ANTI-PD-L1 SINGLE-DOMAIN ANTIBODIES
20220372150 · 2022-11-24
Assignee
Inventors
- GAOFENG YAO (HANGZHOU, ZHEJIANG, CN)
- ZHENXING ZHOU (HANGZHOU, ZHEJIANG, CN)
- YONGLU CHEN (HANGZHOU, ZHEJIANG, CN)
- ZHIYU YANG (HANGZHOU, ZHEJIANG, CN)
- JIALI DONG (HANGZHOU, ZHEJIANG, CN)
- XIAOFANG WEN (HANGZHOU, ZHEJIANG, CN)
- YANSHAN HUANG (HANGZHOU, ZHEJIANG, CN)
Cpc classification
C07K2317/569
CHEMISTRY; METALLURGY
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C07K2319/31
CHEMISTRY; METALLURGY
A61K35/00
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
The present disclosure provides a class of specific anti-PD-L1 single-domain antibodies that block PD-L1/PD-1 interaction, and humanized antibodies, fusion proteins, and pharmaceutical compositions prepared based on the single-domain antibodies, and use thereof.
Claims
1. An anti-PD-L1 single-domain antibody, having a complementarity determining region (CDR) comprising CDR1-CDR3 having amino acid sequences shown below: (1) CDR1 as shown in SEQ ID NO: 6, CDR2 as shown in SEQ ID NO: 15, and CDR3 as shown in SEQ ID NO: 25; or (2) CDR1 as shown in SEQ ID NO: 7, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 26; or (3) CDR1 as shown in SEQ ID NO: 8, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 27; or (4) CDR1 as shown in SEQ ID NO: 9, CDR2 as shown in SEQ ID NO: 17, and CDR3 as shown in SEQ ID NO: 28; or (5) CDR1 as shown in SEQ ID NO: 7, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 29; or (6) CDR1 as shown in SEQ ID NO: 10, CDR2 as shown in SEQ ID NO: 18, and CDR3 as shown in SEQ ID NO: 30.
2. The single-domain antibody according to claim 1, wherein the anti-PD-L1 single-domain antibody further comprises framework regions (FR), comprising FR1-FR4 having amino acid sequences shown below: (1′) FR1 as shown in SEQ ID NO: 1, FR2 as shown in SEQ ID NO: 11, FR3 as shown in SEQ ID NO: 19, and FR4 as shown in SEQ ID NO: 31; or (2′) FR1 as shown in SEQ ID NO: 2, FR2 as shown in SEQ ID NO: 12, FR3 as shown in SEQ ID NO: 20, and FR4 as shown in SEQ ID NO: 31; or (3′) FR1 as shown in SEQ ID NO: 3, FR2 as shown in SEQ ID NO: 13, FR3 as shown in SEQ ID NO: 21, and FR4 as shown in SEQ ID NO: 31; or (4′) FR1 as shown in SEQ ID NO: 4, FR2 as shown in SEQ ID NO: 13, FR3 as shown in SEQ ID NO: 22, and FR4 as shown in SEQ ID NO: 31; or (5′) FR1 as shown in SEQ ID NO: 5, FR2 as shown in SEQ ID NO: 12, FR3 as shown in SEQ ID NO: 23, and FR4 as shown in SEQ ID NO: 32; or (6′) FR1 as shown in SEQ ID NO: 5, FR2 as shown in SEQ ID NO: 14, FR3 as shown in SEQ ID NO: 24, and FR4 as shown in SEQ ID NO: 31.
3. The single-domain antibody according to claim 1, wherein the anti-PD-L1 single-domain antibody comprises: (a) a single-domain antibody having an amino acid sequence as shown in any one of SEQ ID NOs: 33-38; or (b) a single-domain antibody having an amino acid sequence that has sequence identity of 80% or above to the sequence as shown in any one of SEQ ID NOs: 33-38, and having functions of the (a) single-domain antibody.
4. The single-domain antibody according to claim 1, wherein the anti-PD-L1 single-domain antibody is a humanized antibody, wherein preferably, a framework region (FR) of the single-domain antibody comprises FR1-FR4 having amino acid sequences selected from the group consisting of: FR1 as shown in SEQ ID NO: 3; FR2 as shown in SEQ ID NO: 59-61; FR3 as shown in SEQ ID NO: 62-64; and FR4 as shown in SEQ ID NO: 65.
5. The single-domain antibody according to claim 1 or wherein the anti-PD-L1 single-domain antibody is a humanized antibody, and comprises: (i) a single-domain antibody having an amino acid sequence as shown in SEQ ID NO: 39-44; or (ii) a single-domain antibody having an amino acid sequence that has sequence identity of 80% or above to the sequence as shown in any one of SEQ ID NOs: 39-44, and having functions of the (i) single-domain antibody.
6. A fusion protein, comprising: a first domain, which is an anti-PD-L1 single-domain antibody, wherein the anti-PD-L1 single-domain antibody has a complementarity determining region (CDR) comprising CDR1-CDR3 having amino acid sequences shown below: (1) CDR1 as shown in SEQ ID NO: 6, CDR2 as shown in SEQ ID NO: 15, and CDR3 as shown in SEQ ID NO: 25; or (2) CDR1 as shown in SEQ ID NO: 7, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 26; or (3) CDR1 as shown in SEQ ID NO: 8, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 27; or (4) CDR1 as shown in SEQ ID NO: 9, CDR2 as shown in SEQ ID NO: 17, and CDR3 as shown in SEQ ID NO: 28; or (5) CDR1 as shown in SEQ ID NO: 7, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 29; or (6) CDR1 as shown in SEQ ID NO: 10, CDR2 as shown in SEQ ID NO: 18, and CDR3 as shown in SEQ ID NO: 30; and a second domain, having an effect of extending the half-life and/or binding to effector cells.
7. The fusion protein according to claim 6, wherein the second domain comprises: an immunoglobulin Fc region, preferably a human immunoglobulin Fc region; and/or serum albumin or a fragment thereof, a domain that binds to serum albumin, polyethylene glycol, a polyethylene glycol-liposome complex, or a combination thereof; and/or a molecule that has an affinity for surface molecules of T cells and/or are capable of binding to a surface molecule present on T cells, wherein preferably, the surface molecule comprises CD3.
8. The fusion protein according to claim 7, wherein the human immunoglobulin Fc region comprises a mutation for altering an Fc-mediated effector function, wherein the effector function comprises CDC activity, ADCC activity, ADCP activity, or a combination thereof; or the immunoglobulin is selected from IgG, IgA1, IgA2, IgD, IgE, IgM, or a combination thereof; and the IgG is selected from IgG1, IgG2, IgG3, or IgG4 subtype, or a combination thereof; or the amino acid sequence of the immunoglobulin Fc region is one selected from SEQ ID NOs: 45-48; or a linking peptide is provided between the first domain and the second domain; and the linking peptide is preferably selected from a flexible polypeptide chain consisting of alanine and/or serine and/or glycine, and has a length of preferably 3-30 amino acids.
9. An isolated polynucleotide, encoding a single-domain antibody according to claim 1; or encoding a fusion protein comprising a first domain which is a single-domain antibody as in claim 1 and a second domain having an effect of extending the half-life and/or binding to effector cells.
10. A construct, comprising an isolated polynucleotide according to claim 9.
11. An antibody expressing system, comprising a construct including an isolated polynucleotide according to claim 9 or having a genome integrated with an exogenous polynucleotide according to claim 9, wherein preferably, the expressing system is a cell expression system.
12. A method for producing an anti-PD-L1 single-domain antibody or a fusion protein, comprising: under conditions suitable for expressing the antibody, expressing the antibody or fusion protein using the antibody expressing system according to claim 11; and preferably, the method further comprises purifying and isolating the antibody or fusion protein, wherein the anti-PD-L1 single-domain antibody has a complementarity determining region (CDR) comprising CDR1-CDR3 having amino acid sequences shown below: (1) CDR1 as shown in SEQ ID NO: 6, CDR2 as shown in SEQ ID NO: 15, and CDR3 as shown in SEQ ID NO: 25; or (2) CDR1 as shown in SEQ ID NO: 7, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 26; or (3) CDR1 as shown in SEQ ID NO: 8, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 27; or (4) CDR1 as shown in SEQ ID NO: 9, CDR2 as shown in SEQ ID NO: 17, and CDR3 as shown in SEQ ID NO: 28; or (5) CDR1 as shown in SEQ ID NO: 7, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 29; or (6) CDR1 as shown in SEQ ID NO: 10, CDR2 as shown in SEQ ID NO: 18, and CDR3 as shown in SEQ ID NO: 30; and the fusion protein comprises a first domain which is the anti-PD-L1 single-domain antibody and a second domain having an effect of extending the half-life and/or binding to effector cell.
13. An immunoconjugate, comprising: (A) a single-domain antibody according to claim 1 or a fusion protein comprising a first domain which is a single-domain antibody as in claim 1 and a second domain having an effect of extending the half-life and/or binding to effector cells, and (B) a functional molecule linked to (A).
14. The immunoconjugate according to claim 12, wherein (B) comprises a cytotoxin, a radioisotope, a biologically active protein, a molecule targeting a tumor surface marker, a tumor-suppressing molecule, a molecule or detectable marker that targets a surface marker of an immune cell, or an extracellular hinge region, a transmembrane region and intracellular signaling region based on chimeric antigen receptor technology, or a combination thereof; preferably, the molecule targeting the tumor surface marker is an antibody or ligand that binds to the tumor surface marker; or the tumor-suppressing molecule is an anti-tumor cytokine or anti-tumor toxin.
15. A pharmaceutical composition, comprising a single-domain antibody according to claim 1, a fusion protein comprising a first domain which is a single-domain antibody as in claim 1 and a second domain having an effect of extending the half-life and/or binding to effector cells, or an immunoconjugate comprising (A) the single-domain antibody or the fusion protein and (B) a functional molecule linked to (A).
16. The pharmaceutical composition according to claim 15, further comprising a pharmaceutically acceptable carrier.
17. The use of a single-domain antibody according to claim 1, a fusion protein, an immunoconjugate, or a pharmaceutical composition in the preparation of formulations, kits, or pharmaceutical packs for the diagnosis, treatment or prevention of cancers, wherein the fusion protein comprises: a first domain, which is a single-domain antibody as in claim 1; and a second domain having an effect of extending the half-life and/or binding to effector cells; the immunoconjugate comprises: (A) the single-domain antibody or the fusion protein; and (B) a functional molecule linked to (A); and the pharmaceutical composition comprises: the single-domain antibody, the fusion protein, or the immunoconjugate.
18. The use according to claim 17, wherein the cancers comprise lung cancer, melanoma, gastric cancer, ovarian cancer, colon cancer, liver cancer, kidney cancer, bladder cancer, breast cancer, classic Hodgkin lymphoma, hematological malignancies, head and neck cancer or nasopharyngeal cancer, or a combination thereof.
19. The use of the single-domain antibody according to claim 1, a fusion protein, an immunoconjugate, or a pharmaceutical composition in preparation of formulations, kits, or pharmaceutical packs for the treatment or prevention of infectious diseases or chronic inflammatory diseases, wherein the fusion protein comprises: a first domain, which is a single-domain antibody as in claim 1; and a second domain having an effect of extending the half-life and/or binding to effector cells; the immunoconjugate comprises: (A) the single-domain antibody or the fusion protein; and (B) a functional molecule linked to (A); and the pharmaceutical composition comprises: the single-domain antibody, the fusion protein, or the immunoconjugate.
20. A kit or pharmaceutical pack, comprising a single-domain antibody according to claim 1, a fusion protein, an immunoconjugate, or a pharmaceutical composition, wherein the fusion protein comprises: a first domain, which is a single-domain antibody as in claim 1; and a second domain having an effect of extending the half-life and/or binding to effector cells; the immunoconjugate comprises: (A) the single-domain antibody or the fusion protein; and (B) a functional molecule linked to (A); and the pharmaceutical composition comprises: the single-domain antibody, the fusion protein, or the immunoconjugate.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0039]
[0040]
[0041]
[0042]
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS
[0043] After extensive screening and in-depth research, the present inventors disclose a class of specific anti-PD-L1 single-domain antibodies that block PD-L1/PD-1 interaction; humanized antibodies and fusion proteins prepared based on the single-domain antibodies; and use thereof.
