A. et al. JASPAR 2014: an extensively expanded and updated open-access database of transcription factor binding profiles. Nucleic Acids Res 42, D142-147 (2014). 53. Krueger, F. & Andrews, S. R. Bismark: a flexible aligner and methylation caller for Bisulfite-Seq applications. Bioinformatics 27, 1571-1572 (2011). 54. Boeva, V. et al. Control-free calling of copy number alterations in deep-sequencing data using GC-content normalization. Bioinformatics 27, 268-269 (2011). 55. Wang, J. et al. CREST maps somatic structural variation in cancer genomes with base-pair resolution. Nat Methods 8, 652-654 (2011). 56. McLaren, W. et al. Deriving the consequences of genomic variants with the Ensembl API and SNP Effect Predictor. Bioinformatics 26, 2069-2070 (2010). 57. Krzywinski, M. et al. Circos: an information aesthetic for comparative genomics. Genome Res 19, 1639-1645 (2009). 58. Schulte, J. H. et al. High ALK receptor tyrosine kinase expression supersedes ALK mutation as a determining factor of an unfavorable phenotype in primary neuroblastoma. Clin Cancer Res 17, 5082-5092 (2011). 59. Passoni, L. et al. Mutation-independent anaplastic lymphoma kinase overexpression in poor prognosis neuroblastoma patients. Cancer Res 69, 7338-7346 (2009). 60. Bresler, S. C. et al. Differential inhibitor sensitivity of anaplastic lymphoma kinase variants found in neuroblastoma. Sci Transl Med 3, 108-114 (2011). 61. Montavon, G. et al. Wild-type ALK and activating ALK-R1275Q and ALKF1174L mutations upregulate Myc and initiate tumor formation in murine neural crest progenitor cells. Oncotarget 5, 4452-4466 (2014). 62. Wiesner, T. et al. Kinase fusions are frequent in Spitz tumors and spitzoid melanomas. Nat Commun 5, 3116 (2014)
(179) Various publications are cited herein, the contents of which are hereby incorporated by reference in their entireties.