ONCOLYTIC VIRUS AND CHECKPOINT INHIBITOR COMBINATION THERAPY
20190022203 ยท 2019-01-24
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
A61K39/3955
HUMAN NECESSITIES
C12N2760/20243
CHEMISTRY; METALLURGY
A61K2300/00
HUMAN NECESSITIES
A61K2300/00
HUMAN NECESSITIES
C12N2760/20032
CHEMISTRY; METALLURGY
A61K2039/545
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
A61K45/06
HUMAN NECESSITIES
C12N2760/20232
CHEMISTRY; METALLURGY
A61K39/001184
HUMAN NECESSITIES
C12N2760/20034
CHEMISTRY; METALLURGY
C12N2760/20043
CHEMISTRY; METALLURGY
C12N2710/20034
CHEMISTRY; METALLURGY
C07K2317/76
CHEMISTRY; METALLURGY
C12N2760/20041
CHEMISTRY; METALLURGY
International classification
A61K39/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
The present invention pertains to a combination for simultaneous, separate or sequential use which comprises (a) an oncolytic virus and (b) a checkpoint inhibitor and to its use for the treatment of cancer.
Claims
1. A method for treating and/or preventing cancer or prolonging an anti-tumor response in a mammal in need thereof, comprising administering to the mammal an effective amount of a combination comprising (a) a replicative oncolytic rhabdovirus and (b) one or more checkpoint inhibitors.
2. The method of claim 1, wherein the checkpoint inhibitor is a monoclonal antibody, a humanized antibody, a fully human antibody, a fusion protein or a combination thereof.
3. The method of claim 1, wherein the checkpoint inhibitor inhibits a checkpoint protein selected from the group consisting of: cytotoxic T-lymphocyte antigen-4 (CTLA4), programmed cell death protein 1 (PD-1), PD-L1, PD-L2, B7-H3, B7-H4, herpesvirus entry mediator (HVEM), T cell membrane protein 3 (TIM3), galectin 9 (GAL9), lymphocyte activation gene 3 (LAG3), V-domain immunoglobulin (Ig)-containing suppressor of T-cell activation (VISTA), Killer-Cell Immunoglobulin-Like Receptor (KIR), B and T lymphocyte attenuator (BTLA), T cell immunoreceptor with Ig and ITIM domains (TIGIT), and combinations thereof.
4. The method of claim 3, wherein the checkpoint inhibitor inhibits CTLA-4, PD-1 or PD-L1.
5. The method of claim 4, wherein the checkpoint inhibitor inhibits CTLA-4 and is selected from Ipilimumab and Tremelimumab.
6. The method of claim 4, wherein the checkpoint inhibitor inhibits PD-1 and is selected from Nivolumab, Pembrolizumab, Pidilizumab, lambrolizumab, and AMP-224.
7. The method of claim 4, wherein the checkpoint inhibitor inhibits PD-L1 and is selected from BMS-936559, MEDI-4736, MPDL33280A, M1H1, Atezolizumab, Durvalumab and Avelumab.
8. The method of any one of claims 1-7, wherein the oncolytic rhabdovirus is administered to the mammal in combination with at least two checkpoint inhibitors.
9. The method of any one of claims 1-8, wherein the oncolytic rhabdovirus and the checkpoint inhibitor are administered simultaneously.
10. The method of any one of claims 1-8, wherein the oncolytic rhabdovirus and the checkpoint inhibitor are administered sequentially and wherein a first administration of checkpoint inhibitor occurs prior to a first administration of oncolytic virus and preferably occurs within 30 days of a first administration of oncolytic virus.
11. The method of any preceding claim, wherein the oncolytic rhabdovirus expresses a tumor associated antigen.
12. The method of claim 11, wherein the tumor associated antigen is selected from the group consisting of MAGEA3, Human Papilloma Virus E6/E7 fusion protein, human Six-Transmembrane Epithelial Antigen of the Prostate protein, Cancer Testis Antigen 1, and a variant thereof.
13. The method of claim 11 or 12, wherein the mammal has a pre-existing immunity to the tumor associated antigen.
14. The method of claim 13, wherein the pre-existing immunity in the mammal is established by administering said tumor associated antigen to the mammal prior to administering the oncolytic rhabodvirus.
15. The method of claim 14, wherein the pre-existing immunity in the mammal is established by administering an expression vector encoding said tumor associated antigen to the mammal prior to administering the oncolytic rhabdovirus.
16. The method of claim 15, wherein the expression vector is selected from an adenovirus vector, a poxvirus vector, a retrovirus vector, an alpha virus vector, a plasmid and a loaded antigen-presenting cell.
