NUCLEAR RECEPTOR SET DOMAIN CONTAINING PROTEIN 2 TRANSITION STATE AND USES THEREOF
20190026440 ยท 2019-01-24
Assignee
Inventors
Cpc classification
G16B40/00
PHYSICS
C40B20/08
CHEMISTRY; METALLURGY
G16B15/30
PHYSICS
G16B15/00
PHYSICS
G16B35/00
PHYSICS
G16B5/00
PHYSICS
C12Y201/01043
CHEMISTRY; METALLURGY
International classification
Abstract
Methods and systems for obtaining inhibitors of Nuclear receptor SET Domain containing protein 2 (NSD2) are disclosed where the methods involve designing compounds that resemble the NSD2 transition state.
Claims
1. A system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon which, when executed by the one or more data processing apparatus, cause the one or more data processing apparatus to perform a method comprising: (i) obtaining kinetic isotope effects on human Nuclear receptor SET Domain containing protein 2 (NSD2)-catalyzed methylation of histone H3 lysine 36 to obtain the NSD2 transition state structure, wherein the NSD2 transition state comprises the structure (ii) obtaining the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state; and (iiia) identifying from a library of compounds a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state, or (iiib) designing a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state; wherein the chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state is a putative inhibitor of NSD2.
2. (canceled)
3. A computer implemented method performed using a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon, the method comprising: (i) obtaining kinetic isotope effects on human Nuclear receptor SET Domain containing protein 2 (NSD2)-catalyzed methylation of histone H3 lysine 36 to obtain the NSD2 transition state structure, wherein the NSD2 transition state comprises the structure (ii) obtaining the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state; and (iiia) identifying from a library of compounds a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state, or (iiib) designing a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state; wherein the chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state is a putative inhibitor of NSD2.
4-8. (canceled)
9. The system of claim 1, which further comprises synthesizing the compound.
10. The system of claim 1, which further comprises testing the compound for inhibitory activity to NSD2.
11. (canceled)
12. A method of screening for an inhibitor of human Nuclear receptor SET Domain containing protein 2 (NSD2), the method comprising the steps of: (i) measuring kinetic isotope effects on the NSD2-catalyzed methylation of histone H3 lysine 36 to obtain the NSD2 transition state structure, wherein the NSD2 transition state comprises the structure (ii) determining the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state; (iiia) obtaining a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state, or (iiib) using a computer to design a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state, and synthesizing the compound; and (iv) testing the compound for inhibitory activity to NSD2 by determining if the compound inhibits NSD2-catalyzed methylation of histone H3 lysine 36, wherein a compound that inhibits NSD2-catalyzed methylation of histone H3 lysine 36 is an inhibitor of NSD2.
13. A method of inhibiting NSD2 comprising obtaining a NSD2 inhibitor by the system of claim 1, and contacting NSD2 with the compound.
14. A method of treating a subject having a cancer comprising obtaining a NSD2 inhibitor by using the system of claim 1, and administering the compound to the subject in an amount effective to inhibit NSD2.
15. The method of claim 14, wherein the cancer is multiple myeloma, neuroblastoma, glioblastoma, prostate cancer or breast cancer.
16. The system of claim 1, wherein the transition state is a S.sub.N2 transition state where a positive charge is distributed between a leaving group, a transferring group and a nucleophile.
17. The system of claim 1, wherein the transition state has a CN distance of 1.8 and a CS distance of 2.6 , or the transition state has a CN distance of 2.10 and a CS distance of 2.53 .
18. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
DETAILED DESCRIPTION OF THE INVENTION
[0051] The invention provides a method of obtaining a putative inhibitor of human Nuclear receptor SET Domain containing protein 2 (NSD2), the method comprising using a computer to design a chemically stable compound that resembles the charge and geometry of the NSD2 transition state, wherein the compound is a putative inhibitor of NSD2.
[0052] The invention also provides a system for obtaining a putative inhibitor of human Nuclear receptor SET Domain containing protein 2 (NSD2) comprising one or more data processing apparatus and a computer-readable medium coupled to the one or more data processing apparatus having instructions stored thereon that are configured to perform a method comprising designing a chemically stable compound that resembles the charge and geometry of the NSD2 transition state, wherein the compound is a putative inhibitor of NSD2.
[0053] The method can include the steps of:
[0054] (i) determining the molecular electrostatic potential at the van der Waals surface computed from the wave function of a NSD2 transition state and the geometric atomic volume of the NSD2 transition state, and
[0055] (ii) designing a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state, wherein the compound is a putative inhibitor of NSD2.
[0056] As disclosed herein, the NSD2 transition state structure can comprise
[0057] Preferably, the transition state is a S.sub.N2 transition state where a positive charge is distributed between a leaving group, a transferring group and a nucleophile. Preferably, the transition state has a CN distance of 1.8 and a CS distance of 2.6 , or the transition state has a CN distance of 2.10 and a CS distance of 2.53 .
[0058] The invention further provides a method for screening for a compound that is an inhibitor of human Nuclear receptor SET Domain containing protein 2 (NSD2), the method comprising the steps of:
[0059] (i) determining the molecular electrostatic potential at the van der Waals surface computed from the wave function of a NSD2 transition state and the geometric atomic volume of the NSD2 transition state, wherein the HIV-1 protease transition state comprises the structure
[0060] (ii) using a computer to design a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state;
[0061] (iii) synthesizing the compound; and
[0062] (iv) testing the compound for inhibitory activity to HIV-1 protease.
[0063] The invention further provides a method of screening for an inhibitor of human Nuclear receptor SET Domain containing protein 2 (NSD2), the method comprising the steps of:
[0064] (i) measuring kinetic isotope effects on the NSD2-catalyzed methylation of histone H3 lysine 36 to obtain the NSD2 transition state structure,
[0065] wherein the NSD2 transition state comprises the structure
[0066] (ii) determining the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state;
[0067] (iii) obtaining a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state; and
[0068] (iv) testing the compound for inhibitory activity to NSD2 by determining if the compound inhibits NSD2-catalyzed methylation of histone H3 lysine 36,
[0069] wherein a compound that inhibits NSD2-catalyzed methylation of histone H3 lysine 36 is an inhibitor of NSD2.