Terms
[0044] As used herein, the terms “programmed death ligand 1”, “PD-ligand 1”, “PD-L1”, “PDL1”, “B7 homologue 1”, “B7-H1”, and “CD274” are used interchangeably, and include variants, isotypes, species homologues of human PD-L1 and analogs with at least one common epitope of PD-L1.
[0045] Regardless of a heavy-chain antibody or a conventional 4-chain antibody, the term “antibody” or “immunoglobulin” herein is a general term to include a full-length antibody, a single chain, and a moiety, domain or fragment (including, but not limited to, an antigen binding domain or fragment, e.g. VHH domain or VH/VL domain) thereof. Moreover, as used herein, the term “sequence” (e.g. in the terms “immunoglobulin sequence”, “antibody sequence”, “single variable domain sequence”, “VHH sequence” or “protein sequence” etc.) is generally understood to include both a relevant amino acid sequence, and a nucleic acid sequence or nucleotide sequence encoding the sequence, unless otherwise specifically defined herein.
[0046] The term “monoclonal antibody” refers to a preparation of antibody molecules consisting of a single molecule. Monoclonal antibodies show a single binding specificity and affinity for a specific epitope.
[0047] The term “domain” (of a polypeptide or protein) refers to a folded protein structure that is able to maintain a tertiary structure independently of other moieties of the protein. Generally, the domain is responsible for an individual functional property of the protein, and can be, in many cases, added, removed or transferred to other proteins without compromising the functions of other moieties and/or domains of the protein.
[0048] The term “single domain antibody (VHH)” refers to a heavy chain variable region of a cloned antibody, and a single-domain antibody (VHH) constructed to consist of only one heavy chain variable region is the smallest antigen-binding fragment with complete functionality. Usually, an antibody with natural deletion of light chain and heavy chain constant region 1 (CH1) is derived from alpaca immune serum, and then a heavy chain variable region of the antibody is cloned, to construct a single-domain antibody (VHH) consisting of only one heavy chain variable region.
[0049] The term “single domain antibody (VHH)” refers to an immunoglobulin domain including four “framework regions” that are referred to as “framework region1” or “FR1”, “framework region 2” or “FR2”, “framework region 3” or “FR3”, and “framework region 4” or “FR4” in the art and hereinafter. The framework regions are spaced apart by three “complementarity determining regions” or “CDRs” that are referred to as “complementarity determining region 1” or “CDR1”, “complementarity determining region 2” or “CDR2”, and “complementarity determining region 3” or “CDR3” in the art and hereinafter. Therefore, the general structure or sequence of a single-domain antibody (VHH) can be expressed as FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. A single-domain antibody (VHH) confers an antigen binding specificity to the antibody due to the presence of an antigen-binding site.
[0050] The term “heavy-chain single-domain antibody”, “VHH domain”, “VHH”, “VHH antibody fragment”, “VHH antibody” and “nanobody” are used interchangeably.
[0051] The term “IMGT numbering system” is an integrated information system dedicated for immunoglobulins (IGs), T cell receptors (TCRs) and major histocompatibility complexes (MHCs) of humans and other vertebrates, that is, THE INTERNATIONAL IMMUNOGENETICS INFORMATION SYSTEM® (Lafranc et al., 2003, Dev.Comp.Immunol. 27(1):55-77). Log on to IMGT (http://www.imgt.org/ IMGT_vquest) to analyze the light and heavy chains of an antibody, so as to determine the framework regions (FRs) and complementarity determining regions CDRs) of the variable region. The “position” of CDRs within the structure of immunoglobulin variable domains is conserved between species, and exists in a structure called loop. By using a numbering system that aligns variable domain sequences according to structural features, CDRs and framework residues can be easily identified. The information can be used to graft and insert CDR residues of an immunoglobulin from one species into a receptor framework usually from a human antibody. Unless otherwise indicated, in the specification, claims and drawings, the anti-PD-L1 single-domain antibodies are numbered according to the IMGT numbering system, to determine the CDR and FR regions.
[0052] The term “humanized antibody” refers to a molecule having an antigen-binding site substantially derived from an immunoglobulin from a non-human species, where the rest of the immunoglobulin structure of the molecule is based on the structure and/or sequence of a human immunoglobulin. The antigen binding site may include a complete variable domain fused to a constant domain, or only include a complementarity determining region (CDR) grafted into an appropriate framework region in the variable domain. The antigen binding site can be wild-type, or modified by one or more amino acid substitutions. For example, modifications are made to allow the antibody to be more similar to human immunoglobulins. Some forms of humanized antibodies retain all CDR sequences (e.g., a humanized single-domain antibody including all three CDRs from alpaca). Other forms have one or more CDRs that have been altered relative to the original antibody.
[0053] The term “protein aggregate” means that the protein structures are stabilized by non-covalent interactions and a disulfide linkage between two cysteine residues. The noncovalent interaction includes ionic interactions and weak van der Waals interactions. The ionic interaction is formed between anions and cations, and form a salt bridge, to stabilize the protein. It plays an important role in the secondary structure, for example, in the formation of alpha helices or beta sheets, and in the tertiary structure of proteins. The interactions between amino acid residues in a particular protein are very important in the final structure of that proteins. Commonly in the industrial preparation of active proteins in vitro or extracellularly, when for example, the pH, concentration, ionic strength or temperature changes in the environment where the active protein is present, noncovalent interactions between amino acids are changed, causing that the exposed hydrophobic moiety of one protein molecule may interact with the exposed hydrophobic moiety of other protein molecules, to form an amorphous aggregate, an oligomer and a high molecular weight aggregate. The aggregate affects the stability of active proteins. The in-vivo formation of aggregates easily triggers a clearance response by the immune system, which accelerates the drug clearance and may cause an immune risk to the body.
[0054] The “sequence identity” between two polypeptide sequences indicates the percentage of identical amino acids between the sequences. The “sequence similarity” indicates the percentage of identical or conservatively substituted amino acids among sequences. Methods for assessing the degree of sequence identity between amino acid sequences or nucleotide sequences are known to those skilled in the art. For example, the amino acid sequence identity is typically determined by sequence analysis software. For example, the identity can be determined using the BLAST program of the NCBI database.
[0055] An “effective amount” of an agent refers to an amount necessary to cause a physiological change in a cell or tissue to which it is administered.
[0056] A “therapeutically effective amount” of an agent, such as a pharmaceutical composition, refers to an amount effective for achieving the desired therapeutic or prophylactic result at a dosage level and for a period of time. A therapeutically effective amount of an agent can, for example, eliminate, reduce, delay, minimize or prevent the adverse effects of a disease.
[0057] An “individual” or “subject” is a mammal, including, but not limited to, domesticated animals (e.g. cows, sheep, cats, dogs and horses), primates (e.g. humans and non-human primates such as monkeys), rabbits and rodents (e.g. mice and rats). Preferably, the individual or subject is a human.
[0058] The term “pharmaceutical composition” refers to a preparation in a form that allows the biological activity of the active ingredient contained therein to be effective, and do not contain other ingredients that would be unacceptably toxic to subjects to whom the composition would be administered.
[0059] “Pharmaceutically acceptable carrier” refers to an ingredient other than the active ingredient in a pharmaceutical composition that is not toxic to the subject. The pharmaceutically acceptable carriers include, but are not limited to, buffers, excipients, stabilizers or preservatives.
[0060] The term “treating/preventing” (and its grammatical variants) refers to an attempt to alter the natural progress of a disease in a treated individual, and can be prevention or clinical intervention implemented during the course of clinical pathology. The desired effect of treatment includes, but is not limited to, preventing the occurrence or recurrence of diseases, alleviating the symptoms, relieving any direct or indirect pathological consequences of the disease, preventing the metastasis, slowing the rate of disease progression, improving or lessening the disease states, and relieving or improving the prognosis. In some embodiments, the antibody of the present disclosure is useful for delaying the development of a disease or delaying the progression of a disorder.
[0061] The term “detectable marker” refers to a marker that can be attached to an antibody, and used to determine the presence or amount of a specific target in a subject to be tested. The “detectable marker” may be, but is not limited to: an enzyme, a fluorescent label, a radionuclide, quantum dots, or colloidal gold, etc.; and more specifically, for example, horseradish peroxidase (HRP), alkaline phosphatase (AP), glucose oxidase, β-D-galactosidase, urease, hydrogen peroxidase, or glucoamylase.
[0062] In the present disclosure, the cancer or tumor includes, but is not limited to, lung cancer, melanoma, gastric cancer, ovarian cancer, colon cancer, liver cancer, kidney cancer, bladder cancer, breast cancer, classic Hodgkin lymphoma, hematological malignancies, head and neck cancer or nasopharyngeal cancer, or a combination thereof, and also metastases or complications thereof.
Single-Domain Antibody
[0063] In a first aspect of the present disclosure, an anti-PD-L1 single-domain antibody is provided. Complementarity determining region (CDR) of the anti-PD-L1 single-domain antibody includes CDR1-CDR3 having amino acid sequences shown below: (1) CDR1 as shown in SEQ ID NO: 6, CDR2 as shown in SEQ ID NO: 15, and CDR3 as shown in SEQ ID NO: 25; or (2) CDR1 as shown in SEQ ID NO: 7, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 26; or (3) CDR1 as shown in SEQ ID NO: 8, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 27; or (4) CDR1 as shown in SEQ ID NO: 9, CDR2 as shown in SEQ ID NO: 17, and CDR3 as shown in SEQ ID NO: 28; or (5) CDR1 as shown in SEQ ID NO: 7, CDR2 as shown in SEQ ID NO: 16, and CDR3 as shown in SEQ ID NO: 29; or (6) CDR1 as shown in SEQ ID NO: 10, CDR2 as shown in SEQ ID NO: 18, and CDR3 as shown in SEQ ID NO: 30.
[0064] The anti-PD-L1 antigen single-domain antibody provided in the present disclosure may include a framework region FR. The framework region FR includes FR1-FR4 having amino acid sequences shown below: (1′) FR1 as shown in SEQ ID NO: 1, FR2 as shown in SEQ ID NO: 11, FR3 as shown in SEQ ID NO: 19, and FR4 as shown in SEQ ID NO: 31; or (2′) FR1 as shown in SEQ ID NO: 2, FR2 as shown in SEQ ID NO: 12, FR3 as shown in SEQ ID NO: 20, and FR4 as shown in SEQ ID NO: 31; or (3′) FR1 as shown in SEQ ID NO: 3, FR2 as shown in SEQ ID NO: 13, FR3 as shown in SEQ ID NO: 21, and FR4 as shown in SEQ ID NO: 31; or (4′) FR1 as shown in SEQ ID NO: 4, FR2 as shown in SEQ ID NO: 13, FR3 as shown in SEQ ID NO: 22, and FR4 as shown in SEQ ID NO: 31; or (5′) FR1 as shown in SEQ ID NO: 5, FR2 as shown in SEQ ID NO: 12, FR3 as shown in SEQ ID NO: 23, and FR4 as shown in SEQ ID NO: 32; or (6′) FR1 as shown in SEQ ID NO: 5, FR2 as shown in SEQ ID NO: 14, FR3 as shown in SEQ ID NO: 24, and FR4 as shown in SEQ ID NO: 31.
[0065] The antigen-binding property of the antibody is usually determined by three complementarity determining regions (CDRs), where the CDR regions and FR regions are arranged in order, and the FR regions do not directly participate in the binding reaction. These CDRs form a loop structure, and are spatially close to each other by means of the β-sheets formed by the FRs therebetween, to form the antigen-binding site of the antibody. The CDR regions are sequences of proteins of immunological interest, and the CDR regions of the antibody of the present disclosure are completely new.