17. The method of any preceding claim wherein the oncolytic rhabdovirus is an oncolytic vesiculovirus.
18. The method of claim 17, wherein the oncolytic rhabdovirus is a wild type or genetically modified VSV or Maraba strain rhabdovirus.
19. The method of claim 17, wherein the oncolytic rhabdovirus is VSVdelta51 or Maraba MG1.
20. The method of claim 14, wherein the oncolytic rhabodvirus is Maraba MG1.
21. The method of any preceding claim, wherein the oncolytic rhabdovirus is administered as one or more doses of 10.sup.6-10.sup.14 pfu, 10.sup.6-10.sup.12 pfu, 10.sup.8-10.sup.14 pfu, 10.sup.8-10.sup.12 or 10.sup.10-10.sup.12 pfu.
22. The method of any preceding claim, wherein the oncolytic rhabdovirus is administered intravascularly.
23. The method of any preceding claim, wherein the cancer is colorectal cancer, lung cancer, melanoma, pancreatic cancer, ovarian cancer, renal cell carcinoma, cervical cancer, liver cancer, breast cancer, head and neck cancer, prostate cancer, gastro-esophagael junction cancer, brain cancer, and soft tissue sarcoma.
24. The method of claim 23, wherein the cancer is ER/PR-HER2+ breast cancer, triple negative breast cancer, ER and/or PR+HER2+ breast cancer, squamous or non-squamous non-small cell lung cancer (NSCLC) or gastroesophagael junction cancer.
24. The method of any preceding claim, wherein the checkpoint inhibitor is an antibody or fusion protein and is administered as one or more doses of 0.01-10 mg/kg, 0.1-10 mg/kg, 1-10 mg/kg, 2-8 mg/kg, 3-7 mg/kg, 4-5 mg/kg or at least 10 mg/kg.
25. The method of claim 24, wherein the checkpoint inhibitor is administered at least three times per week, at least four times per week, at least five times per week, weekly, bi-weekly, every other week, or every three weeks.
26. The method of any preceding claim, wherein the mammal is a human.
27. The method of any one of claims 11-22 and 24 wherein the cancer expresses the tumor-associated antigen.
28. The method of claim 27, wherein the tumor-associated antigen is MAGE-A3.
29. A method for treating and/or preventing cancer or prolonging an anti-tumor response in a human in need thereof, comprising administering to a human with a cancer expressing the cancer testis antigen melanoma antigen family A3 (MAGE-A3), an effective amount of a combination comprising (a) Maraba MG1 expressing MAGE-A3 and (b) a PD-1 inhibitor.
30. The method of claim 27, wherein the cancer is ER/PR-HER2+ breast cancer, triple negative breast cancer, ER and/or PR+HER2+ breast cancer, squamous or non-squamous NSCLC or gastroesophagael junction cancer.
31. The method of claim 29 or 30, wherein the PD-1 inhibitor is pembrolizumab.
32. The method of any one of claims 29 to 31, wherein the human is administered, preferably intramuscularly, a single priming dose of adenovirus vector expressing MAGE-A3 about 1 to 3 weeks, preferably about two weeks, prior to a first, preferably intravenous, administration of Maraba MG1 expressing MAGE-A3.
33. The method of any one of claims 29-32, wherein Maraba MG1 is administered once or multiple times at a dose of 10.sup.10 to 10.sup.12 pfu, preferably 10.sup.10 or 10.sup.11 pfu.
34. The method of claim 32 or 33, wherein a first dose of the PD-1 inhibitor is administered subsequent to the single priming dose of adenovirus vector expressing MAGE-A3 and prior to the first dose of Maraba MG1 expressing MAGE-A3.
35. The method of any one of claims 29-34, wherein the cancer has progressed after treatment with at least one cycle of chemotherapy, preferably comprising platinum-doublet therapy.
Description
DESCRIPTION OF THE DRAWINGS
[0034] The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present invention. The invention may be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
DETAILED DESCRIPTION OF THE INVENTION
[0056] It has been found that combination therapy with an oncolytic virus (e.g. oncolytic rhabdovirus) and a checkpoint inhibitor results in unexpected improvement in the treatment of cancer. When administered simultaneously, sequentially or separately, the oncolytic virus and the checkpoint inhibitor interact cooperatively and even synergistically to significantly improve survival relative to single administration of either component with no apparent adverse effects or reduction in virus titer. This unexpected effect may allow a reduction in the effective dose of each component, leading to a reduction in side effects and enhancement of clinical effectiveness of the compounds and treatment.
[0057] In several embodiments, a combination therapy for use in the treatment and/or prevention of cancer and/or the establishment of metastases in a mammal is provided comprising co-administering to the mammal (i) a replication competent oncolytic virus in combination with (ii) an immune checkpoint inhibitor. In preferred embodiments, the replication competent oncolytic virus is administered prior to the immune checkpoint inhibitor.