[0070] The invention also provides a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon which, when executed by the one or more data processing apparatus, cause the one or more data processing apparatus to perform a method comprising:
[0071] (i) obtaining kinetic isotope effects on human Nuclear receptor SET Domain containing protein 2 (NSD2)-catalyzed methylation of histone H3 lysine 36 to obtain the NSD2 transition state structure,
[0072] wherein the NSD2 transition state comprises the structure
[0073] (ii) obtaining the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state; and
[0074] (iii) identifying from a library of compounds a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state;
[0075] wherein the chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state is a putative inhibitor of NSD2.
[0076] The invention also provides a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon which, when executed by the one or more data processing apparatus, cause the one or more data processing apparatus to perform a method comprising:
[0077] (i) obtaining the molecular electrostatic potential at the van der Waals surface computed from the wave function of a human Nuclear receptor SET Domain containing protein 2 (NSD2) transition state and the geometric atomic volume of the NSD2 transition state, wherein the NSD2 transition state comprises the structure
and
[0078] (ii) designing a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state;
[0079] wherein a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state is a putative inhibitor of NSD2.
[0080] The invention also provides a computer implemented method performed using a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon, the method comprising:
[0081] (i) obtaining kinetic isotope effects on human Nuclear receptor SET Domain containing protein 2 (NSD2)-catalyzed methylation of histone H3 lysine 36 to obtain the NSD2 transition state structure,
[0082] wherein the NSD2 transition state comprises the structure
[0083] (ii) obtaining the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state; and
[0084] (iii) identifying from a library of compounds a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state;
[0085] wherein the chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state is a putative inhibitor of NSD2.
[0086] The invention also provides a computer implemented method performed using a system comprising a non-transitory computer-readable medium coupled to one or more data processing apparatus having instructions stored thereon, the method comprising:
[0087] (i) determining the molecular electrostatic potential at the van der Waals surface computed from the wave function of a human Nuclear receptor SET Domain containing protein 2 (NSD2) transition state and the geometric atomic volume of the NSD2 transition state, wherein the NSD2 transition state comprises the structure
and
[0088] (ii) designing a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state;
[0089] wherein a chemically stable compound that resembles the molecular electrostatic potential at the van der Waals surface computed from the wave function of the NSD2 transition state and the geometric atomic volume of the NSD2 transition state is a putative inhibitor of NSD2.
[0090] The methods can also comprise synthesizing the putative inhibitor compound and/or testing the compound for inhibitory activity to NSD2.
[0091] The invention also provides methods of inhibiting NSD2 comprising obtaining a NSD2 inhibitor by any of the methods disclosed herein or by using any of the systems disclosed herein, and contacting NSD2 with the compound.
[0092] The invention further provides methods of treating a subject having a cancer comprising obtaining a NSD2 inhibitor by any of the methods disclosed herein or by using any of the systems disclosed herein, and administering the compound to the subject in an amount effective to inhibit NSD2. The subjects can have different types of cancers, including but not limited to, a multiple myeloma, a neuroblastoma, a glioblastoma, prostate cancer and/or breast cancer.
[0093] The invention still further provides compounds obtained by any of the methods disclosed herein or by using any of the systems disclosed herein.
[0094] As used herein, a compound resembles the NSD2 transition state molecular electrostatic potential at the van der Waals surface computed from the wave function of the transition state and the geometric atomic volume if that compound has an S.sub.e and S.sub.g0.5, where S.sub.e and S.sub.g are determined as in Formulas (1) and (2) on page 8831 of Bagdassarian, Schramm and Schwartz, 1996 (58).
[0095] Page 8831 of Bagdassarian et al. 1996 (58) sets forth in part [a] molecule can be compared to another either geometrically or electrostatically, but ideally, a similarity measure will contain a mixture of both. Consider first the measure
[0096] where .sub.i.sup.A is the electrostatic potential at surface point i of molecule A, .sub.j.sup.B defines point j of molecule B, and in the numerator r.sub.ij.sup.2 is the spatial distance squared between point i on A and j on B. nA and nB refer to the number of surface points on each molecule. The double summation is therefore over all possible interactions between points on the two molecules, and is the length scale for the interaction between i and j. The numerator compares A to B for a particular orientation of molecule B relative to molecule A. The denominator serves as a normalization factor for the comparison of A to itself and for B to itself. Here, r.sub.ij.sup.2 refers to the distance between i and j on the same molecule. The distance between points is squared to decrease computation time. Consider also a second, purely geometrical measure:
[0097] The invention provides methods and systems that provide a technical solution to enable obtaining inhibitors for NSD2, particularly ones that will be effective in cancer therapy. The disclosed methods enhance the performance of the system in obtaining the inhibitors.
[0098] This invention will be better understood from the Experimental Details that follow. However, one skilled in the art will readily appreciate that the specific methods and results discussed are merely illustrative of the invention as described more fully in the claims that follow thereafter.
EXPERIMENTAL DETAILS
Overview
[0099] Nuclear receptor SET domain containing protein 2 (NSD2) catalyzes the methylation of histone H3 lysine 36 (H3K36). It is overexpressed in human multiple myeloma and several other human cancers. Despite the relevance of NSD2 to cancer, there have been no potent selective inhibitors of this enzyme reported. Here, a combination of kinetic isotope effect measurements and quantum chemical modeling was used to provide sub- details of the transition state structure for NSD2 enzymatic activity. Kinetic isotope effects were measured for the methylation of isolated HeLa cell nucleosomes by NSD2. NSD2 preferentially catalyzes the dimethylation of H3K36 along with a reduced preference for H3K36 monomethylation. Primary [Me-.sup.14C] and [.sup.36S] and secondary [Me-.sup.3H.sub.3], [Me-.sup.2H.sub.3], [5-.sup.14C] and [5-.sup.3H.sub.2] kinetic isotope effects were measured for the methylation of
[0100] H3K36 using specifically labeled S-adenosyl-L-methionine. The intrinsic kinetic isotope effects were used as boundary constraints for quantum mechanical calculations for the NSD2 transition state. The experimental and calculated kinetic isotope effects are consistent with an S.sub.N2 chemical mechanism with methyl transfer as the first irreversible chemical step in the reaction mechanism. The transition state is a late, asymmetric nucleophilic displacement with bond separation of the leaving group more advanced (2.53 ) and bond-making to the nucleophile (2.10 ) more advanced at the transition state. The transition state structure can be represented in a molecular electrostatic potential map to guide the design of inhibitors that mimic the transition state geometry and charge.