[0066] The amino acid sequence of the anti-PD-L1 antigen single-domain antibody provided in the present disclosure may include: a) an amino acid sequence shown in one of SEQ ID NOs: 33-38; or, b) an amino acid sequence having 80% or more sequence identity to one of SEQ ID NO: 33-38, and having the functions of the amino acid sequence defined in a). Specifically, the amino acid sequence in b) specifically refers to a polypeptide fragment derived from the amino acid sequence as shown in one of SEQ ID NOs: 33-38 by the substitution, deletion or addition of one or more (specifically 1-50, 1-30, 1-20, 1-10, 1-5, or 1-3) amino acids, or by the addition or deletion of one or more (specifically 1-50, 1-30, 1-20, 1-10, 1-5, or 1-3) amino acids at the N- and/or C-terminus, and having the functions of a polypeptide fragment having an amino acid sequence as shown in one of SEQ ID NOs: 33-38, for example, the ability to specifically bind to PD-L1. The amino acid sequence as shown in b) may have at least 80%, 85%, 90%, 93%, 95%, 97%, or 99% sequence homology or sequence identity to one of SEQ ID NO: 33-38. The anti-PD-L1 single-domain antibody provided in the present disclosure can specifically bind to human PD-L1, block the interaction between PD-L1 and PD-1, increase the expression of IFN-γ and/or IL-2 in T lymphocytes, and inhibit the tumor growth.
[0067] The anti-PD-L1 single-domain antibody provided in the present disclosure can be a humanized antibody, and the humanized single-domain antibody can retain at least one of the functional properties of the antibody, for example, the ability to specifically bind to PD-L1 or block the interaction between PD-L1 and PD-1. On the basis of use of the specific complementarity determining regions in the present disclosure, humanized antibodies designed according to techniques in the art are all embraced in the present disclosure.
[0068] In a preferred embodiment of the present disclosure, a naturally occurring single-domain antibody from Camelidae is humanized by the present inventors, to further improve the drug safety, and effectively reduce the immunogenicity of the antibody. Fully humanized heavy chain antibodies often have the problem of protein aggregation caused by poor solubility, and thus fail to be used in actual clinical practice. Decreased solubility of the single-domain antibody due to humanization may attribute to their lack of a light chain that a natural monoclonal antibody paired with (Front Immunol. 2017 Nov. 22;8:1603). The humanized antibody with modified framework region obtained in the present disclosure still maintains a high solubility, making it feasible for use in practical clinical application. In a specific embodiment of the present disclosure, the amino acid sequences of the anti-PD-L1 humanized single-domain antibody are as shown in SEQ ID NO: 39-44.
Fusion Protein
[0069] In a second aspect of the present disclosure, a fusion protein of an anti-PD-L1 single-domain antibody is provided, which includes a first domain of the single-domain antibody provided in the first aspect of the present disclosure and a second domain for prolonging the half-life in vivo and/or having the ability to bind to effector cells. The fusion protein can be a binding molecule, which can specifically bind to cells expressing PD-L1.
[0070] In the second domain, the fragment for extending the half-life in vivo may include serum albumin or a fragment thereof, polyethylene glycol, a domain binding to serum albumin (such as a single-domain antibody against serum albumin), or a polyethylene glycol-liposome complex, etc. In the second domain, the fragment capable of binding to effector cells may include an Fc region of an immunoglobulin molecule, etc., and preferably an Fc region of a human immunoglobulin molecule. The Fc region of a human immunoglobulin includes a mutation for altering the Fc-mediated effector functions, where the effector functions include CDC activity, ADCC activity, ADCP activity, or a combination thereof. The immunoglobulin is selected from IgG, IgA1, IgA2, IgD, IgE, IgM, or a combination thereof. IgG is specifically selected from IgG1, IgG2, IgG3, or IgG4 subtype, or a combination thereof. The Fc region of an immunoglobulin contained in the fusion protein of a single-domain antibody makes the fusion protein form a dimer, prolong the in vivo half-life of the fusion protein and increase the related activity mediated by Fc. In a specific embodiment of the present disclosure, the Fc region of an immunoglobulin can be the Fc region of human IgG1, and more specifically Fc sequence of wild-type IgG1. A mutation that alters Fc-mediated effector function can be introduced into the sequence, for example, a) a mutation that alters the Fc-mediated CDC activity; b) a mutation that alters the Fc-mediated ADCC activity; or a) a mutation that alters the Fc-mediated ADCP activity. Such mutations are described in: Leonard G Presta, Current Opinion in Immunology 2008, 20:460-470; Esohe E. Idusogie et al., J Immunol 2000, 164:4178-4184; RAPHAEL A. CLYNES et al., Nature Medicine, 2000, Volume 6, Number 4:443-446; Paul R. Hinton et al., J Immunol, 2006, 176:346-356. In another specific embodiment of the present disclosure, the Fc region of the immunoglobulin has an amino acid sequence selected from SEQ ID NOs: 45-48.
[0071] In the fusion protein of the anti-PD-L1 single-domain antibody provided in the present disclosure, a linker peptide may be included, which connects the first domain and the second domain. The linker peptide may be a flexible polypeptide chain consisting of alanine (A) and/or serine (S) and/or glycine (G), having a length of 3-30 amino acids, preferably 3-9, 9-12, 12-16, 16-20 amino acids. In another specific embodiment of the present disclosure, the linker peptide may have a length of 8 or 15 amino acids.
Isolated Polynucleotide
[0072] In a third aspect of the present disclosure, an isolated polynucleotide is provided, which encodes the single-domain antibody provided in the first aspect of the present disclosure, or the fusion protein provided in the second aspect of the present disclosure. The polynucleotide may be RNA, DNA or cDNA, etc. Methods of providing the isolated polynucleotide are known to those skilled in the art, for example, preparation by automatic DNA synthesis and/or recombinant DNA technology, or isolation from a suitable natural source.
Construct
[0073] In a fourth aspect of the present disclosure, a construct is provided. The construct includes the isolated polynucleotide provided in the third aspect of the present disclosure. A method of constructing the construct is known to those skilled in the art. For example, the construct can be obtained by in-vitro recombinant DNA technology, DNA synthesis technology, or in-vivo recombinant technology. More specifically, it can be constructed by inserting the isolated polynucleotide into a polyclonal site of an expression vector. The expression vector in the present disclosure generally refers to various commercially available expression vectors well known in the art, for example, bacterial plasm ids, bacteriophages, yeast plasmids, plant cell-infected viruses, mammalian cell-infected viruses such as adenovirus, retrovirus or other vectors. The vector may also include one or more regulatory sequences operably linked to the polynucleotide sequence, where the regulatory sequence may include a suitable promoter sequence. The promoter sequence is usually operably linked to a sequence coding the amino acid sequence to be expressed. The promoter can be any nucleotide sequence that exhibits transcriptional activity in the selected host cell, including mutated, truncated and hybrid promoters, and can be obtained from a gene encoding an extracellular or intracellular polypeptide homologous or heterologous to the host cell. The regulatory sequence may further include a suitable transcription terminator sequence, a sequence recognized by the host cell to terminate the transcription. The terminator sequence is linked to the 3′ end or terminus of the nucleotide sequence encoding the polypeptide, and any terminator that is functional in the host cell of choice may be used in the present disclosure.
[0074] Generally, a suitable vector may contain an origin of replication capable in at least one organism, a promoter sequence, a convenient restriction enzyme site and one or more selectable markers. For example, these promoters may include, but not limited to, the lac or trp promoter of Escherichia coli (E. coli); the lambda phage PL promoter; and eukaryotic promoters (including CMV immediate-early promoter, HSV thymidine kinase promoter, early and late SV40 promoters, methanol oxidase promoter of Pichia pastoris), and some other known promoters that are capable of controlling gene expression in prokaryotic cells or eukaryotic cells or viruses. Marker genes can be used to provide phenotypic characters for selection of transformed host cells. For example, marker genes may include, but not limited to, dihydrofolate reductase, neomycin resistance and green fluorescent protein (GFP) for eukaryotic cell culture, or tetracycline resistance or ampicillin resistance for E. coli. When the polynucleotide is expressed, the expression vector may further include an enhancer sequence. If an enhancer sequence is inserted into the vector, the transcription will be enhanced. Enhancer is a cis-acting factor of DNA, typically containing about 10 to 300 base pairs. Enhancer acts on a promoter to enhance gene transcription.
Expression System
[0075] In a fifth aspect of the present disclosure, an antibody expression system is provided, which includes a construct provided in the fourth aspect or incorporates an exogenous polynucleotide provided in the third aspect of the present disclosure in the genome. Any cell suitable for the expression of an expression vector can be used as a host cell. For example, the host cell can be a prokaryotic cell, such as a bacterial cell; or a lower eukaryotic cell, such as a yeast cell; or a higher eukaryotic cell, such as a mammalian cell, specifically including, but not limited to, Escherichia coli, Streptomyces; bacterial cells of Salmonella typhimurium; or fungal cells such as yeast, and filamentous fungi; plant cells; insect cells derived from Drosophila S2 or Sf9; animal cells such as CHO, COS, HEK293 cells, or Bowes melanoma cells, or a combination thereof. Methods for constructing the expression system should be known to those skilled in the art, for example, including, but not limited to, microinjection, gene gun method, electroporation, virus-mediated transformation, electron bombardment, precipitation with calcium phosphate, or a combination thereof.
Immunoconjugate
[0076] In a sixth aspect of the present disclosure, an immunoconjugate is provided, which includes the single-domain antibody provided in the first aspect of the present disclosure, or the fusion protein provided in the second aspect of the present disclosure. Generally the immunoconjugate may further includes a functional molecular linked to the single-domain antibody or fusion protein (including but not limited to covalent linkage, conjugation, attachment, and adsorption). The functional molecule may include, but not limited to, “detectable markers”, cytotoxins, radioisotopes, biologically active proteins, molecules targeting tumor surface marker, tumor-suppressing molecules, molecules that target surface markers of immune cells, or a combination thereof.
[0077] Methods of preparing the immunoconjugate is known to those skilled in the art. For example, the single-domain antibody and/or fusion protein can be linked to the functional molecule directly or through a spacer of a suitable length, by chemical cross-linking or genetic engineering such as fusion expression, to obtain the immunoconjugate.
[0078] For therapeutic purposes, a therapeutic effector group such as a radioactive group may be suitable. The radioactive group are composed of a radioisotope or radionuclide (such as .sup.3H, .sup.14C, .sup.15N, .sup.33P, .sup.35S, .sup.90Y, 99T.sub.c, 111In, .sup.123, .sup.125I, .sup.131I, .sup.201TI, .sup.213Bi), a toxin, or a cytotoxic group such as a cytostatic agent, or a group including the same.
[0079] The immunoconjugate may include the single-domain antibody or fusion protein of the present disclosure and a detectable marker. The detectable marker includes, but not limited to: a fluorescent marker, a developing marker, or a protein tag; such as an enzyme, a prosthetic group, a fluorescent material, a luminescent material, a bioluminescent material, a radioactive material, a positron-emitting metal and a non-radioactive paramagnetic metal ion. More than one markers may also be included. The labels used to label antibodies for detection and/or analysis and/or diagnostic purposes depend on the particular detection/analysis/diagnostic technique and/or method used, such as immunohistochemical staining of (tissue) samples, and flow cytometry, etc. Suitable labels for detection/analysis/diagnostic techniques and/or methods are well known to those skilled in the art.