[0058] Oncolytic Virus
[0059] In preferred embodiments, the replication competent oncolytic virus of the combination is an oncolytic rhabdovirus.
[0060] Oncolytic rhabdoviruses have several advantages as the oncolytic virus for use in the combination including the following: (1) Antibodies to the oncolytic rhabdoviruses will be rare to non-existent in most populations of the world. (2) rhabdoviruses replicate more quickly than other oncolytic viruses such as adenovirus, reovirus, measles, parvovirus, retrovirus, and HSV. (3) Rhabdovirus grow to high titers and are filterable through 0.2 micron filter. (4) The oncolytic rhabdoviruses and recombinants thereof have a broad host range, capable of infecting many different types of cancer cells and are not limited by receptors on a particular cell (e.g., coxsackie, measles, adenovirus). (5) The rhabdovirus of the invention is amenable to genetic manipulation. (6) The rhabdovirus also has a cytoplasmic life cycle and do not integrate in the genetic material a host cell, which imparts a more favorable safety profile.
[0061] The archetypal rhabdoviruses are rabies and vesicular stomatitis virus (VSV), the most studied of this virus family. Rhabdovirus is a family of bullet shaped viruses having non-segmented (?)sense RNA genomes. The family Rhabdovirus includes, but is not limited to: Arajas virus, Chandipura virus (AF128868/gi:4583436, AJ810083/gi:57833891, AY871800/gi:62861470, AY871799/gi:62861468, AY871798/gi:62861466, AY871797/gi:62861464, AY871796/gi:62861462, AY871795/gi:62861460, AY871794/gi:62861459, AY871793/gi:62861457, AY871792/gi:62861455, AY871791/gi:62861453), Cocal virus (AF045556/gi:2865658), Isfahan virus (AJ810084/gi:57834038), Maraba virus (SEQ ID ON: 1-6 of U.S. Pat. No. 8,481,023, incorporated herein by reference; HQ660076.1), Carajas virus (SEQ ID NO:7-12 of U.S. Pat. No. 8,481,023, incorporated herein by reference, AY335185/gi:33578037), Piry virus (D26175/gi:442480, Z15093/gi:61405), Vesicular stomatitis Alagoas virus, BeAn 157575 virus, Boteke virus, Calchaqui virus, Eel virus American, Gray Lodge virus, Jurona virus, Klamath virus, Kwatta virus, La Joya virus, Malpais Spring virus, Mount Elgon bat virus (DQ457103/gi191984805), Perinet virus (AY854652/gi:71842381), Tupaia virus (NC_007020/gi:66508427), Farmington, Bahia Grande virus (SEQ ID NO:13-18 of U.S. Pat. No. 8,481,023, incorporated herein by reference, KM205018.1), Muir Springs virus (KM204990.1), Reed Ranch virus, Hart Park virus, Flanders virus (AF523199/gi:25140635, AF523197/gi:25140634, AF523196/gi:25140633, AF523195/gi:25140632, AF523194/gi:25140631, AH012179/gi:25140630), Kamese virus, Mosqueiro virus, Mossuril virus, Barur virus, Fukuoka virus (AY854651/gi:71842379), Kern Canyon virus, Nkolbisson virus, Le Dantec virus (AY854650/gi:71842377), Keuraliba virus, Connecticut virus, New Minto virus, Sawgrass virus, Chaco virus, Sena Madureira virus, Timbo virus, Almpiwar virus (AY854645/gi:71842367), Aruac virus, Bangoran virus, Bimbo virus, Bivens Arm virus, Blue crab virus,
[0062] Charleville virus, Coastal Plains virus, DakArK 7292 virus, Entamoeba virus, Garba virus, Gossas virus, Humpty Doo virus (AY854643/gi:71842363), Joinjakaka virus, Kannamangalam virus, Kolongo virus (DQ457100/gi191984799 nucleoprotein (N) mRNA, partial cds); Koolpinyah virus, Kotonkon virus (DQ457099/gi191984797, AY854638/gi:71842354); Landjia virus, Manitoba virus, Marco virus, Nasoule virus, Navarro virus, Ngaingan virus (AY854649/gi:71842375), Oak-Vale virus (AY854670/gi:71842417), Obodhiang virus (DQ457098/gi191984795), Oita virus (AB116386/gi:46020027), Ouango virus, Parry Creek virus (AY854647/gi:71842371), Rio Grande cichlid virus, Sandjimba virus (DQ457102/gi191984803), Sigma virus (AH004209/gi:1680545, AH004208/gi:1680544, AH004206/gi:1680542), Sripur virus, Sweetwater Branch virus, Tibrogargan virus (AY854646/gi:71842369), Xiburema virus, Yata virus, Rhode Island, Adelaide River virus (U10363/gi:600151, AF234998/gi:10443747, AF234534/gi:9971785, AY854635/gi:71842348), Berrimah virus (AY854636/gi:71842350]), Kimberley virus (AY854637/gi:71842352), or Bovine ephemeral fever virus (NC_002526/gi:10086561).