Materials and Methods
[0101] Materials. L-[Me-.sup.14C]Methionine and L-[Me-.sup.3H.sub.3]methionine were purchased from PerkinElmer, Inc. D[1-.sup.3H]Ribose, D[6-.sup.3H.sub.2]glucose, D[6-.sup.14C]glucose, and [8-.sup.14C]adenine were purchased from American Radiolabeled Chemicals, Inc. L-[Me-.sup.2H.sub.3]methionine was purchased from Cambridge Isotope Laboratories, Inc. Hexokinase pyruvate kinase, myokinase, phosphoriboisomerase, glucose-6-phosphate dehydrogenase, glutamic acid dehydrogenase and 6-phosphogluconic acid dehydrogenase were purchased from Sigma-Aldrich. Adenine phosphoribosyltransferase, phosphoribosyl--1-pyrophosphate synthetase, and ribokinase and SAM synthetase (SAMsyn) were prepared as previously described (51-53). HeLa cell nucleosome (HeLaNuc) were extracted and purified as primarily mono- and di-nucleosome from cultured HeLa cells as previously described (54). Other chemicals and reagents were obtained from commercial sources and used without further purification. Human NSD2 SET domain (amino acid residues 980-1365) was expressed recombinantly and purified, and contained no bound SAM or SAH.
[0102] Human NSD2 has the amino acid sequence (NCBI Accession No. 096028, SEQ ID NO:1):
TABLE-US-00001 1 mefsikqsplsvqsvvkcikmkqapeilgsangktpscevnrecsvflskaqlssslqeg 61 vmqkfnghdalpfipadklkdltsrvfngepgandaklrfesqemkgigtppnttpikng 121 speiklkitktymngkplfessicgdsaadvsqseengqkpenkarrnrkrsikydslle 181 qglveaalvskisspsdkkipakkescpntgrdkdhllkynvgdlvwskvsgypwwpcmv 241 sadpllhsytklkgqkksarqyhvqffgdaperawifekslvafegegqfeklcqesakq 301 aptkaekikllkpisgklraqwemgivqaeeaasmsveerkakftflyvgdqlhlnpqva 361 keagiaaeslgemaessgvseeaaenpksvreecipmkrrrraklcssaetleshpdigk 421 stpqktaeadprrgvgsppgrkkttvsmprsrkgdaasqflvfcqkhrdevvaehpdasg 481 eeieellrsqwsllsekqraryntkfalvapvqaeedsgnvngkkrnhtkriqdptedae 541 aedtprkrlrtdkhslrkrdtitdktartssykameaasslksqaatknlsdackplkkr 601 nrastaassalgfskssspsasltenevsdspgdepsespyesadetqtevsvsskkser 661 gvtakkeyvcqlcekpgslllcegpccgafhlaclglsrrpegrftcsecasgihscfvc 721 kesktdvkrcvvtqcgkfyheacvkkypltvfesrgfrcplhscvschasnpsnprpskg 781 kmmrcvrcpvayhsgdaclaagcsviasnsiictahftarkgkrhhahvnvswcfvcskg 841 gsllccescpaafhpdclniempdgswfcndcragkklhfqdiiwvklgnyrwwpaevch 901 pknvppniqkmkheigefpvfffgskdyywthqarvfpymegdrgsryqgvrgigrvfkn 961 alqeaearfreiklqrearetqeserkpppykhikvnkpygkvqiytadiseipkcnckp 1021 tdenpcgfdseclnrmlmfechpqvcpagefcqnqcftkrqypetkiiktdgkgwglvak 1081 rdirkgefvneyvgelideeecmarikhahendithfymltidkdriidagpkgnysrfm 1141 nhscqpncetlkwtvngdtrvglfavcdipagteltfnynldclgnektvcrcgasncsg 1201 flgdrpktsttlsseekgkktkkktrrrrakgegkrqsedecfrcgdggqlvlcdrkfct 1261 kayhlsclglgkrpfgkwecpwhhcdvcgkpstsfchlcpnsfckehqdgtafsctpdgr 1321 syccehdlgaasvrstktekpppepgkpkgkrrrrrgwrrvtegk.
[0103] Methylation of HeLa cell nucleosome. NSD2 reaction mixtures containing 1 M HeLaNuc, 100 nM NSD2, and 20 M [Me-.sup.2H.sub.3]-SAM in 50 mM Tris-HCl (pH 9.0) with 5 mM MgCl.sub.2, 30 mM NaCl, 4 mM dithiothreitol, and 5% glycerol were monitored by LC-MS to track newly installed methyl marks.
[0104] Synthesis of isotope labeled SAM [1-.sup.3H]-, [5-.sup.3H.sub.2]-, and [5-.sup.14C]-labeled ATPs were prepared as described previously (51). [8-.sup.14C]-ATP was synthesized enzymatically in an analogous manner using [8-.sup.14C]-labeled adenine (
[0105] Measurement of KIEs and forward commitment. KIEs on V/K were measured using the competitive radiolabel approach (25, 51). SAM labeled at the atomic position of interest was mixed with an appropriate remote-labeled SAM bearing the light isotope at the position of interest shown in Table 2. KIEs were calculated from the change in isotope ratio in the remaining SAM substrate after 15-45% of the SAM substrate. Forward commitment (C.sub.f) was measured using the isotope trapping method (28).
[0106] KIE measurements. KIEs were measured under competitive radiolabel conditions where the light substrate contained a remote 1-.sup.3H or 8-.sup.14C to track the light isotope at the position of interest. For .sup.36S and Me-.sup.2H.sub.3 KIEs the heavy substrate also contained a remote radiolabel to track the stable heavy isotope at the position of interest in the same way. The heavy and light substrates were mixed with a counts-per-minute (cpm) ratio for .sup.3H:.sup.14C of approximately 1:1. Typical reactions contained 2.5 M SAM (total of heavy, light and unlabeled), 1.5 M HeLaNuc, and 10 nM NSD2 in 500 L 50 mM Tris-HCl (pH 9.0) with 5 mM MgCl.sub.2, 30 mM NaCl, 4 mM dithiothreitol, and 5% glycerol. A 250 L portion of each mixture was removed to measure the isotope ratio of the unreacted substrate and immediately quenched by addition of 10 mM H.sub.2SO.sub.4. NSD2 was added to the remaining samples and allowed to proceed until 15-45% of the SAM was consumed (f=0.15-0.45). Reactions were quenched as above and frozen over dry ice to prevent SAM degradation before purification. Control reactions containing no HeLa nucleosome were run in parallel to control for SAM degradation during the incubation and purification procedure. SAM and SAH were isolated from each sample by analytical reversed-phase HPLC employing method B, where SAM and SAH elute at 5.5 and 15.5 min, respectively. The collected SAM and SAH fractions were dried by centrifugation under vacuum, dissolved in 500 L of water and mixed with 10 mL of Ultima Gold scintillation fluid (PerkinElmer).