[0080] The single-domain antibody or fusion protein of the present disclosure can be coupled with a labeling group (labeled polypeptide), and then used e.g. for diagnostic purposes. Suitable labeling groups may be selected from radioisotopes (such as those mentioned above) or groups containing radioisotopes orradionuclides, fluorophores (e.g. fluorescent proteins such as GFP and RFP, dyes, rhodamine, fluoresceins and derivatives thereof such as FITC and cyanine dyes), enzyme groups (e.g. horseradish peroxidase, alkaline phosphatase, and β-galactosidase), chemiluminescent groups, biotin groups, metal particles (e.g. gold particles), magnetic particles (for example, having cores containing magnetite (Fe.sub.3O.sub.4) and/or maghemite (Fe.sub.2O.sub.3)), and intended polypeptide groups, etc.
[0081] The immunoconjugate may include the single-domain antibody or fusion protein of the present disclosure and a molecule targeting a surface marker of immune cells. The molecule targeting a surface marker of immune cells can recognize immune cells, and carry the antibody of the present disclosure to reach immune cells. Also, the antibody of the present disclosure can target the immune cells to tumor cells, to exert the killing effect of the antibody of the present disclosure, and trigger the immune cells to specifically kill tumor cells.
[0082] The immunoconjugate may include the single-domain antibody or fusion protein of the present disclosure and at least one molecule targeting a tumor surface marker or a tumor-suppressing molecule. The tumor-suppressing molecule can be an anti-tumor cytokine, or an antitumor toxin. For example, the cytokine can be, but not limited to, IL-12, IL-15, IFN-beta, or TNF-alpha. The molecule targeting a tumor surface marker, for example, can take effects synergistically with the antibodies of the present disclosure, to more accurately target the tumor cells.
[0083] The immunoconjugate may further be a chimeric antigen receptor (CAR) expressed on immune cells. The term “immune cells” and “immune effector cells” are used interchangeably, and include T lymphocytes, NK cells or NKT cells, and preferably, NK cells and T lymphocytes. The chimeric antigen receptor generally includes an extracellular binding region, a transmembrane region and an intracellular signaling region connected in sequence. The extracellular binding region includes the single-domain antibody or fusion protein of the present disclosure. The design of the transmembrane region and the intracellular signaling region based on CAR technology is well known in the art. For example, the transmembrane region may be selected from CD8, CD28 and other molecules; and the intracellular signaling region is a CD3ζ chain of immunoreceptor tyrosine activation motif (ITAM), an FcεRly tyrosine activation motif or an intracellular signaling region of costimulatory signal molecules CD28, CD27, CD137, CD134, MyD88, CD40, and others. More specifically, For T lymphocytes, the first-generation CAR T lymphocytes only include ITAM in the intracellular signaling region, and the chimeric antigen receptor is linked in a pattern of scFv-TM-ITAM, to stimulate the anti-tumor cytotoxic effect. The second-generation CAR T lymphocytes has incorporated the intracellular signaling region of CD28 or CD137 (also known as 4-1BB), and the chimeric antigen receptor is linked in a pattern of scFv-TM-CD28 -ITAM or scFv-TM-/CD137-ITAM, where the co-stimulation of B7/CD28 or 4-1BBL/CD137 in the intracellular signaling region causes the continuous proliferation of T lymphocytes, increases the level of cytokines such as IL-2 and IFN-γ secreted by T lymphocytes, and improves the survival period and anti-tumor effect of CAR T in vivo. In the third-generation CAR T lymphocytes, the chimeric antigen receptor is linked in a pattern of scFv-TM-CD28-CD137-ITAM or scFv-TM-CD28-CD134-ITAM, further improving the survival period and anti-tumor effect of CAR T in vivo.
[0084] As described above, the chimeric antigen receptor prepared with the single-domain antibody or fusion protein of the present disclosure can include the following extracellular binding region, transmembrane region and intracellular signaling region linked in sequence: the single-domain antibody or fusion protein of the present disclosure, CD8 and CD3ζ; the single-domain antibody or fusion protein of the present disclosure, CD8, CD137 and CD3ζ; the single-domain antibody or fusion protein of the present disclosure, the transmembrane region (CD28a) of CD28 molecule, the intracellular signaling region (CD28b) of CD28 molecule, and CD3ζ; or, the single-domain antibody or fusion protein of the present disclosure, the transmembrane region of CD28 molecule, the intracellular signaling region of CD28 molecule, CD137 and CD3ζ.
[0085] Expression of the chimeric antigen receptor on the surface of immune effector cells, while exerting the killing effect of the antibody of the present disclosure, allows the immune effector cells to have a highly specific cytotoxic effect on tumor cells expressing PD-L1.
Pharmaceutical Composition
[0086] In a seventh aspect of the present disclosure, a pharmaceutical composition is provided, which includes an anti-PD-L1 single-domain antibody provided in the first aspect of the present disclosure, a fusion protein of an anti-PD-L1 single-domain antibody provided in the second aspect of the present disclosure, or an immunoconjugate provided in the sixth aspect of the present disclosure.
[0087] The pharmaceutical composition may also include various pharmaceutically acceptable carriers in the art. The pharmaceutically acceptable carrier is nontoxic to a recipient at the dose and concentration employed, and can specifically include, but not limited to, a buffering agent, such as an acetate, Tris, a phosphate, a citrate and other organic acids; an antioxidant, including ascorbic acid and methionine; a preservative (such as octadecyldimethylbenzylammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenols, butanol or benzyl alcohol; alkyl paraben, such as methylparaben or propylparaben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); a protein, such as serum albumin, gelatin or immunoglobulin; a hydrophilic polymer, such as polyvinylpyrrolidone; an amino acid, such as glycine, glutamine, asparagine, histidine, arginine or lysine; a monosaccharide, a disaccharides and other carbohydrates, including glucose, mannose or dextrin; a chelating agent, such as EDTA; a tonicity modifier, such as trehalose and sodium chloride; a carbohydrate, such as sucrose, mannitol, trehalose or sorbitol; a surfactant, such as polysorbate; a salt-forming counter ion, such as sodium; a metal complex (such as a Zn-protein complex); and/or a nonionic surfactant, such as TWEE®, PLURONICS® or polyethylene glycol (PEG). The pharmaceutical formulation to be used for in-vivo therapeutic administration are generally sterile, and methods for sterilizing the pharmaceutical formulation are known to those skilled in the art, for example, filtration through a sterile filtration membrane. Those skilled in the art can also select a suitable pharmaceutically acceptable carrier according to the desired dosage form of the pharmaceutical composition, to prepare different dosage forms. For example, the pharmaceutical composition of the present disclosure can include, but not limited to tablets, injections, lyophilized formulation, and other dosage forms.
[0088] In the pharmaceutical composition, the fusion protein and immunoconjugate are usually in an effective amount, where the content of the active ingredient corresponding to the effective amount can be determined according to the subject to be treated and the specific mode of administration. For example, based on the total weight of the pharmaceutical composition, the content of the fusion protein and immunoconjugate can be in the range of about 0.01-99%, 0.1-70%, 1-30%, 0.01-0.05%, 0.05-0.1%, 0.1-0.3%, 0.3-0.5%, 0.5-1%, 1-3%, 3-5%, 5-10%, 10-20%, 20-30%, 30-50%, 50-70%, or 70-99%.
[0089] The fusion protein, immunoconjugate and pharmaceutical composition of the present disclosure can be administered as a single active ingredient, or administered in a combination therapy, i.e., in combination with other drugs. For example, the combination therapy includes a combination of the fusion protein, the immunoconjugate or the pharmaceutical composition with at least one other anti-tumor drug. For example, the combination therapy includes a combination of the fusion protein, the immunoconjugate or the pharmaceutical composition with an antibody targeting another tumor-specific antigen. The antibody targeting another tumor-specific antigen includes, but not limited to, anti-EGFR antibody, anti-VEGF antibody, anti-HER2 antibody, or anti-Claudin18A2 antibody, or a combination thereof. The inhibitor is preferably a monoclonal antibody.
Detection Kit
[0090] In an eighth aspect of the present disclosure, a detection kit is provided, which includes a single-domain antibody provided in the first aspect of the present disclosure, a fusion protein provided in the second aspect of the present disclosure, or an immunoconjugate provided in the sixth aspect of the present disclosure. The kit may further include, as required, a container, a control (negative or positive control), a buffer, and an auxiliary agent, etc., which can be selected by those skilled in the art according to the specific situation. An instruction for use may also be included in the kit, for the convenience of operation by those skilled in the art.
[0091] The present disclosure further provides a detection method for detecting PD-L1 protein by using the single-domain antibody, including, but not limited to, qualitative detection, quantitative detection and localization detection. Particularly, the detection method includes, but not limited to, immunofluorescence assay, immunohistochemistry and radioimmunoassay, etc.
[0092] A method for detecting the presence or absence of PD-L1 protein in a sample includes: contacting the sample with a single-domain antibody of the present disclosure; and observing whether an antibody complex is formed, where the formation of the antibody complex indicates the presence of PD-L1 protein in the sample. The sample may be a cell and/or tissue sample; where the sample is immobilized or dissolved in a medium, and the level of PD-L1 protein in the immobilized or dissolved sample is detected. In some embodiments, the detection object can be a cell-containing sample in a cell preservation solution. In some other embodiments, the single-domain antibody is also conjugated with a fluorescent dye, a chemical material, a polypeptide, an enzyme, an isotope, and a label that can be used for detection or can be detected by other reagents.
Use
[0093] In a ninth aspect of the present disclosure, use of a single-domain antibody provided in the first aspect of the present disclosure, a fusion protein provided in the second aspect of the present disclosure, an immunoconjugate provided in the sixth aspect of the present disclosure, or a pharmaceutical composition provided in the eighth aspect of the present disclosure in the preparation of drugs for the diagnosis, treatment or prevention of diseases associated with cells expressing PD-L1.
[0094] The “therapeutically effective amount” of the fusion protein, the immunoconjugate, and the pharmaceutical composition provided in the present disclosure preferably causes a reduction in the severity of disease symptoms and increased frequency and duration of asymptomatic period of a disease, or prevents injury or disability due to illness or suffering. For example, for the treatment of PD-L1 -related tumors (including, for example, melanoma), relative to untreated subjects, the “therapeutically effective amount” preferably inhibits the cell growth or tumor growth by at least about 10%, preferably at least about 20%, more preferably at least about 30%, more preferably at least about 40%, more preferably at least about 50%, more preferably at least about 60%, more preferably at least about 70%, more preferably at least about 80%. The ability to inhibit tumor growth can be evaluated in an animal model system that predicts the efficacy against human tumors, or evaluated by detecting the ability to inhibit cell growth. Such inhibition can be determined in vitro by assays well known to those skilled in the art. The therapeutically effective amount of the fusion protein, the immunoconjugate, and the pharmaceutical compositions is often able to reduce the tumor size, or otherwise relieve the symptoms of a subject. Those skilled in the art can select an appropriate therapeutically effective dose according to the actual situation, for example, the size of the subject, the severity of the subject's symptoms, and the particular composition or route of administration chosen. A prescription for treatment (e.g., decision on dosage, etc.) may be determined by a physician commonly considering factors including, but not limited to, the disease being treated, status of the patient, delivery site, route of administration and other factors. A prophylactically effective amount refers to an amount effective for achieving the desired prophylactic effect at a dose and for a period of time required. Usually, but not necessarily, since a prophylactic dose is administered to a subject before the onset of a disease or at an early stage of the disease, the “prophylactically effective amount” is usually lower than the “therapeutically effective amount”. Examples of diseases associated with PD-L1 expressing cells that can be diagnosed, treated and/or prevented in the present disclosure may include all PD-L1 expressing cancers and tumor entities, specifically including, but not limited to, lung cancer, melanoma, gastric cancer, ovarian cancer, colon cancer, liver cancer, kidney cancer, bladder cancer, breast cancer, classic Hodgkin lymphoma, hematological malignancies, head and neck cancer and nasopharyngeal cancer, which may be early, intermediate, or advanced, such as, metastatic cancers.
[0095] The implementations of the present disclosure will be described below by way of specific examples, and other advantages and effects of the present disclosure are readily comprehensible to those skilled in the art from the disclosure of the present disclosure. The present disclosure can also be implemented or applied through other different specific embodiments, and various modifications or changes can be made to the details in the specification based on different viewpoints and applications, without departing from the spirit of the present disclosure.