[0063] In a preferred embodiment, the oncolytic virus of the combination is a wild type Maraba strain rhabdovirus or a variant thereof that has optionally been genetically modified e.g. to enhance tumor selectivity. The Maraba virus may be e.g. a Maraba virus containing a substitution at amino acid 242 of the G protein and/or at amino acid 123 of the M protein as described at col. 2, lines 24-42 of U.S. Pat. No. 9,045,729, the entire contents of which are incorporated herein by reference. In a particularly preferred embodiment, the Maraba virus is Maraba MG1 as described in Brun et al., Mol. Ther., 18(8):1440-1449 (2010). Maraba MG1 is a genetically modified Maraba strain rhabdovirus containing a G protein mutation (Q242R) and an M protein mutation (L123W) that renders the virus hypervirulent in cancer cells yet attenuated in normal cells.
[0064] In another preferred embodiment, the oncolytic rhadovirus is a VSV strain or a variant thereof that has optionally been genetically modified e.g. to enhance tumor selectivity. In a particularly preferred embodiment, the VSV comprises a deletion of methionine at position 51 of the M protein as described in Stojdl et al., Cancer Cell., 4(4):263-75 (2003), the contents of which are incorporated herein by reference.
[0065] In other preferred embodiments, the oncolytic rhabdovirus expresses one or more tumor associated antigens such as oncofetal antigens such as alphafetoprotein (AFP) and carcinoembryonic antigen (CEA), surface glycoproteins such as CA 125, oncogenes such as Her2, melanoma-associated antigens such as dopachrome tautomerase (DCT), GP100 and MART 1, cancer-testes antigens such as the MAGE proteins and NY-ESO1, viral oncogenes such as HPV E6 and E7, and proteins ectopically expressed in tumours that are usually restricted to embryonic or extraembryonic tissues such as PLAC or a variant of a tumor-associated antigen. In such case, the combination therapy is preferably administered to a human with a cancer expressing the tumor associated antigen. A variant of a tumor associated antigen refers to a protein that (a) includes at least one tumor associated antigenic epitope from the tumor associated antigenic protein and (b) is at least 70%, preferably at least 80%, more preferably at least 90% or at least 95% identical to the tumor associated antigenic protein. A database summarizing well accepted antigenic epitopes is provided by Van der Bruggen P, Stroobant V, Vigneron N, Van den Eynde B in Database of T cell-defined human tumor antigens: the 2013 update. Cancer Immun 2013 13:15 and www.cancerimmunity.org/peptide. Thus, in various embodiments, the oncolytic rhabdovirus (e.g. VSVdelta51 or Maraba MG1) of the combination encodes a protein comprising an amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 4, SEQ ID NO: 7, SEQ ID NO: 10, SEQ ID NO: 13 or a variant at least 95% identical thereto. In related embodiments, the oncolytic rhabdovirus of the combination includes a reverse complement and RNA version of a transgene comprising a nucleotide sequence of SEQ ID NO: 2, 3, 5, 6, 8, 9, 11, 12, or 14.
[0066] In particularly preferred embodiments, the oncolytic rhadovirus expresses MAGEA3, Human Papilloma Virus E6/E7 fusion protein, human Six-Transmembrane Epithelial Antigen of the Prostate protein, or Cancer Testis Antigen 1. Oncolytic rhabdovirus expressing each of these tumor-associated antigens has been demonstrated to increase survival in relevant animal cancer models in a prime-boost strategy (WIPO publication no. WO 2014/127478). Prime-boost as used herein means administering (preferably intravascularly) to a mammal with cancer an (replicative) oncolytic rhabodvirus expressing a natural tumor-associated antigen associated with that cancer and to which the mammal has a pre-existing immunity to boost a pre-existing immunity, wherein the pre-existing immunity in the mammal is preferably established by a priming administration of the tumor-associated antigen to the mammal prior to administering the oncolytic rhabdovirus. Preferably, the mammal has a cancer in which expression of the tumor-associated antigen has been detected/identified.