[0107] Samples were counted for radioactivity in a Tricarb 2910 TR scintillation counter (PerkinElmer) in dual-channel fashion where the .sup.3H signal appears only in channel 1 and the .sup.14C signal appears in both channels. The cpm per channel was determined from the average of 10 cycles of scintillation counting at 10 min per sample. The ratio of .sup.14C cpm in channel 1:2 (r) was determined for standards containing only .sup.14C-labeled SAM purified in an identical manner to the KIE reactions. The .sup.3H and .sup.14C signals were calculated by Eq. 2 and Eq. 3, respectively,
.sup.3H=CPM.sub.channel1(rCPM.sub.channel2) [2]
.sup.14C=CPM.sub.channel2(1+r) [3].
[0108] Experimental KIEs were calculated from the change of isotope ratio of the heavy to light isotopes of unreacted SAM initially (R.sub.0) and at f=0.15-0.45 (R.sub.f). The KIEs were extrapolated to 0% conversion using Eq. 4,
V/K=ln(1f)/ln[(1f)(R.sub.f/R.sub.0)][4]
where f is the fraction of conversion determined from the ratio of cpm from the remote label in the product SAH to the total cpm of remote label in both SAM and SAH. Each reported KIE is the average of at least six replicates measured from two independent experiments.
[0109] Measurement of Forward Commitment Factor. The forward commitment factor (C.sub.f) for SAM was measured by isotope trapping (28). NSD2 (10 M) was incubated for 5 min at 25 C. with [1-.sup.3H] SAM (40 M) in 50 mM Tris-HC1 (pH 9.0) with 5 mM MgCl.sub.2, and 4 mM dithiothreitol allowing formation of an equilibrium enzyme-SAM complex (EA). A chase solution (480 L; 1 mM unlabeled SAM, 2 M HeLaNuc, 50 mM Tris-HCl (pH 9.0) with 5 mM MgCl.sub.2, 4 mM dithiothreitol, 30 mM NaCl, and 5% glycerol) was rapidly mixed with 20 L of the EA complex solution. Four 125 L aliquots were removed and quenched with 10 mM H.sub.2SO.sub.4 at the indicated times in
C.sub.f=Y/(1Y) [5]
where Y is the ratio of labeled SAH produced to initial ES complex at time zero. Intrinsic KIEs were obtained by correcting the observed KIEs (V/K) for forward commitment by Eq.1.
[0110] Computational methods. The TS for methyl transfer catalyzed by NSD2 was studied by density functional theory in m062X/6-31G* as implemented in Gaussian 09 (39). Starting coordinates for the TS were derived from an overlay of the crystal structures of NSD1 (PDB: 3OOI) (35), SET7/9 (PDB: 2F69 and 1XQH) (36), SET8 (PDB: 3F9Y and 3F9W) (
[0111] Natural bond orbital (NBO) analysis was performed for TS2 and the SAM (
[0112] Synthesis of Isotopically labeled ATP. [5-.sup.3H]ATP and [5-.sup.14C]ATP were enzymatically synthesized and purified as previously described from [6-.sup.3H]glucose and [6-.sup.14C]glucose, respectively (51). Each reaction contained 0.5 mM glucose (combination of hot and cold), 2 mM adenine, 25 M ATP, 20 mM MgCl.sub.2, 5 mM NADP, 20 mM PEP, 50 mM KCl, 20 mM GlyGly, 100 mM KH.sub.2PO.sub.4 (pH 7.4), 1 U mL.sup.1 of HK, 5 U mL.sup.1 of MK, 1 U mL.sup.1 of G-6PD, 1 U mL.sup.1 of 6-PGD, 5 U mL.sup.1 of PRI, 10 U mL.sup.1 of PK, 5 U mL.sup.1 PRPPase, and 5 U mL.sup.1 of APRTase.
[0113] The synthesis of [1-.sup.3H]ATP used [1-.sup.3H]ribose as the labeled precursors. Each reaction contained 0.8 mM ribose (combination of hot and cold), 2 mM adenine, 0.1 mM ATP, 20 mM PEP, 10 mM MgCl.sub.2, 100 mM KH.sub.2PO.sub.4 (pH 7.4), with 5 U mL.sup.1 of RK, 2 U mL.sup.1 of MK, 10 U mL.sup.1 of PK, 5 U mL.sup.1 PRPPase, and 2 U mL.sup.1 of ARPTase.
[0114] [8-.sup.14C]ATP was prepared from [8-.sup.14C]adenine enzymatically. Reactions consisted of 1 mM adenine (total of hot and cold), 2.4 mM PRPP, 0.1 mM ATP, 20 mM PEP, 10 mM MgCl.sub.2, 100 mM KH.sub.2PO.sub.4 (pH 7.4), with 2 U mL.sup.1 of MK, 20 U mL.sup.1 PK, and 2 U mL.sup.1 of APRTase.
[0115] Synthesis and purification of isotope labeled SAM. Labeled SAM were prepared using E. coli SAMSyn from the corresponding labeled ATPs or methionines (Table 1). Typical reactions contained 1 mM methionine, 1 mM ATP, and 800 nM MAT in 500 ,L of 20 mM Tris-HCl, pH 8.0 containing 25 mM MgSO.sub.4, 50 mM K.sub.250.sub.4, and 8% -mercaptoethanol, and were incubated at 37 C. for 2-3 hours. For radiolabeled methionine 50 Ci of labeled methionine was diluted to 1 mM using cold methionine. Radiolabeled ATPs were diluted to 1 mM with cold ATP in a similar manner. Labeled SAMs were purified by reverse-phase high performance liquid chromatography (HPLC) using water with 0.1% formic acid for 4 min followed by a linear gradient of 0-45% acetonitrile over 6 min and holding at 45% acetonitrile for 10 min before re-equilibrating (HPLC method A). SAM elutes at 3 min under these conditions. The isolated SAMs were dried by centrifugation under vacuum and further purified by reverse-phase HPLC using 50 mM ammonium formate pH 4 for 4 min followed by a linear gradient of 0-30% acetonitrile in the same buffer over 8 min holding at 30% acetonitrile for 8 min (HPLC method B). All labeled SAMs co-elute with authentic SAM. Using this method labeled SAMs were isolated as a single isomer (S,S) in greater than 95% purity.