[0096] Before further describing specific embodiments of the present disclosure, it should be understood that the protection scope of the present disclosure is not limited to the following specific embodiments. It should also be understood that the terms used in the examples of the present disclosure are for the purpose of describing specific embodiments, instead of limiting the scope of protection of the present disclosure.
[0097] When a numerical range is given in the example, it should be understood that both endpoints of each numerical range and any value between the two endpoints can be used, unless otherwise specified in the present disclosure. All technical and scientific terms used in the present disclosure have the same meaning as commonly understood by those skilled in the art, unless otherwise defined. In addition to the specific method, apparatus, and material used in the examples, according to the understanding of the prior art by those skilled in the art and the description of the present disclosure, any method, apparatus, apparatus, and material in the prior art that are the same as or similar to the method, apparatus, and material described in the examples of the present disclosure can be used to implement the present disclosure.
[0098] Unless otherwise stated, the experimental methods, detection methods, and preparation methods disclosed in the present disclosure are all conventional techniques used in molecular biology, biochemistry, chromatin structure and analysis, analytical chemistry, cell culture, and recombinant DNA technology in the art, as well as conventional techniques in related art. These techniques are well described in the existing literatures.
Example 1 Construction of Anti-PDL1 Single-Domain Antibody Library
[0099] 1 mg PDL1-HSA fusion protein (SEQ ID NO: 49) composed of PDL1 extracellular domain and human serum albumin was mixed with 1 ml of Freund's complete adjuvant (sigma), and emulsified. Healthy alpacas (Vicugnapacos) were immunized and then further immunized after 21 days for a total of three immunizations, to stimulate B cells to express the antigen-specific single-domain antibody. One week after the third-immunization, 30 ml of alpaca blood was collected with a vacuum blood collection tube, lymphocytes were separated using a lymphocyte separation medium (Tianjin HaoyangHuake Biotechnology Co., Ltd.), and total RNA was extracted by Trizol method. 3 μg of total RNA was reverse transcribed into cDNA using a reverse transcription kit (Invitrogen) according to the manufacturer's instructions, and VHH was amplified by nested PCR. The target VHH nucleic acid fragments were recovered, digested with restriction endonuclease Sfil (NEB), inserted into the digested phage display vector pcomb3xss (Addgene plasmid # 63890; RRID:Addgene_63890), and ligated by T4 ligase (Takara). The ligation product was transformed into electrocompetent cells ER2738, to construct an anti-PDL1single-domain antibody library. The cells were plated by gradient dilution, and the size of the library capacity was determined to be 1.25×10.sup.8. Further, 24 clones were randomly selected for PCR detection. The results show that the insertion rate of the constructed library was 100%.
Example 2 Screening and Identification of Anti-PDL1Single-Domain Antibody
[0100] 2.1. Screening of Anti-PDL1Single-Domain Antibody
[0101] The constructed anti-PDL1 single-domain antibody library was packaged with helper phage M13KO7 (NEB), and the titer of the recombinant phages in the display library was 2.88×10.sup.13 PFU/ml. PDL1-HSA was diluted with a coating buffer of 100 mM NaHC.sub.3(pH=8.2) to 2 μg/ml and added in 100 μL/well to a microtiter plate, and allowed to stand at 4° C. overnight. On the following day, 200 μL of 3% BSA was added to the plate and incubated at 37° C. for 1 hr. 100 μL of recombinant phage (about 2.88×10.sup.11PFU/well, obtained from the library constructed in Example 1) was added, and incubated for 1 hr at room temperature. Then the plate was washed 5 times with PBST (containing 0.1% Tween 20), to remove non-specifically binding phages. After washing, the plate was incubated for 10 min with 1 ml of 0.1 M gly-HCl and 1 mg/ml BSA (pH2.2) buffer and eluted off, and then neutralized with 1 M Tris-HCl pH 8.0. The phage titer of the above round of panning was 5.25×10.sup.6 PFU/ml. The phage eluted from the above round of panning was amplified, and the titer was 1.3×10.sup.13 PFU/ml. The fusion protein PDL1-Fc (SEQ ID NO: 50) composed of PDL1 extracellular domain sequence and human IgG1 Fc was used as a coating protein, 3% ovalbumin (OVA) was used for blocking, and the second round of panning was carried out following the same screening process. The titer of phage after the second round of panning was 2.54×10.sup.8 PFU/ml.
[0102] 2.2. Double Screening by Enzyme-Linked Immunosorbent Assay (ELISA) and TEPITOPE
[0103] 380 single clones were picked from the phage titer determination plate eluted after the second round of panning, cultured in 96-well plates, infected and packaged with M13KO7 helper phage, to obtain the accumulated recombinant phages in the supernatant. The plate was coated with PDL1-HSA in 200 ng/well, and blocked with 3% BSA for 1 hr at room temperature. ELISA was carried out in the presence of various concentrations of PD1-FC (SEQ ID NO: 51), a binding curve was plotted, and the EC90 was calculated to be 2.4 μg/m L. The monoclonal recombinant phage-containing supernatant were mixed in equal proportion with 4 μg/mL PD1-FC in a 96-well plate, and incubated in the 96-well plate coated with PDL1-HSA in an amount of 100 μl/well (where the well with only PD1-FC at a final concentration of 2 μg/mL was used as a control) at 37° C. for 1 hr. After washing three times with PBST, 100 μl of 1:20000 diluted HRP-Goat anti-Human IgG Fc(Novex) was added to each well, and the plate was incubated at 37° C. for 1 hr. After washing 3 times with PBS, a TMB developing solution (Beijing ComWin Biotech Co., Ltd) was added, and the plate was incubated for 5 min at room temperature for color development. 1 M sulfuric acid was added to stop the reaction, and the OD value was read at 450 nm. The PD1-Fc in the control well showed obvious color development (with an OD450 nm value of 3.375), and wells with phage competition-positive clones showed weak or almost no color development (with an OD450nm value of lower than 0.3). Competition-positive clones were sequenced, and the repeated clones were removed. The immunogenicity of the obtained high-affinity positive clones was further analyzed, and the scores of alleles DRB1*03:01, DRB1*07:01, DRB1*15:01, DRB3*01:01, DRB3*02:02, DRB4*01:01 and DRB5*01:01 which are closely related to human immunogenicity were calculated using the prediction tool TEPITOPE based on the QAM method (Sturniolo T et al., Nat. Biotechnol. 17:555-561). Furthermore, sequences with a total CDR3 TEPITOPE score above 4 were excluded to obtain highly humanized anti-PD-L1 single-domain antibodies after screening. Most of the total CDR3 TEPITOPE scores of the anti-PD-L1 single-domain antibodies obtained in the present disclosure are <-2.0, which are significantly lower than that of similar anti-PD-L1 single-domain antibodies, suggesting that the anti-PD-L1 single-domain antibodies of the present disclosure have a lower potential risk of immunogenicity.
[0104] After several rounds of screening, the present inventors finally picked out 6 positive anti-PDL1 single-domain antibody sequences which showed strong competition and low TEPITOPE scores. Their full-length sequences are shown in Table 1a, where the CDR regions are underlined.
TABLE-US-00001 TABLE 1a SEQ ID Full-length sequence NO: 1A7 QLQLVESGGDLVQPGGSLRLSCAAS IDWYRQPPGKQ 33 RELVAV
SYADSVKGRFTISRDNAKNTVYLQMNSLKPEDT AVYYC
WGQGTQVTVSS 1D1 QLQLVESGGGLVQAGGSLRLSCAAS
MGWFRQAPGK 34 DREFVAG
YYTDSVKGRFTISRDNAKNTVYLQMNSLK PGDTAVYYC
WGQGTQVTVSS 1D7 QVQLVESGGGLVQPGGSLRLSCAAS
MGWFRQAPGK 35 EREFVAA
YYADSVKGRFTISRDNAKNMVYLQMNSLK PEDTAVYYC
WGQGTQVTVSS 1G10 QVQLVESGGGLVQAGGSLRLSCAAS
MGWFRQAPGK 36 EREFVAA
AYADSVKGRFTISRDNAKNAAYLQMNSLKP DDTAVYYC
WGQGTQVTVSS 5A8 QLQLVESGGGLVQPGGSLRLSCAAS
MGWFRQAPGK 37 DREFVAG
YYTDSVKGRFTISRDNAQNTVYLQMNSRK PGDTAVYYC
GGQGTQVTVSS 6F1 QLQLVESGGGLVQPGGSLRLSCAAS
MHWFRQAPEK 38 ERVFVAA
YYADSVKGRFTISRDNSKNTVDLQMNNLK PEDTAVYVC
WGQGTQVTVSS
[0105] The framework region (FR) and complementarity determining region (CDR region) of each antibody are shown in Table 1b.
TABLE-US-00002 TABLE 1b FR1(SEQ CDR1(SEQ FR2(SEQ CDR2(SEQ FR3(SEQ CDR3(SEQ FR4(SEQ ID NO:) ID NO:) ID NO:) ID NO:) ID NO:) ID NO:) ID NO:) 1A7 1 6 11 15 19 25 31 1D1 2 7 12 16 20 26 31 1D7 3 8 13 16 21 27 31 1G1 4 9 13 17 22 28 31 0 5A8 5 7 12 16 23 29 32 6F1 5 10 14 18 24 30 31
[0106] The TEPITOPE score of CDR3 was shown in Table 1c.
TABLE-US-00003 TABLE 1c CDR3 TEPITOPE score (Threshold: 3%) Clone SEQ DRB1* DRB1* DRB1* DRB3* DRB3* DRB4* DRB5* Total No. ID NO. 03:01 07:01 15:01 01:01 02:02 01:01 01:01 score 1A7 25 −0.3165 4.0793 2.0981 −1.5304 −1.7309 −1.2642 1.8849 3.5368 1D1 26 0.3353 2.071 0.6483 −0.3405 −1.9074 −0.8487 −2.0181 −2.0601 1D7 27 −0.1001 0.1069 0.6146 −0.8096 −2.6263 −1.3442 −2.6174 −6.9899 1G10 28 −0.4723 −0.222 0.4577 −1.4754 −2.6443 −1.0317 −1.6145 −7.0025 5A8 29 0.3353 2.071 0.6483 −0.3405 −1.9074 −0.8487 −2.0181 −2.0601 6F1 30 −8.9 −10.2 −8 −10 −12.6 −10 −10.5 −70.2 PDL1- 66 1.99 3.873 0.7435 1.5116 1.2524 2.5062 1.4777 13.3544 56 dAb InnoventNb 67 2.5389 3.5707 3.0883 1.9171 1.0934 1.8357 3.5789 17.623 Nb 43 68 1.3009 2.886 2.3973 0.1293 −0.466 0.4211 3.163 8.7308 Note: PDL1-56 dAb is derived from WO2017/020801A1, InnoventNb is derived from CN107686520A, Nb 43 is derived from WO2018/233574A1. The TEPITOPE of amino acids 2-26 in CDR3 of InnoventNb is predicted.
Example 3 Preliminary Evaluation and Identification of Anti-PDL1 Single-Domain Antibody
[0107] 3.1. Expression of single-domain antibodies in E. coli and purification
[0108] Using the screened specific positive sequence as a template, PCR amplification was performed using the high-fidelity enzyme GVP8 (General Biosystems (Anhui) Co., Ltd.). A histidine tag coding sequence was introduced at the 3′ end of the sequence. The PCR product was subjected to electrophoresis and extracted to recover a band of about 600 bp. The recovered PCR product was recombinantly ligated to the pET32a+ vector (Novagen) digested with endonuclease Ndel (NEB) and EcoRl (NEB) using a recombination kit (Novoprotein Scientific Co., Ltd.), to construct an E. coli expression plasmid. The plasm id was transformed into competent E. coli Top1OF′ cells which were plated onto an ampicillin-coated plate, followed by incubation overnight at 37° C. The clones on the ampicillin-coated plate were picked respectively, and the plasmid was extracted and sequenced, to confirm the correct insertion of the sequence into the pET32a+ vector. The E. coli expression plasm id confirmed by sequencing was transformed into E. coli expression host Rosetta (DE3), to construct an E. coli expression strain. The recombinant clones on an ampicillin plate was picked up, incubated, and induced with 1 mM IPTG to express overnight at 30° C. The cell suspension induced to express overnight was ultrasonicated, and subjected to centrifugation at 12,000g and 4° C. for 10 min. The supernatant was collected, and purified by a Ni column (BestChrom Biotechnology Co., Ltd.). The protein showed purity above 90%.