[0067] The priming step may be accomplished by administering (using any suitable administration route including but limited to intravenous, intramuscular or intranasal administration) the tumor-associated antigen per se or, preferably, by administering the tumor-associated antigen via a vector such as an adenoviral, poxviral (e.g. vaccinia virus), retroviral (e.g. lentivirus) or alpha virus (e.g. semliki forest) vector, or a plasmid or loaded antigen-presenting cell such as a dendritic cell. The vector used to administer the priming administration with tumor-associated antigen is immunologically distinct from (i.e. is heterologous to) the oncolytic virus expressing tumor-associated antigen administered to boost immunity in the mammal (e.g. in the case where the oncolytic virus expressing tumor-associated antigen is an oncolytic rhabdovirus, the priming vector is either not a rhabdovirus or is an immunologically distinct rhabdovirus). Generally, the vector is modified to express the antigen using well-established recombinant technology and is administered in an amount effective to generate an immune response in the mammal. By way of example, intramuscular administration of at least about 10.sup.7 pfu of adenoviral vector expressing a tumor-associated antigen to a mouse is sufficient to generate an immune response. For treatment of humans, for example, about 10.sup.8-10.sup.12, 10.sup.9-10.sub.11 or 10.sup.10 pfu of adenovral vector expressing a tumor-associated antigen may be administered to generate a priming immune response.
[0068] Once an immune response has been generated in the mammal by a priming administration of the tumor-associated antigen (e.g. via adenovirus vector), the oncolytic rhabdovirus expressing the same tumor-associated antigen in an amount effective for oncolytic viral therapy is administered at least once within a suitable immune response interval which may be for example, at least about 24 hours, preferably at least about 2-4 days or longer, e.g. within about one week, within about two weeks, within about three weeks or within about four weeks.
[0069] In some embodiments, a first boosting administration of oncolytic rhabdovirus expressing a tumor-associated antigen occurs about two weeks after a single priming administration of the same tumor-associated antigen (e.g. via adenovirus vector) which may be followed by a second boosting administration about 15-20 days, about 16-19 days or about 17 days after the single priming administration. In related embodiments, a first dose of the checkpoint inhibitor is administered after a single priming administration and prior to a first boosting administration of the oncolytic rhabdovirus expressing the same tumor-associated antigen and preferably includes a treatment phase wherein administration of the checkpoint inhibitor and administration of the oncolytic rhabdovirus expressing the same tumor-assocaited antigen overlap. In other embodiments, a second dose of the checkpoint inhibitor is administered after a first, second (and optionally third, fourth, fifth and so on) boosting administration. In related embodiments, the checkpoint inhibitor is administered weekly, every other week or every three weeks.
[0070] The MAGE family of genes encoding tumor specific antigens is discussed in De Plaen et al., Immunogenetics 40:360-369 (1994). MAGEA3 is expressed in a wide variety of tumours including melanoma, non-small cell lung cancer, head and neck cancer, colorectal cancer and bladder cancer. Tumor associated antigenic epitopes have been already identified for MAGEA3. Accordingly, a variant of the MAGEA3 protein may be, for example, an antigenic protein that includes at least one tumor associated antigenic epitope selected from the group consisting of: EVDPIGHLY (SEQ ID NO: 1), FLWGPRALV (SEQ ID NO: 2), KVAELVHFL (SEQ ID NO: 3), TFPDLESEF (SEQ ID NO:4), VAELVHFLL (SEQ ID NO: 5), MEVDPIGHLY (SEQ ID NO: 6), EVDPIGHLY (SEQ ID NO: 7), REPVTKAEML (SEQ ID NO: 8), AELVHFLLL (SEQ ID NO: 9), MEVDPIGHLY (SEQ ID NO: 10), WQYFFPVIF (SEQ ID NO: 11), EGDCAPEEK (SEQ ID NO: 12), KKLLTQHFVQENYLEY (SEQ ID NO: 13), RKVAELVHFLLLKYR (SEQ ID NO: 14), KKLLTQHFVQENYLEY (SEQ ID NO: 15), ACYEFLWGPRALVETS (SEQ ID NO: 16), RKVAELVHFLLLKYR (SEQ ID NO: 17), VIFSKASSSLQL (SEQ ID NO: 18),
[0071] VIFSKASSSLQL (SEQ ID NO: 19), VFGIELMEVDPIGHL (SEQ ID NO: 20), GDNQIMPKAGLLIIV (SEQ ID NO: 21), TSYVKVLHHMVKISG (SEQ ID NO: 22), RKVAELVHFLLLKYRA (SEQ ID NO: 23), and FLLLKYRAREPVTKAE (SEQ ID NO: 24); and that is at least 70%, 80%, 90%, or 95% identical to the MAGEA3 protein. It may be desirable for variants of a tumor associated antigenic protein to include only antigenic epitopes that have high allelic frequencies, such as frequencies greater than 40% of the population. Accordingly, preferred examples of variants of MAGEA3 may include proteins that include at least one antigenic epitope selected from the group consisting of: FLWGPRALV (SEQ ID NO: 25), KVAELVHFL (SEQ ID NO: 26), EGDCAPEEK (SEQ ID NO: 27), KKLLTQHFVQENYLEY (SEQ ID NO: 28), RKVAELVHFLLLKYR (SEQ ID NO: 29), and KKLLTQHFVQENYLEY (SEQ ID NO: 30); and that is at least 70%, 80%, 90% or 95% identical to the MAGE A3 protein.