[0116] Expression and Purification of apoWSET(980-1365). Full-length (fl) human NSD2 cDNA was PCR amplified from the cDNA library of a human breast cancer cell line (using Kozak-adapted 5 gene-specific primer and 3 gene-specific primer) and the PCR product was cloned into pENTR/TEV/D-TOPO vector. NSD2(980-1365) was generated from NSD2(full length) cDNA with Tev sequence at 5 prime end and put into pDONR221. An LR reaction was performed between pDEST8HisGSTv2 vector and pDONR221-TevNSD2(980-1365) construct to generate a Baculovirus expression construct pDESTHisGSTv2-TevNSD2(980-1365). Baculovirus expressing HisGST-TevNSD2(980-1365) was generated by transforming the construct into DH10Bac cells via a Bac-to-Bac system. The virus was amplified and protein was expressed in SF9 cells. All protein purification steps were carried out at 4 C. HisGST-TevNSD2(980-1365) was released from baculoviral infected SF9 cells by sonication and captured by batch adsorption onto Glutathione Sepharose 4B (GE Healthcare) from clarified cell lysate supernatant. NSD2(980-1365) was released by overnight on column cleavage with tobacco etch virus protease (TEV 6His-protease S216V). Cofactor S-adenosylmethionine (SAM) was removed from NSD2(980-1365) by capture onto Mono S in 2 M Urea at pH=7. After extensive washing with 1.5 M Urea, MMSET(980-1365) was eluted with an increasing linear salt and decreasing Urea gradients. The Mono S pool was concentrated and further fractionated on Superdex 200. Removal of SAM was confirmed by heat precipitation of NSD2(980-1365) for 20 min at 55 C. and the SAM concentration was measured by absorbance at 260 nm in the supernatant (modified method from (57)). After unfolding and refolding the activity of apo NSD2(980-1365) demonstrated equivalent specific activity as the initial SAM-bound NSD2(980-1365) against HeLaNuc.
[0117] LC-MS analysis of HeLaNuc products. Reactions of NSD2 (100 nM) with HeLaNuc (2 M) and [Me-.sup.2H.sub.3]SAM (20 M) in 500 L 50 mM Tris-HC1 (pH 9.0) with 5 mM MgCl.sub.2, 30 mM NaCl, 4 mM dithiothreitol, and 5% glycerol were allowed to proceed for 0, 40, 80 and 160 min and stopped with 0.5% formic acid. A 10 L volume of each sample, containing approximately 1.2 g of H3 protein, was removed and diluted with 20 L of buffer containing 100 mM ammonium bicarbonate and 5 mM calcium acetate. 5 L of 45 mM DTT solution was added to each sample followed by 2.5 L (125 ng) of ArgC (Protea Biosciences) solution. The samples were allowed to digest at 37 C. over 2.5 h and then stopped by adding 1 L of formic acid to each sample. Duplicate samples were prepared for each time point and analyzed by LC-MS on an LTQ-Orbitrap Velos Pro equipped with an Agilent 1100 nano-HPLC system. Methylated products were observed for the peptide containing amino acids 27-40 of histone H3. The approximate distribution of each product was calculated on the basis of their ion abundance.
Results and Discussion
[0118] NSD2 di-methylates histone H3 at lysine 36 of HeLa cell nucleosomes. The substrate and product specificity of NSD2 is dependent on both the nature of the substrate and the NSD2 construct used (17, 18). The product distribution was analyzed using extracted HeLaNuc as a mimic of the native substrate and a NSD2 construct containing the C-terminal SET domain and basic post-SET extensions (residues 980-1365). HeLaNuc contain a heterogeneous mixture of preexisting methyl marks (26). The installation of new methyl marks was tracked using [Me-.sup.2H.sub.3]-SAM and the products monitored by LC-MS after protease digestion (
[0119] Measurement of intrinsic KIEs and forward commitment. KIEs for methylation of HeLaNuc histone H3K36 by NSD2 were measured using a competitive radiolabel approach. Under these conditions the observed KIEs on V.sub.max/K.sub.m (V/K) include contributions from all isotopically sensitive steps up to and including the first irreversible reaction, which for PKMT is generally accepted to be CH.sub.3-transfer (5). Thus any events preceding CH.sub.3-transfer, including substrate binding and lysine deprotonation, can lead to an observed forward commitment (C.sub.f), which would lower the magnitude of measured KIEs. C.sub.f is a measure of the distribution of enzyme bound substrate that proceeds to form product rather than equilibrate with free substrate. Using the isotope trapping method (28), a C.sub.f of 0.0870.003 was measured for the reaction of SAM with NSD2.sub.SET (
(V/K)=(k=C.sub.f)/(1+C.sub.f) [1].
[0120] KIEs measured for the atomic positions surrounding the methyltransfer reaction coordinate are summarized in Table 2 and
[0121] A large primary .sup.14C KIE is consistent with an S.sub.N2 mechanism where the CH.sub.3-transfer is largely rate limiting. The magnitude of the primary KIE of the transferring methyl-group for S.sub.N2 reaction mechanisms is proportional to the symmetry of the TS structure, with the largest isotope effects expected when bond order to the nucleophile and leaving group are equal (29). A large inverse -secondary .sup.3H KIE for the methyl group hydrogen of 0.770.03 suggests the hydrogen vibrational modes are constrained at the TS relative to the ground state. To confirm the magnitude of this isotope effect, the -secondary [Me-.sup.2H.sub.3] KIE was measured as well. The intrinsic [Me-.sup.2H.sub.3] KIE of 0.8330.007 is in good agreement with the [Me-.sup.3H.sub.3] isotope effect given the difference in the reduced mass of each isotope (30). Such large inverse -secondary KIEs have previously been observed for the methylation of catechol substrates by catechol O-methyltransferase (COMT) (31, 32). In that case the large inverse KIE was attributed to compression of the methyl donor-acceptor distance at the transition state (31). However, QM/MM calculations suggest that such compression is not required to explain the observed inverse KIEs (33, 34).