[0109] 3.2. Specific binding of anti-PDL1 single-domain antibody to human PD-L1
[0110] Human PDL1-HSA or HSA (purchased from Sigma) was coated onto a plate in an amount of 200 ng/well at 4° C., and blocked with 5% skimmed milk powder for 1 hr at room temperature. The purified anti-PDL1single-domain antibody with a histidine-tag was diluted to 1 μg/mL, added to the plate in an amount of 100 μL/well, and incubated at 37° C. for 1 hr. After washing three times with PBST, 100 μl/well of 1:5000 diluted mouse anti-his tag antibody (R&D Systems Inc.) was added, and the plate was incubated at room temperature for 1 hr. After washing with PBST, 100 μwell of 1:10000 diluted HRP-Goat anti mouse IgG antibody (Thermo Scientific) was added, and the plate was incubated at room temperature for 1 hr. After washing with PBST, a TMB developing solution (Beijing ComWin Biotech Co., Ltd) was added for color development, and the OD value was read at 450 nm.
[0111] The test results are shown in Table 2. The results show that the six clones screened above specifically bind to human PDL1.
TABLE-US-00004 TABLE 2 Clone OD450 nm OD450 nm No. (coated with PDL1-HSA) (coated with HSA) 1A7 2.051 0.082 1D1 2.013 0.074 1D7 2.152 0.076 1G10 2.083 0.073 5A8 2.024 0.064 6F1 2.053 0.081
[0112] 3.3. Binding of anti-PDL1 single-domain antibody to mouse PD-L1
[0113] Mouse mPDL1-HSA fusion protein (SEQ ID NO: 52) was coated onto a plate overnight in an amount of 200 ng/ well at 4° C., and blocked with 5% skimmed milk powder for 1 hr at room temperature. The purified histidine-tagged anti-PDL1single-domain antibody was diluted to 1 μg/mL, then added to the plate in an amount of 100 μL/well, and incubated at 37° C. for 1 hr. After washing three times with PBST, 100 μl/well of 1:5000 diluted mouse anti his tag antibody (R&D Systems Inc) was added, and the plate was incubated at room temperature for 1 hr. After washing with PBST, 100 μl/well of 1:10000 diluted HRP-Goat anti mouse IgG antibody (Thermo Scientific) was added, and the plate was incubated at room temperature for 1 hr. After washing with PBST, TMB was added for color development, and the OD value was detected at 450 nm.
[0114] The results showed that the OD value corresponding to the anti-PDL1 single-domain antibody was not significantly different from that of the blank control group without the anti-PDL1single-domain antibody, indicating that none of the six clones screened bind to mouse PDL1.
[0115] 3.4. Competitive ELISA detection of Anti-PDL1 single-domain antibody protein
[0116] PDL1-HSA was coated onto a plate overnight in an amount of 200 ng/well at 4° C., and blocked with 5% skimmed milk powder for 1 hr at room temperature. The purified histidine tagged anti-PDL1 single-domain antibody was diluted in gradient and then mixed with an equal volume of 4.8 μg/mL PD1-Fc, respectively. 100 μl was added per well and incubated at 37° C. for 1 hr. After washing three times with PBST, 100 μl of 1:20000 diluted HRP-Goat anti-Human IgG Fc(Novex) was added to each well, and incubated at room temperature for 1 hr. After washing three times with PBS, TMB substrate was added, and the plated was incubated at 37° C. After incubation for 5 min to develop color, 1 M sulfuric acid was added to stop the reaction. The OD value was read at 450 nm, and the half maximal inhibitory concentration (IC50 value) was calculated. A smaller IC50 value indicates a higher specificity of the antibody.
[0117] The results are shown in Table 3, showing that the single-domain antibodies screened in the present disclosure have a good binding specificity.
TABLE-US-00005 TABLE 3 Clone No. IC50 (ng/ml) 1A7 50.5 1D1 45.2 1D7 55.1 1G10 62.8 5A8 43.6 6F1 52.7
Example 4. Humanization of anti-PDL1 single-domain antibodies
[0118] The humanization was carried out by the VHH humanization universal framework transplantation method established by Vincke C et al. (Vincke C, Loris R, Saerens D, Martinez-Rodriguez S, Muyldermans S, Conrath K. J Biol Chem. 2009; 284(5): 3273-3284). The corresponding CDR region in the universal humanized VHH framework h-NbBcII10FGLA (PDB number: 3EAK) designed according to sequence homology was replaced by the CDR region of the anti-PDL1 single-domain antibody, and individual amino acids in the FR2 region were further humanized according to the sequence of the humanized antibody DP-47. Multiple humanized variants were obtained for each anti-PDL1single-domain antibody. On basis of introducing as many human-derived amino acids as possible, a humanization scheme with high solubility and less aggregation was used. The humanized single-domain antibody was expressed and purified according to Example 3.1.
[0119] Preferably, the humanized VHH has an amino acid sequence of SEQ ID NO: 39-44, as shown in Table 4a, where the CDR regions are underlined.
TABLE-US-00006 TABLE 4a SEQ ID Full-length sequence NO: hu1A7V3 QVQLVESGGGLVQPGGSLRLSCAAS IDWYRQAPGK 39 GLELVAV
SYADSVKGRFTISRDNSKNTLYLQMNSLRAE DTAVYYC
WGQGTLVTVSS hu1D1V3 QVQLVESGGGLVQPGGSLRLSCAAS
MGWFRQAPG 40 KGLEFVAG
YYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAVYYC
WGQGTLVTVSS hu1D7V3 QVQLVESGGGLVQPGGSLRLSCAAS
MGWFRQAPG 41 KGLEFVAA
YYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAVYYC
WGQGTLVTVSS hu1G10V3 QVQLVESGGGLVQPGGSLRLSCAAS
MGWFRQAPG 42 KGLEFVAA
AYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAVYYC
WGQGTLVTVSS hu5A8V3 QVQLVESGGGLVQPGGSLRLSCAAS
MGWFRQAPG 43 KGLEFVAG
YYADSVKGRFTISRDNSKNTLYLQMNSL RAEDTAVYYC
WGQGTLVTVSS hu6F1V3 QVQLVESGGGLVQPGGSLRLSCAAS
MGWFRQAP 44 GKGLEFVAA
YYADSVKGRFTISRDNSKNTLYLQMN SLRAEDTAVYYC
WGQGTLVTVSS
[0120] The framework region (FR) and complementarity determining region (CDR region) of each humanized variant are shown in Table 4b.
TABLE-US-00007 TABLE 4b FR1(SEQ CDR1(SEQ FR2(SEQ CDR2(SEQ FR3(SEQ CDR3(SEQ FR4(SEQ ID NO:) ID NO:) ID NO:) ID NO:) ID NO:) ID NO:) ID NO:) hu1A7V3 3 6 59 15 62 25 65 hu1D1V3 3 7 60 16 63 26 65 hu1D7V3 3 8 61 16 63 27 65 hu1G10V3 3 9 61 17 64 28 65 hu5A8V3 3 7 60 16 63 29 65 hu6F1V3 3 10 61 18 63 30 65
[0121] The degree of humanization of each humanized single-domain antibody (by comparison of sequence identity to the closest human gene and allele) was analyzed by IMGT/3Dstructure-DB (http://www.imgt.org), as described in Use of IMGT® Databases and Tools for Antibody Engineering and Humanization, Marie-PauleLefranc et al., Methods Mol Biol, 907:3-37, 2012. The results are shown in Table 4c.
TABLE-US-00008 TABLE 4c Closest human Sequence gene and allele identity (%) hu1A7V3 IGHV3-66*01, IGHJ4*01 84.2 hu1D1V3 IGHV3-23*04, IGHJ4*01 88.7 hu1D7V3 IGHV3-23*04, IGHJ4*01 88.7 hu1G10V3 IGHV3-23*04, IGHJ4*01 85.6 hu5A8V3 IGHV3-23*04, IGHJ4*01 88.7 hu6F1V3 IGHV3-64*04, IGHJ4*01 87.6 hu56V1 IGHV3-64*04, IGHJ1*01 78.4 hu56V2 IGHV3-64*04, IGHJ1*01 81.4 InnoventNb IGHV3-66*01, IGHJ5*02 81.2 HualanNb 1 IGHV3-NL1*01, IGHJ6*01 72.2 HualanNb 2 IGHV3-23*01, IGHJ4*01 78.4 Bevacizumab IGHV3-30*02, IGHJ4*01 76.8 VH Adalimumab VH IGHV3-9*01, IGHJ4*01 93.9
[0122] Note: hu56V1 and hu56V2 are respectively derived from SEQ ID NO:33 and SEQ ID NO:34 of WO2017/020801A1, Innovent Nb is derived from SEQ ID NO:14 of CN107686520A, and Hualan Nb 1 and Hualan Nb 2 are respectively derived from SEQ ID NO: 8 and SEQ ID NO: 14 of WO2018/233574A1. Bevacizumab and Adalimumab are marketed monoclonal antibodies.
Example 5. Preparation of Anti-PDL1-Fc Fusion Protein with Mammalian Cells
[0123] 5.1. Expression and purification of anti-PDL1 single-domain antibodies and Fc fusion protein (Anti-PDL1-Fc)
[0124] The amino acid sequences of the screened specific positive clones (SEQ ID NO: 33-38) and the humanized counterparts (SEQ ID NO: 39-44) were respectively converted into a base sequence according to the codon preference in CHO cells, and full-length DNAs were obtained by gene synthesis (Nanjing GenScript Biotechnology Co., Ltd.). Using each DNA as a template, PCR amplification was performed using the high-fidelity enzyme GVP8 (General Biosystems (Anhui) Co., Ltd.). The PCR product was subjected to electrophoresis and extracted to recover a band of about 600 bp. The recovered PCR product was recombinantly ligated to the pCDNA3.1 vector containing a signal peptide and human IgG1 Fc sequence (SEQ ID NO: 45), to construct a cell expression plasmid in which anti-PDL1 single-domain antibody is fused with human IgG1 Fc. The expression plasm id in which anti-PDL1 single-domain antibody was fused with human IgG1 Fc was extracted with an endotoxin-free plasm id max kit (Biomiga). The plasmid was mixed well with the transfection reagent PEI (Polysciences, Inc.) at a ratio of 1:3, and allowed to stand for 30 min, and then added to HEK293F cells. After 7 days of culture in a shaker incubator at 37° C. and 5% CO2, the cell suspension was centrifuged, and the supernatant was collected. The supernatant was adjusted to pH 7.0, loaded onto a Protein A affinity column (Bestchrom Biotechnology Co., Ltd), and then eluted with 100% 0.1 M Gly-HCl (pH3.0). The eluate was pre-added with 10% 1M Tris-HCl (pH 8.5), diluted to a conductivity of 4 ms/cm with 100% eluant, adjusted to pH 5.5, and centrifuged (8000 rpm, 4° C., 10 min). The supernatant was adjusted to pH 5.0 and loaded onto a DSP column (Bestchrom Biotechnology Co., Ltd), and eluted in linear gradients with 0-60% eluant (20 mM NaAc, 0.5M NaCl, pH5.0), at a flow rate of 2 ml/min for 15 min. The purity was determined by SEC-HPLC-UV analysis under the following conditions: detector: Agilent 1100 LC; detection wavelength: 214 nm; mobile phase: 150 mM pH7.0 PB +5% isopropanol; chromatographic column: Superdex 200 Increase 5/150 GL; running time: 15 min; column temperature: 25° C. The purity is greater than 95%.