[0072] Human Papilloma Virus (HPV) oncoproteins E6/E7 are constitutively expressed in cervical cancer (Zur Hausen, H (1996) Biochem Biophys Acta 1288:F55-F78). Furthermore, HPV types 16 and 18 are the cause of 75% of cervical cancer (Walboomers JM (1999) J Pathol 189: 12-19). An oncolytic rhabdovirus expressing a fusion protein of the E6/E7 oncoproteins of HPV types 16 and 18, which was mutated to remove oncogenic potential, has been shown to increase the number and percentage of antigen-specific CD8+ T cells in a heterologous prime:boost setting.
[0073] Six-Transmembrane Epithelial Antigen of the Prostate (huSTEAP) is a recently identified protein shown to be overexpressed in prostate cancer and up-regulated in multiple cancer cell lines, including pancreas, colon, breast, testicular, cervical, bladder, ovarian, acute lyphocytic leukemia and Ewing sarcoma (Hubert R S et al., (1999) Proc Natl Acad Sci 96: 14523-14528). The STEAP gene encodes a protein with six potential membrane-spanning regions flanked by hydrophilic amino- and carboxyl-terminal domains. An oncolytic rhabdovirus expressing huSTEAP has been shown to increase the number and percentage of antigen-specific CD8+ T cells in a heterologous prime:boost setting.
[0074] Cancer Testis Antigen 1 (NYES01) is a cancer/testis antigen expressed in normal adult tissues, such as testis and ovary, and in various cancers (Nicholaou T et al., (2006) Immunol Cell Biol 84:303-317). Cancer testis antigens are a unique family of antigens, which have restricted expression to testicular germ cells in a normal adult but are aberrantly expressed on a variety of solid tumours, including soft tissue sarcomas, melanoma and epithelial cancers. An oncolytic rhabdovirus expressing NYES01 has been shown to increase the number and percentage of antigen-specific CD8+ T cells in a heterologous prime:boost setting.
[0075] In other embodiments, an oncolytic rhabdovirus expressing a tumor-associated antigen is co-administered with a checkpoint inhibitor to a mammal with cancer, wherein the mammal has a naturally existing immunity to the tumor-associated antigen.
[0076] Thus, in several embodiments, a method for treating and/or preventing cancer in a mammal is provided comprising co-administering to a mammal with cancer (i) an oncolytic rhabdovirus expressing a natural tumor associated antigen naturally associated with the cancer and to which the mammal has a pre-existing immunity and (ii) a checkpoint inhibitor, whereby the pre-existing immunity in the mammal is preferably established by administering the tumor antigen to the mammal prior to administering the oncolytic rhabdovirus. In preferred embodiments, the oncolytic rhabdovirus is intravascularly administered to the mammal. In other preferred embodiments, the pre-existing immunity in the mammal is established by administering a viral vector (e.g. adenovirus) expressing the tumor-associated antigen to the mammal prior to administering the oncolytic rhabdovirus.
[0077] Routes of administration of the oncolytic virus of the combination will vary, naturally, with the location and nature of the lesion, and include, e.g., intradermal, transdermal, parenteral, intravascular (intravenous or intra-arterial), intramuscular, intranasal, subcutaneous, regional, percutaneous, intratracheal, intraperitoneal, intravesical, intratumoral, inhalation, perfusion, lavage, direct injection, alimentary, and oral administration and formulation. In preferred embodiments, a pharmaceutical composition comprising the oncolytic virus (e.g. oncolytic rhabdovirus) of the combination and a pharmaceutically acceptable carrier is administered to a mammal with cancer by intratumoral injection and/or is administered intravascularly, although the pharmaceutical composition may alternatively be administered intratumorally, parenterally, intravenously, intrarterially, intradermally, intramuscularly, transdermally or even intraperitoneally as described in U.S. Pat. Nos. 5,543,158, 5,641,515 and 5,399,363 (each specifically incorporated herein by reference in its entirety). As used herein, carrier includes any and all solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like. The use of such media and agents for pharmaceutical active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active ingredient, its use in the therapeutic compositions is contemplated. Supplementary active ingredients can also be incorporated into the compositions.