[0122] Computational models of the NSD2 TS. The TS structure for methylation of H3K36 by NSD2 was modeled using the intrinsic KIEs as constraints. An input for TS analysis was derived from the conformation of SAM in the crystal structure of NSD1 (PDB: 3OOI) (35) as no structure of NSD2 was available. The catalytic SET domain of NSD1 and NSD2 are highly homologous containing 79% sequence identity. To model the lysine position, the SET domain of NSD1 was overlaid with those of SET7/9, SET8 and PIMS bound to their corresponding peptide substrates (
[0123] The TS geometry for NSD2 can be described by a combination of the CN and CS distances, d1 and d2, shown in
[0124] Previous work indicates quantum mechanical (QM) tunneling can contribute to the magnitude of heavy atom KIEs (41, 42). To assess the possibility that QM tunneling contributes to the observed Me-.sup.14C KIE, predicted Me-.sup.14C KIEs were calculated while including a correction for carbon tunneling. For the present system, the magnitude of predicted KIEs including tunneling are larger than the intrinsic value for all TS geometries tested (
[0125] Secondary hydrogen KIEs can also be influenced by geometric and electronic constraints imposed by the enzyme that are not reproduced using a simplified TS model. Previous QM/MM studies of COMT have shown that increasing the number of atoms included in the QM region impacts the predicted donor-acceptor geometry in the bound complex of COMT, SAM and catechol (43). Thus, it is possible that including atoms from amino acids from NSD2 active site residues in the QM calculation will influence the predicted KIEs. Here, the backbone carbonyls of R1138 and F1117 and side chain of Y1179, whose positions are conserved amongst SET domain containing PKMT, were included in the TS calculation (
[0126] TS bond order and charge distribution. The total bond order to both the leaving group and nucleophile in an S.sub.N2 reaction can vary between 0, for extremely loose TS, up to 2 for highly compact TS geometry. By comparison, TS2 has calculated bond orders of 0.382 and 0.482 for the CS and CN bonds, respectively. The sum of these bond orders is consistent with a loose donor-acceptor distance in the NSD2 TS structure. The electrostatic potential and natural bond orbital (NBO) charge distribution in TS2 was compared to that of SAM and the methyltransferase inhibitor sinefungin. A positive charge is predominantly localized on the sulfur atom of SAM in GS2, as indicated by the NBO charge of 0.930 for the sulfur atom compared to 0.024 for the Me group carbon and hydrogen. In TS2 the positive charge on sulfur is reduced to 0.398 with a corresponding increase for the Me group to 0.326, consistent with an S.sub.N2 TS where the positive charge is distributed between the leaving group, transferring group and nucleophile. The same distribution is observed for the electrostatic potential, where a positive electrostatic potential is localized on sulfur in SAM and distributed between the sulfur, methyl carbon and lysine nitrogen in TS2. Analogues of sinefungin have been reported as selective inhibitors of SETD2, and proposed to mimic the TS of this enzyme (50). However, the electrostatic potential distribution for sinefungin appears to more closely mimic the charge localization of SAM than TS2. It is likely that chemically stable analogues of the NSD2 TS will require that a positive charge be distributed between at least two atoms and located at least 2.5 from a neutral atom mimicking the leaving group sulfur.
CONCLUSIONS
[0127] Epigenetic control by methylation of histones is essential in development. Loss of regulation of methylation pathways is involved in developmental disorders and oncogenesis. Despite interest in NSD2, there have been no selective inhibitors reported. Analogues designed to mimic the NSD2 transition state structure are potential enzyme inhibitors. A combination of experimental kinetic isotope effects and quantum chemistry was used to define the sub-A details of reaction chemistry at the transition state of NSD2. Electrostatic potential maps of reactants and transition states provide a high-resolution map of reaction chemistry and a blueprint for design of transition state analogues for this mechanism of epigenetic regulation.
[0128] NSD2 predominantly catalyzes the dimethylation of HeLaNuc on H3K36 in vitro, consistent with the activity of full length NSD2 (11, 17). Using a combination of experimental KIE measurements and DFT calculations, a TS structure was determined for the NSD2 SET domain catalyzed methylation of histone H3K36. The intrinsic KIEs are consistent with an S.sub.N2 reaction mechanism where methyl group transfer is significantly rate limiting. All of the intrinsic KIEs are consistent with a product like TS geometry with a longer leaving group distance and shorter nucleophile distances of 2.53 and 2.10 , respectively. A comparison of electrostatic potential for the predicted TS structure and SAM GS indicate the positive charge on SAM is distributed between the leaving group sulfur, the transferring methyl group and the nitrogen nucleophile at the TS. This geometry and charge distribution can now guide future transition state analogue design for inhibitors of NSD2.
TABLE-US-00002 TABLE 1 Synthesis of isotopically labeled SAM from labeled ATP and Met.
TABLE-US-00003 TABLE 2 Summary of experimental and predicted KIEs for H3 K36 methylation catalyzed by NSD2. SAM substrates observed predicted KIEs heavy light (V/K)KIEs.sup.a intrinsic KlEs.sup.b (TS1).sup.c (TS2) [Me.sup.14C] [1-.sup.3H] 1.105 0.004 1.113 0.006 1.114 1.118 [Me.sup.3H.sub.3] [8-.sup.14C] 0.79 0.03 0.77 0.03 0.783 0.768 [Me.sup.2H.sub.3, [8-.sup.14C] 0.845 0.006 0.833 0.007 0.839 0.826 1-.sup.3H] [5-.sup.14C] [1-.sup.3H] 0.995 0.009 1.00 0.01 1.001 1.004 [5-.sup.3H.sub.2] [8-.sup.14C] 1.05 0.01 1.05 0.01 1.137 1.057 [.sup.36S, 8-.sup.14C] [1-.sup.3H] 1.017 0.007 1.018 0.008 1.020 1.022 [1-.sup.3H] [8-.sup.14C] 1.00 0.01 1.00 0.01 .sup.aObserved KIE are reported as the mean standard deviation from at least six replicates from two independent experiments. .sup.bIntrinsic KIEs are calculated from observed (V/K)KIEs by correcting for a C.sub.f = 0.087 0.003. .sup.cPredicted KIEs for TS1 (FIG. 3B)best matching intrinsic KIEs with d1 = 1.8 and d2 = 2.6 .
REFERENCES
[0129] 1. Kouzarides T (2007) Chromatin modifications and their function. Cell 128(4):693-705.
[0130] 2. Jenuwein T & Allis CD (2001) Translating the Histone Code. Science 293(5532):1074-1080.
[0131] 3. Dillon S C, Zhang X, Trievel R C, & Cheng X (2005) The SET-domain protein superfamily: protein lysine methyltransferases. Genome Biol. 6(8):227.