Example 6. Identification of In-Vitro Functions of Anti-PDL1-Fc Fusion Protein
[0125] 6.1. Affinity characterization of anti-PDL1-Fc fusion protein to PD-L1
[0126] PDL1-HSA was coated onto a plate overnight in 200 ng/well at 4° C., and blocked with 5% skimmed milk powder for 1 hr at room temperature. The anti-PDL1-Fc fusion protein was diluted in gradient with 1% BSA, and incubated at 37° C. for 1 hr. After washing three times with PBST, 100 μl of a 1:20000 dilution of HRP- Goat anti-Human IgG Fc(Novex) was added to each well, and incubated at room temperature for 1 hr. After washing three times with PBST, TMB substrate was added, and the plate was incubated at 37° C. After incubation for 5 min to develop color, 1 M sulfuric acid was added to stop the reaction, and the OD value was read at 450 nm. The results are shown in Table 5.
TABLE-US-00009 TABLE 5 Sample name EC50(nM) Anti-PDL1-1A7-FC 0.07 Anti-PDL1-1D1-FC 0.07 Anti-PDL1-1D7-FC 0.07 Anti-PDL1-1G10-FC 0.08 Anti-PDL1-5A8-FC 0.11 Anti-PDL1-6F1-FC 0.09 Anti-PDL1-1A7V3-Fc 0.09 Anti-PDL1-1D1V3-Fc 0.10 Anti-PDL1-1D7V3-Fc 0.08 Anti-PDL1-1G10V3-Fc 0.10 Anti-PDL1-5A8V3-Fc 0.08 Anti-PDL1-6F1V3-Fc 0.09
[0127] 6.2. Identification of blocking effect of anti-PD-L1 single-domain antibody/Fc fusion protein on PDL1-PD1 interaction (by competitive ELISA)
[0128] PDL1-HSA was coated onto a plate overnight in an amount of 200 ng/well at 4° C., and blocked with 5% skimmed milk powder for 1 hr at room temperature. The anti-PDL1-Fc fusion protein was diluted 5-fold in gradient with 1% BSA from an initial concentration of 4 μg/mL, and mixed with an equal volume of 4 μg/mL bio-PD1 -Fc(biotin-labeled), respectively. 100 μL of the mixture was added to a 96-well plate and incubated at 37° C. for 1 hr. After washing three times with PBST, 100 μL of a 1:50,000 dilution of HRP-Streptavidin (Jackson ImmunoResearch Inc.) was added to each well, and the plate was incubated at room temperature for 1 hr. After washing three times with PBST, TMB substrate was added, and the plate was incubated at 37° C. After color development for 5 min, 1 M sulfuric acid was added to stop the reaction. The OD value was read at 450 nm, and the results are shown in Table 6 and
TABLE-US-00010 TABLE 6 Sample name IC50(ng/ml) Anti-PDL1-1A7-FC 43.52 Anti-PDL1-1D1-FC 33.50 Anti-PDL1-1D7-FC 43.31 Anti-PDL1-1G10-FC 41.22 Anti-PDL1-5A8-FC 46.79 Anti-PDL1-6F1-FC 39.18 Anti-PDL1-1A7V3-Fc 33.50 Anti-PDL1-1D1V3-Fc 34.60 Anti-PDL1-1D7V3-Fc 37.74 Anti-PDL1-1G10V3-Fc 38.65 Anti-PDL1-5A8V3-Fc 33.50 Anti-PDL1-6F1V3-Fc 39.62
[0129] The above results show that the single-domain antibodies of the present disclosure have a very significant blocking effect on PDL1-PD1 interaction. Example 7. Identification of functional activity of anti-PDL1-Fc fusion protein in human T lymphocyte lineage
[0130] 7.1. Construction of Assay Cell Strains
[0131] CD5L-OKT3scFv-CD14 (GenBank: ADN42857.1) was synthesized, digested with HindIII-EcoRl (Takara), and inserted into the vector pCDNA3.1, to construct pCDNA3.1-antiCD3TM. Human PD-L1 was used as a template, high-fidelity amplification was performed to obtain a PDL1 fragment, which was then recombinantly inserted into pCDNA3.1-antiCD3TM, to construct pCDNA3.1-antiCD3TM-PDL1. CHO cells (Thermo) were transfected and screened against G418 for 10-14 days to produce the stable cell line CHO-antiCD3TM-PDL1.
[0132] The obtained fragment was amplified with human PD1 as a template, and then recombinantly ligated to the vector PB513B1-dual-puro (YouBio) digested with HindIII-BamHI (Takara), to construct the plasmid pB-PD1. pGL4.30 (YouBio) was used as a template, the obtained fragment was subjected to high-fidelity amplification, and then recombinantly ligated to the vector pB-PD1 digested with Sfil-Xbal (Takara), to construct the plasmid pB-NFAT-Luc2p-PD1. After the plasmid was successfully constructed, the plasmid was extracted with an endotoxin-free plasmid maxiprep extraction kit (Biomiga), with which jurkat cells (Stem Cell Bank, Chinese Academy of Sciences) were transfected. Following the method described in Patent No. CN 107022571A, jurkat cells were allowed to be in relatively adherent state by treatment with 0.1 mg/ml poly-D-lysine, and then the jurkat cells were transfected according to instructions for transfection in a lipofection kit (Lipofectamine 3000; invitrogen). On the third day, the cells were screened under 10% FBS-containing RPMI1640 medium (Thermo) containing 2.5 μg/ml puromycin. After that, the medium was supplemented at regular intervals. After the cell viability was restored, the content of puromycin was gradually increased to 4 μg/ml. The Jurkat-NFAT-Luc2p-PD1 cell line was finally obtained.
[0133] 7.2. Characterization of Blocking Capacity of Anti-PDL1-Fc Fusion Proteins in PDL1/ PD1 Pathway
[0134] CHO-CD3TM-PD-L1 and Jurkat-NFAT-Luc2p-PD-1 cells were counted, and the cell density thereof was adjusted to be 4×10.sup.6/ml. Then 25 μl was added to each well of a 96-well plate. In this experiment, the anti-PDL1-Fc fusion protein, positive controls Durvalumab(AstraZeneca) and 56-Fc (SEQID NO:42 from WO2017/020801A1), and negative control ch-175D10 (from U.S. Pat. No. 9,751,934B2) were respectively diluted in gradient with 1′)/0 BSA, and 50 μl were added to the cells, to give a final concentration of 130, 43.4, 14.5, 4.82, 1.61, 0.536, 0.179, and 0.0595 nM; and coincubated at 37° C. and 5% CO.sub.2 for 6 hrs. 10 μl of luciferase substrate was added to each well, and shaken on a shaker for 2 min, and then the luminescence was read. The operation was carried out according to the instruction of the kit (luciferase detection kit; Lot: 0000339727; Promega).
[0135] The results in
[0136] It can be seen from
Example 8. Characterization of Activation of PBMC by Anti-PDL1-Fc Fusion Protein
[0137] PBMCs were isolated from healthy human peripheral blood using a lymphocyte separation medium (TianjinHaoyangHuake Biotechnology Co., Ltd.). The recombinant anti-CD3 monoclonal antibody (Novoprotein Scientific Co., Ltd., Article No. GMP-A018) at a final concentration of 5 μg/ml was coated onto a plate overnight at 4° C. in an amount of 50 μl/well. The cells were diluted to 2×10.sup.6/ml with 2 μg/ml recombinant CD28 monoclonal antibody (Novoprotein Scientific Co., Ltd., Article No. GMP-A063). The coated plate was removed of the supernatant, and washed twice with 200 μl/well of PBS. 200 μl of cells was added to each well. After 24 hrs of cell activation, 5 nM Durvalumab(AstraZeneca) and 5nM Anti-PDL1-Fc fusion protein were added for stimulation. After 3 days of stimulation, the cell suspension was centrifuged at 1500 rpm for 5 min, and the supernatant was collected. The supernatant was taken and the cytokine IL2 was detected according to the instructions of the kit (purchased from Dakewe Biotech Co., Ltd.).
[0138] The results are shown in
Example 9. Tumor Inhibition Activity of Anti-PDL1-Fc Fusion Protein
[0139] The tumor inhibition activity of anti-PDL1-Fc fusion protein was investigated in an experiment where NOD/SCID mice were subcutaneously transplanted with MC38 cells expressing human PD-L1 (MC38-PDL1) (Nanjing Galaxy Biopharma Co., Ltd) and human peripheral blood mononuclear cells (PBMCs).
[0140] The experimental design was as follows: 3×10.sup.6 MC38 cells in 50% Matrigel (purchased from BD) were subcutaneously inoculated into the right flank of 7-8 week-old NOD/SCID mice. 15 days after tumor inoculation, mice with a tumor size of 100-250 mm.sup.3 were randomly grouped, and each test group had 4-6 mice. 100 μl of pooled PBMCs (5×10.sup.5) from two healthy donors were injected intratumorally. 3 days after PBMC implantation, anti-PDL1-Fc fusion protein and human IgG1 Fc were administered by subcutaneous injection at a dose of 1 mg/kg, respectively, followed by administration once a week. PBS was injected in the parallel group as a negative control. Determination of tumor volume: The largest long axis (L) and largest wide axis (W) of the tumor were determined by a vernier caliper, and the tumor volume was calculated according to the following formula: V=L×W.sup.2/2.
[0141] The test results are shown in
Example 10. Solubility Study of Anti-PDL1-Fc Fusion Proteins
[0142] 100 mg of purified single-domain antibody was ultrafiltered at 3500 g and 25° C. in an ultrafiltration tube (Merck Millipore Ltd.), where the replacement solution was 5 mM phosphate buffer (pH7.2) or 5 mM sodium acetate (pH5.5), the solution was replaced twice, and the concentration was continued until there was no significant change in volume after centrifugation for 20 min. The concentrated solution was centrifuged at 8000 g for 10 min and the protein content was determined. This concentration is the solubility under the described conditions.
TABLE-US-00011 TABLE 7 Sequence No. Solubility Protein name (SEQ ID NO:) (mg/ml) Anti-PDL1-1A7V3-Fc 53 128.8 Anti-PDL1-1D1V3-Fc 54 225.3 Anti-PDL1-1D7V3-Fc 55 132.6 Anti-PDL1-1G10V3-Fc 56 113.41 Anti-PDL1-5A8V3-Fc 57 257.11 Anti-PDL1-6F1V3-Fc 58 59.53
[0143] According to Table 7, the optimized humanized anti-PDL1-Fc fusion proteins obtained in the present disclosure showed good solubility. As shown in the humanized PDL1 single-domain antibodies in this example, hydrophilic amino acids at positions 44 and 45 of the original FR2 region were substituted into the fairly conserved hydrophobic residues G and L of ordinary human antibodies (Table 4a), with minimal solubility affected.
[0144] In summary, the present disclosure effectively overcomes various shortcomings in the prior art, by providing an antibody product with high industrial application value.
[0145] A summary of the sequences involved in the present disclosure is shown in Table 8.