[0078] In certain embodiments, the tumor being treated may not, at least initially, be resectable. Treatments with therapeutic viral constructs may increase the resectability of the tumor due to shrinkage at the margins or by elimination of certain particularly invasive portions. Following treatments, resection may be possible. Additional treatments subsequent to resection will serve to eliminate microscopic residual disease at the tumor site.
[0079] A typical course of treatment, for a primary tumor or a post-excision tumor bed, will involve multiple doses. Typical primary tumor treatment involves a 1, 2, 3, 4, 5, 6 or more dose application over a 1, 2, 3, 4, 5, 6-week period or more. A two-week regimen may be repeated one, two, three, four, five, six or more times. During a course of treatment, the need to complete the planned dosings may be re-evaluated.
[0080] The treatments may include various unit doses. Unit dose is defined as containing a predetermined quantity of the therapeutic composition. The quantity to be administered, and the particular route and formulation, are within the skill of those in the clinical arts. A unit dose need not be administered as a single injection but may comprise continuous infusion over a set period of time. Unit dose of the present invention may conveniently be described in terms of plaque forming units (pfu) or viral particles for viral constructs. Unit doses range from 10.sup.3, 10.sup.4, 10.sup.5, 10.sup.6, 10.sup.7, 10.sup.8, 10.sup.9, 10.sup.10, 10.sup.11, 10.sup.12, 10.sup.13 pfu or vp and higher. Alternatively, depending on the kind of virus and the titer attainable, one will deliver 1 to 100, 10 to 50, 100-1000, or up to about 1?10.sup.4, 1?10.sup.5, 1?10.sup.6, 1?10.sup.7, 1?10.sup.8, 1?10.sup.9, 1?10.sup.10, 1?10.sup.11, 1?10.sup.12, 1?10.sup.13, 1?10.sup.14, or 1?10.sup.15 or higher infectious viral particles (vp) to the patient or to the patient's cells.
[0081] The phrase pharmaceutically-acceptable or pharmacologically-acceptable refers to molecular entities and compositions that do not produce an allergic or similar untoward reaction when administered to a human. The preparation of an aqueous composition that contains a protein as an active ingredient is well understood in the art. Typically, such compositions are prepared as injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to injection can also be prepared.
[0082] Checkpoint Inhibitor
[0083] Immune checkpoints regulate T cell function in the immune system. T cells play a central role in cell-mediated immunity. Checkpoint proteins interact with specific ligands which send a signal into the T cell and switch off or inhibit T cell function. Cancer cells in turn exploit this by driving high level expression of checkpoint proteins on their surface resulting in control of the T cell expressing checkpoint proteins on the surface of T cells that enter the tumor microenvironment, thus suppressing the anti-cancer immune response.
[0084] An immune checkpoint inhibitor for use in the combination is any compound inhibiting the function of an immune checkpoint protein. Inhibition includes reduction of function and full blockade. In particular the immune checkpoint protein is a human immune checkpoint protein. Thus the immune checkpoint inhibitor preferably is an inhibitor of a human immune checkpoint protein. Immune checkpoint proteins are described in the art (see e.g. Pardoll, Nature Rev. Cancer 12(4): 252-264 (2012).
[0085] Checkpoint proteins include, without limitation CTLA4, PD-1 and its ligands PD-L1 and PD-L2, B7-H3, B7-H4, HVEM, TIM3, GAL9, LAG3, VISTA, KIR, TIGIT, and BTLA. The pathways involving LAG-3, BTLA, B7H3, B7H4, TIM3, and KIR are recognized in the art to constitute immune checkpoint pathways similar to the CTLA-4 and PD-1 dependent pathways (see e.g. Pardoll, 2012. Nature Rev Cancer 12:252-264; Mellman et al., 2011. Nature 480:480-489).
[0086] Preferred immune checkpoint protein inhibitors are antibodies, preferably human or humanized monoclonal antibodies, that specifically recognize immune checkpoint proteins. A number of CTLA-4, PD1, PDL-1, PD-L2, LAG-3, BTLA, B7H3, B7H4, TIM3, TIGIT and KIR inhibitors have been described.
[0087] CTLA-4 checkpoint inhibitors include, without limitation, ipilimumab (a fully human CTLA-4 blocking antibody presently marketed under the name Yervoy? (Bristol-Myers Squibb)), tremelimumab (referenced in Ribas et al., J. Clin. Oncol. 31:616-622 (2013)), antibodies disclosed in U.S. Patent Application Publication Nos. 2005/0201994, 2002/0039581, and 2002/086014, the contents of each of which are incorporated herein by reference, and antibodies disclosed in U.S. Pat. Nos. 5,811,097, 5,855,887, 6,051,227, 6,984,720, 6,682,736, 6,207,156, 5,977,318, 6,682,736, 7,109,003 and 7,132,281, the contents of each of which are incorporated herein by reference.