[0132] 4. Zhang X & Bruice T C (2008) Enzymatic mechanism and product specificity of SET-domain protein lysine methyltransferases. Proc. Natl. Acad. Sci. U S. A. 105(15):5728-5732.
[0133] 5. Kipp D R, Quinn C M, & Fortin P D (2013) Enzyme-dependent lysine deprotonation in EZH2 catalysis. Biochemistry 52(39):6866-6878.
[0134] 6. Cao R, et al. (2002) Role of histone H3 lysine 27 methylation in Polycomb-group silencing. Science 298(5595):1039-1043.
[0135] 7. Wozniak G G & Strahl B D (2014) Hitting the mark: interpreting lysine methylation in the context of active transcription. Biochim. Biophys. Acta 1839(12):1353-1361.
[0136] 8. Schneider R, Bannister A J, & Kouzarides T (2002) Unsafe SETs: histone lysine methyltransferases and cancer. Trends Biochem. Sci. 27(8):396-402.
[0137] 9. Stec I, et al. (1998) WHSC1, a 90 kb SET domain-containing gene, expressed in early development and homologous to a Drosophila dysmorphy gene maps in the Wolf-Hirschhorn syndrome critical region and is fused to IgH in t(4;14) multiple myeloma. Hum. Mol. Genet. 7(7):1071-1082.
[0138] 10. Chesi M, et al. (1998) The t(4;14) translocation in myeloma dysregulates both FGFR3 and a novel gene, MMSET, resulting in IgH/MMSET hybrid transcripts. Blood 92(9):3025-3034.
[0139] 11. Kuo A J, et al. (2011) NSD2 links dimethylation of histone H3 at lysine 36 to oncogenic programming. Mol. Cell 44(4): 609-620.
[0140] 12. Morishita M & di Luccio E (2011) Cancers and the NSD family of histone lysine methyltransferases. Biochimica Et Biophysica Acta-Reviews on Cancer 1816(2): 158-163.
[0141] 13. Hudlebusch H R, et al. (2011) MMSET Is Highly Expressed and Associated with Aggressiveness in Neuroblastoma. Cancer Res. 71(12):4226-4235.
[0142] 14. Morishita M, Mevius D, & di Luccio E (2014) In vitro histone lysine methylation by NSD1, NSD2/MMSET/WHSC1, and NSD3/WHSC1L. BMC Struct. Biol. 14(1):25.
[0143] 15. Nimura K, et al. (2009) A histone H3 lysine 36 trimethyltransferase links Nkx2-5 to Wolf-Hirschhorn syndrome. Nature 460(7252):287-291.
[0144] 16. Pei H, et al. (2011) MMSET regulates histone H4K20 methylation and 53BP1 accumulation at DNA damage sites. Nature 470(7332):124-128.
[0145] 17. Li Y, et al. (2009) The Target of the NSD Family of Histone Lysine Methyltransferases Depends on the Nature of the Substrate. J. Biol. Chem. 284(49):34283-34295.
[0146] 18. Allali-Hassani A, et al. (2014) A Basic Post-SET Extension of NSDs Is Essential for Nucleosome Binding In Vitro. J. Biomol. Screen. 19(6):928-935.
[0147] 19. Kuo A J, et al. (2011) NSD2 Links Dimethylation of Histone H3 at Lysine 36 to Oncogenic Programming. Mol. Cell 44(4):609-620.
[0148] 20. Schramm V L (2007) Enzymatic transition state theory and transition state analogue design. J. Biol. Chem. 282(39):28297-28300.
[0149] 21. Schramm V L (2011) Enzymatic Transition States, Transition-State Analogs, Dynamics, Thermodynamics, and Lifetimes. Annual Review of Biochemistry, Vol 80 80:703-732.
[0150] 22. Zhang X & Bruice T C (2008) Product specificity and mechanism of protein lysine methyltransferases: insights from the histone lysine methyltransferase SET8. Biochemistry 47(25):6671-6677.
[0151] 23. Zhang X & Bruice T C (2007) Histone lysine methyltransferase SET7/9: formation of a water channel precedes each methyl transfer. Biochemistry 46(51):14838-14844.
[0152] 24. Cleland W W (1995) Isotope effects: determination of enzyme transition state structure. Methods Enzymol. 249:341-373.
[0153] 25. Schramm V L (1999) Enzymatic transition-state analysis and transition-state analogs. Methods Enzymol. 308:301-355.
[0154] 26. Young N L, et al. (2009) High Throughput Characterization of Combinatorial Histone Codes. Mol. Cell. Proteomics 8(10):2266-2284.
[0155] 27. Wagner E J & Carpenter P B (2012) Understanding the language of Lys36 methylation at histone H3. Nat. Rev. Mol. Cell Biol. 13(2):115-126.
[0156] 28. Rose I A (1980) The isotope trapping method: desorption rates of productive E.S complexes. Methods Enzymol. 64:47-59.
[0157] 29. Westaway K C (2006) Using kinetic isotope effects to determine the structure of the transition states of SN2 reactions. Adv. Phys. Org. Chem., ed Richard J P (Academic Press), Vol Volume 41, pp 217-273.
[0158] 30. Swain C G, Stivers E C, Reuwer J F, & Schaad L J (1958) Use of Hydrogen Isotope Effects to Identify the Attacking Nucleophile in the Enolization of Ketones Catalyzed by Acetic Acid1-3. J. Am. Chem. Soc. 80(21):5885-5893.
[0159] 31. Hegazi M, F., Borchardt R, T., & Schowen R, L. (1979) alpha-Deuterium and Carbon-13 Isotope Effects for Methyl Transfer Catalyzed by Catechol O-Methyltransferase. SN2Like transition State. J. Am. Chem. Soc. 101(15):4359-4365.
[0160] 32. Zhang J & Klinman J P (2011) Enzymatic methyl transfer: role of an active site residue in generating active site compaction that correlates with catalytic efficiency. J. Am. Chem. Soc. 133(43):17134-17137.
[0161] 33. Ruggiero G D, Williams I H, Roca M, Moliner V, & Tunon I (2004) QM/MM determination of kinetic isotope effects for COMT-catalyzed methyl transfer does not support compression hypothesis. J. Am. Chem. Soc. 126(28):8634-8635.
[0162] 34. Lameira J, Bora R P, Chu Z T, & Warshel A (2015) Methyltransferases do not work by compression, cratic, or desolvation effects, but by electrostatic preorganization. Proteins 83(2):318-330.