TABLE-US-00012 TABLE 8 1 FR1 QLQLVESGGDLVQPGGSLRLSCAAS 2 FR1 QLQLVESGGGLVQAGGSLRLSCAAS 3 FR1 QVQLVESGGGLVQPGGSLRLSCAAS 4 FR1 QVQLVESGGGLVQAGGSLRLSCAAS 5 FR1 QLQLVESGGGLVQPGGSLRLSCAAS 6 CDR1 GSIFSANL 7 CDR1 GGTFITYA 8 CDR1 GRAFLTYA 9 CDR1 GRPFITYA 10 CDR1 GRTFSTHS 11 FR2 IDWYRQPPGKQRELVAV 12 FR2 MGWFRQAPGKDREFVAG 13 FR2 MGWFRQAPGKEREFVAA 14 FR2 MHWFRQAPEKERVFVAA 15 CDR2 ISSRGIT 16 CDR2 ISWSGSST 17 CDR2 INWSGSIT 18 CDR2 INWNGDST 19 FR3 SYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYC 20 FR3 YYTDSVKGRFTISRDNAKNTVYLQMNSLKPGDTAVYYC 21 FR3 YYADSVKGRFTISRDNAKNMVYLQMNSKPDTAVYYC 22 FR3 AYADSVKGRFTISRDNAKNAAYLQMNSLKPDDTAVYYC 23 FR3 YYTDSVKGRFTISRDNAQNTVYLQMNSRKPGDTAVYYC 24 FR3 YYADSVKGRFTISRDNSKNTVDLQMNNLKPEDTAVYVC 25 CDR3 HLFHTDGLGY 26 CDR3 AAKISGATREHLMTSYDY 27 CDR3 AAKVSGATRDHLMTTYDY 28 CDR3 ASKRTAVAPRALNDYDF 29 CDR3 AAKISGATREHLRTSYDY 30 CDR3 AARPGAPSTIVAMLDY 31 FR4 WGQGTQVTVSS 32 FR4 GGQGTQVTVSS 33 1A7 full-length QLQLVESGGDLVQPGGSLRLSCAASGSIFSANLIDWYRQPP sequence GKQRELVAVISSRGITSYADSVKGRFTISRDNAKNTVYLQMN SLKPEDTAVYYCHLFHTDGLGYWGQGTQVTVSS 34 1D1 full-length QLQLVESGGGLVQAGGSLRLSCAASGGTFITYAMGWFRQA sequence PGKDREFVAGISWSGSSTYYTDSVKGRFTISRDNAKNTVYL QMNSLKPGDTAVYYCAAKISGATREHLMTSYDYWGQGTQV TVSS 35 1D7 full-length QVQLVESGGGLVQPGGSLRLSCAASGRAFLTYAMGWFRQ sequence APGKEREFVAAISWSGSSTYYADSVKGRFTISRDNAKNMVY LQMNSLKPEDTAVYYCAAKVSGATRDHLMTTYDYWGQGT QVTVSS 36 1G10 full- QVQLVESGGGLVQAGGSLRLSCAASGRPFITYAMGWFRQA length PGKEREFVAAINWSGSITAYADSVKGRFTISRDNAKNAAYLQ sequence MNSLKPDDTAVYYCASKRTAVAPRALNDYDFWGQGTQVTV SS 37 5A8 full-length QLQLVESGGGLVQPGGSLRLSCAASGGTFITYAMGWFRQA sequence PGKDREFVAGISWSGSSTYYTDSVKGRFTISRDNAQNTVYL QMNSRKPGDTAVYYCAAKISGATREHLRTSYDYGGQGTQV TVSS 38 6F1 full-length QLQLVESGGGLVQPGGSLRLSCAASGRTFSTHSMHWFRQ sequence APEKERVFVAAINWNGDSTYYADSVKGRFTISRDNSKNTVD LQMNNLKPEDTAVYVCAARPGAPSTIVAMLDYWGQGTQVT VSS 39 hu1A7V3 QVQLVESGGGLVQPGGSLRLSCAASGSIFSANLIDWYRQA PGKGLELVAVISSRGITSYADSVKGRFTISRDNSKNTLYLQM NSLRAEDTAVYYCHLFHTDGLGYWGQGTLVTVSS 40 hu1D1V3 QVQLVESGGGLVQPGGSLRLSCAASGGTFITYAMGWFRQA PGKGLEFVAGISWSGSSTYYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAVYYCAAKISGATREHLMTSYDYWGQGTLV TVSS 41 hu1D7V3 QVQLVESGGGLVQPGGSLRLSCAASGRAFLTYAMGWFRQ APGKGLEFVAAISWSGSSTYYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTAVYYCAAKVSGATRDHLMTTYDYWGQGTL VTVSS 42 hu1G10V3 QVQLVESGGGLVQPGGSLRLSCAASGRPFITYAMGWFRQA PGKGLEFVAAINWSGSITAYADSVKGRFTISRDNSKNTLYLQ MNSLRAEDTAVYYCASKRTAVAPRALNDYDFWGQGTLVTV SS 43 hu5A8V3 QVQLVESGGGLVQPGGSLRLSCAASGGTFITYAMGWFRQA PGKGLEFVAGISWSGSSTYYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAVYYCAAKISGATREHLRTSYDYWGQGTLV TVSS 44 hu6F1V3 QVQLVESGGGLVQPGGSLRLSCAASGRTFSTHSMGWFRQ APGKGLEFVAAINWNGDSTYYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTAVYYCAARPGAPSTIVAMLDYWGQGTLVT VSS 45 IgG1 FC EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT PEVTCVWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPG 46 IgG4 FC ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEV mutant TCVWDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNS TYRWSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKA KGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVE WESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQE GNVFSCSVMHEALHNHYTQKSLSLSLG 47 IgG1 FC EPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRT mutant PEVTCVWVAVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAGIEKTIS KAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIA VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQ QGNVFSCSVMHEALHNHYTQKSLSLSPG 48 IgG1 FC EPKSSDKTHTCPPCPAPELLGGPDVFLFPPKPKDTLMISRT mutant PEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPEEKTI SKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG 49 hPDL1-HSA FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEM EDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQ ITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRIL WDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKIIIIN SKREEKLFNVTSTLRINIIINEIFYCTFRRLDPEENHTAELVI PELPLAHPPNERTGGGGSGGGGDAHKSEVAHRFKDLGEE NFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADESA ENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPERN ECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYLY EIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKL DELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQR FPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAKYI CENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPSL AADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSWLL LRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQNLI KQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSRN LGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTPV SDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTFH ADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDFA AFVEKCCKADDKETCFAEEGKKLVAASQAALGL 50 hPDL1-FC FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEM EDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQ ITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRIL WDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKIIIIN SKREEKLFNVTSTLRINIIINEIFYCTFRRLDPEENHTAELVI PELPLAHPPNERTDIEGRMDPKSCDKTHTCPPCPAPELLGG PSVFLFPPKPKDTLMISRTPEVTCVWDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYASTYRWSVLTVLHQDWLNGKE YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTK NQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL SLSPGK 51 hPD1-FC LDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVL NWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGR DFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVT ERRAEVPTAHPSPSPRPAGQFQDIEGRMDPKSCDKTHTCP PCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCWVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYASTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVY TLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHE ALHNHYTQKSLSLSPGK 52 mPDL1-HSA FTITAPKDLYVVEYGSNVTMECRFPVERELDLLALVVYWEK EDEQVIQFVAGEEDLKPQHSNFRGRASLPKDQLLKGNAAL QITDVKLQDAGVYCCIISYGGADYKRITLKVNAPYRKINQRIS VDPATSEHELICQAEGYPEAEVIWTNSDHQPVSGKRSVTTS RTEGMLLNVTSSLRVNATANDVFYCTFWRSQPGQNHTAELI IPELPATHPPQNRTHGGGGSGGGGDAHKSEVAHRFKDLGE ENFKALVLIAFAQYLQQCPFEDHVKLVNEVTEFAKTCVADES AENCDKSLHTLFGDKLCTVATLRETYGEMADCCAKQEPER NECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEETFLKKYL YEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPK LDELRDEGKASSAKQRLKCASLQKFGERAFKAWAVARLSQ RFPKAEFAEVSKLVTDLTKVHTECCHGDLLECADDRADLAK YICENQDSISSKLKECCEKPLLEKSHCIAEVENDEMPADLPS LAADFVESKDVCKNYAEAKDVFLGMFLYEYARRHPDYSWL LLRLAKTYETTLEKCCAAADPHECYAKVFDEFKPLVEEPQN LIKQNCELFEQLGEYKFQNALLVRYTKKVPQVSTPTLVEVSR NLGKVGSKCCKHPEAKRMPCAEDYLSVVLNQLCVLHEKTP VSDRVTKCCTESLVNRRPCFSALEVDETYVPKEFNAETFTF HADICTLSEKERQIKKQTALVELVKHKPKATKEQLKAVMDDF AAFVEKCCKADDKETCFAEEGKKLVAASQAALGL 53 Anti-PDL1- QVQLVESGGGLVQPGGSLRLSCAASGSIFSANLIDWYRQA 1A7V3-FC PGKGLELVAVISSRGITSYADSVKGRFTISRDNSKNTLYLQM NSLRAEDTAVYYCHLFHTDGLGYWGQGTLVTVSSEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRV VSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP REPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESN GQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFS CSVMHEALHNHYTQKSLSLSPG 54 Anti-PDL1- QVQLVESGGGLVQPGGSLRLSCAASGGTFITYAMGWFRQA 1D1V3-Fc PGKGLEFVAGISWSGSSTYYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAVYYCAAKISGATREHLMTSYDYWGQGTLV TVSSEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPG 55 Anti-PDL1- QVQLVESGGGLVQPGGSLRLSCAASGRAFLTYAMGWFRQ 1D7V3-Fc APGKGLEFVAAISWSGSSTYYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTAVYYCAAKVSGATRDHLMTTYDYWGQGTL VTVSSEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTL MISRTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKP REEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPI EKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFY PSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG 56 Anti-PDL1- QVQLVESGGGLVQPGGSLRLSCAASGRPFITYAMGWFRQA 1G10V3-Fc PGKGLEFVAAINWSGSITAYADSVKGRFTISRDNSKNTLYLQ MNSLRAEDTAVYYCASKRTAVAPRALNDYDFWGQGTLVTV SSEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS RTPEVTCWVDVSHEDPEVKFNWYVDGVEVHNAKTKPREE QYNSTYRWSLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDI AVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRW QQGNVFSCSVMHEALHNHYTQKSLSLSPG 57 Anti-PDL1- QVQLVESGGGLVQPGGSLRLSCAASGGTFITYAMGWFRQA 5A8V3-Fc PGKGLEFVAGISWSGSSTYYADSVKGRFTISRDNSKNTLYL QMNSLRAEDTAVYYCAAKISGATREHLRTSYDYWGQGTLV TVSSEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM ISRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPR EEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYP SDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKS RWQQGNVFSCSVMHEALHNHYTQKSLSLSPG 58 Anti-PDL1- QVQLVESGGGLVQPGGSLRLSCAASGRTFSTHSMGWFRQ 6F1V3-Fc APGKGLEFVAAINWNGDSTYYADSVKGRFTISRDNSKNTLY LQMNSLRAEDTAVYYCAARPGAPSTIVAMLDYWGQGTLVT VSSEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVWDVSHEDPEVKFNWYVDGVEVHNAKTKPRE EQYNSTYRWSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK TISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPS DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR WQQGNVFSCSVMHEALHNHYTQKSLSLSPG 59 humanized IDWYRQAPGKGLELVAV FR2 60 humanized MGWFRQAPGKGLEFVAG FR2 61 humanized MGWFRQAPGKGLEFVAA FR2 62 humanized SYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC FR3 63 humanized YYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC FR3 64 humanized AYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYC FR3 65 humanized WGQGTLVTVSS FR4 66 PDL1-56 dAb AADSFEDPTCTLVTSSGAFQY 67 InnoventNb AAPKVGLGPRTALGHLAFMTLPALNY 68 Nb 43 AADDDYYAFLSRGARDFRY
[0146] The above embodiments only exemplarily illustrate the principles and effects of the present disclosure, but are not used to limit the present disclosure. Any person skilled in the art may make modifications or changes on the foregoing embodiments without departing from the spirit and scope of the present disclosure. Therefore, all equivalent modifications or changes made by a person of ordinary skill in the art without departing from the spirit and technical idea of the present disclosure shall be covered by the claims of the present disclosure.