[0163] 35. Qiao Q, et al. (2011) The structure of NSD1 reveals an autoregulatory mechanism underlying histone H3K36 methylation. J. Biol. Chem. 286(10):8361-8368.
[0164] 36. Couture J F, Collazo E, Hauk G, & Trievel R C (2006) Structural basis for the methylation site specificity of SET7/9. Nat. Struct. Mol. Biol. 13(2):140-146.
[0165] 37. Couture J F, Dirk L M, Brunzelle J S, Houtz R L, & Trievel R C (2008) Structural origins for the product specificity of SET domain protein methyltransferases. Proc. Natl. Acad. Sci. U S. A. 105(52):20659-20664.
[0166] 38. Zhang X, et al. (2003) Structural basis for the product specificity of histone lysine methyltransferases. Mol. Cell 12(1): 177-185.
[0167] 39. Frisch M J, et al. (2009) Gaussian 09 (Gaussian, Inc., Wallingford, Conn., USA).
[0168] 40. Anisimov V & Paneth P (1999) ISOEFF98. A program for studies of isotope effects using Hessian modifications. J. Math. Chem. 26(1-3):75-86.
[0169] 41. Gonzalez-James O M, et al. (2010) Experimental evidence for heavy-atom tunneling in the ring-opening of cyclopropylcarbinyl radical from intramolecular 12C/13C kinetic isotope effects. J. Am. Chem. Soc. 132(36):12548-12549.
[0170] 42. Vetticatt M J & Singleton D A (2012) Isotope effects and heavy-atom tunneling in the
[0171] Roush allylboration of aldehydes. Org. Lett. 14(9):2370-2373.
[0172] 43. Zhang J, Kulik H J, Martinez T J, & Klinman J P (2015) Mediation of donor-acceptor distance in an enzymatic methyl transfer reaction. Proc. Natl. Acad. Sci. U S. A. 112(26):7954-7959.
[0173] 44. Horowitz S, et al. (2013) Conservation and functional importance of carbon-oxygen hydrogen bonding in AdoMet-dependent methyltransferases. J. Am. Chem. Soc. 135(41):15536-15548.
[0174] 45. Horowitz S, Yesselman J D, Al-Hashimi H M, & Trievel R C (2011) Direct evidence for methyl group coordination by carbon-oxygen hydrogen bonds in the lysine methyltransferase SET7/9. J. Biol. Chem. 286(21):18658-18663.
[0175] 46. Hu P & Zhang Y (2006) Catalytic Mechanism and Product Specificity of the Histone Lysine Methyltransferase SET7/9: An ab Initio QM/MM-FE Study with Multiple Initial Structures. J. Am. Chem. Soc. 128(4):1272-1278.
[0176] 47. Zhang X & Bruice T C (2007) A quantum mechanics/molecular mechanics study of the catalytic mechanism and product specificity of viral histone lysine methyltransferase. Biochemistry 46(34):9743-9751.
[0177] 48. Zhang X & Bruice T C (2007) Catalytic mechanism and product specificity of rubisco large subunit methyltransferase: QM/MM and MD investigations. Biochemistry 46(18):5505-5514.
[0178] 49. Zhang X & Bruice T C (2008) Mechanism of product specificity of AdoMet methylation catalyzed by lysine methyltransferases: transcriptional factor p53 methylation by histone lysine methyltransferase SET7/9. Biochemistry 47(9):2743-2748.
[0179] 50. Zheng W, et al. (2012) Sinefungin Derivatives as Inhibitors and Structure Probes of Protein Lysine Methyltransferase SETD2. J. Am. Chem. Soc. 134(43):18004-18014.
[0180] 51. Parkin D W, Leung H B, & Schramm V L (1984) Synthesis of nucleotides with specific radiolabels in ribose. Primary 14C and secondary 3H kinetic isotope effects on acid-catalyzed glycosidic bond hydrolysis of AMP, dAMP, and inosine. J. Biol. Chem. 259(15):9411-9417.
[0181] 52. Singh V, Lee J E, Nez S, Howell P L, & Schramm V L (2005) Transition State Structure of 5 -Methylthioadenosine/S-Adenosylhomocysteine Nucleosidase from Escherichia coli and Its Similarity to Transition State Analogues\. Biochemistry 44(35):11647-11659.
[0182] 53. Markham G D, Hafner E W, Tabor C W, & Tabor H (1980) S-Adenosylmethionine synthetase from Escherichia coli. I Biol. Chem. 255(19):9082-9092.
[0183] 54. Jiang Y, et al. (2011) Methyltransferases prefer monomer over core-trimmed nucleosomes as in vitro substrates. Anal. Biochem. 415(1):84-86.
[0184] 55. Poulin M B, Du Q, & Schramm V L (2015) Chemoenzymatic synthesis of 36S isotopologues of methionine and S-adenosyl-L-methionine. J. Org. Chem. 80(10):5344-5347.
[0185] 56. Kim S, Bolton E E, & Bryant S H (2013) PubChem3D: conformer ensemble accuracy. J. cheminformatics 5(1): 1.
[0186] 57. Forneris F, Binda C, Vanoni M A, Mattevi A, & Battaglioli E (2005) Histone demethylation catalysed by LSD1 is a flavin-dependent oxidative process. FEBS Lett. 579(10):2203-2207.
[0187] 58. Bagdassarian, C. K., Schramm, V. L., and Schwartz, S. D. (1996) Molecular electrostatic potential analysis for enzymatic substrates, competitive inhibitors and transition-state inhibitors, J. Am. Chem. Soc. 118, 8825-8836.
[0188] 59. U.S. Pat. No. 8,541,567 B2, issued Sep. 24, 2013, Schramm, Transition state structure of 5-methylthioadenosine/s-adenosylhomocysteine nucleosidases.
[0189] 60. U.S. Patent Application Publication No. 2010/0062995, published Mar. 11, 2010, Schramm, Transition state structure of human 5methylthioadenosine phosphorylase.
[0190] 61. U.S. Patent Application Publication No. 2011/0301104, published Dec. 8, 2011, Schramm, Transition state structure of orotate phosphoribosyl transferases and uses thereof.
[0191] 62. U.S. Patent Application Publication No. 2007/0275988, published Nov. 29, 2007, Schramm, Transition state structure and inhibitors of thymidine phosphorylases.
[0192] 63. PCT International Publication No. WO 2013/126370 A1, published Aug. 29, 2013, Albert Einstein College of Medicine of Yeshiva University, HIV-1 protease transition state and uses thereof.