[0088] PD-1 inhibitors include without limitation humanized antibodies blocking human PD-1 such as lambrolizumab (e.g. disclosed as hPD109A and its humanized derivatives h409A11, h409A16 and h409A17 in U.S. Pat. No. 8,354,509, incorporated herein by reference; and in Hamid et al., N. Engl. J. Med. 369: 134-144 (2013)), pidilizumab (CT-011; disclosed in Rosenblatt et al., J Immunother. 34:409-418 (2011)), as well as fully human antibodies such as nivolumab (CAS Registry Number: 946414-94-4; previously known as MDX-1106 or BMS-936558, Topalian et al., N. Eng. J. Med. 366:2443-2454 (2012), disclosed in U.S. Pat. No. 8,008,449, incorporated herein by reference) or an antibodiy comprising the heavy and light chain variable regions of any of these antibodies. Pidilizumab is a fully human IgG4 monoclonal antibody that has shown efficacy for treatment of diffuse large B-cell lymphoma in human clinical trials. Nivolumab is a fully human IgG4 monoclonal antibody that has shown efficacy for treatment of advanced treatment-refractory malignancies (e.g. melanoma, renal cell carcinoma, and NSCLC). Other PD-1 inhibitors may include fusion proteins such as the PD-L2-Fc fusion protein also known as B7-DC-Ig or AMP-244 (disclosed in Mkrtichyan M, et al. J Immunol. 189:2338-47 2012). AMP224 is undergoing phase I testing as a monotherapy in treatment of subjects with advanced cancer.
[0089] In a preferred embodiment, the immune checkpoint inhibitor is nivolumab or an isolated anti-PD-1 antibody comprising a heavy chain variable region comprising the heavy chain variable region amino acid sequence of nivolumab and/or a light chain variable region comprising the light chain variable region amino acid sequence of nivolumab. The heavy chain sequence of nivolumab is:
TABLE-US-00001 (SEQIDNO:31) QVQLVESGGGVVQPGRSLRLDCKASGITFSNSGMHWVRQAPGKGLEWVAV IWYDGSKRYYADSVKGRFTISRDNSKNTLFLQMNSLRAEDTAVYYCATND DYWGQGTLVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPV TVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDH KPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTP EVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEE MTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLY SRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
The light chain sequence of nivolumab is:
TABLE-US-00002 (SEQIDNO:32) EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYD ASNRATGIPARFSGSGSGTDFTLTISSLEPEDFAVYYCQQSSNWPRTFGQ GTKVEMRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVD NALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGL SSPVTKSFNRGEC
[0090] In some preferred embodiments, the checkpoint inhibitor comprises a heavy chain and/or a light chain sequence at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 98%, at least 99% or 100% to the heavy chain and/or light chain sequence of nivolumab.
[0091] Immune checkpoint inhibitors also include, without limitation, humanized or fully human antibodies blocking PD-L1 such as pembrolizumab (CAS Registry Number 1374853-91-4; also known as MK-3475) (disclosed in WO2009/114335), MEDI-4736 (disclosed in U.S. Pat. No. 8,779,108, incorporated herein by reference) , MPDL33280A (disclosed in U.S. Pat. No. 8,217,149, the contents of which are incorporated herein by reference), MIH1 (Affymetrix obtainable via eBioscience (16.5983.82)), BMS-936559 and MSB0010718C (Avelumab) or an antibody comprising the heavy and light chain variable regions of any of these antibodies. BMS-936559 is a fully human IgG4 monoclonal antibody demonstrated to show efficacy in treatment of melanoma, NSCLC, renal cell carcinoma and ovarian cancer in human clinical trials (administered bi-weekly). Pembrolizumab is a humanized IgG4 monoclonal antibody with a stabilizing SER228PRO sequence alteration in the Fc region undergoing clinical trials for treatment of progressive, locally advanced or metastatic carcinoma, melanoma or NSCLC, which binds to PD-1 and prevents the interaction of PD-1 with its ligands PD-L1 and PD-L2. MPDL33280A is a monoclonal antibody undergoing testing in combination with the BRAF inhibitor vemurafenib in subjects with BRAF V600-mutant metastatic melanoma and in combination with bevacizumab which targets VEGFR in subjects with advanced solid tumors. MEDI-4736 is in phase I clinical testing in patients with advanced malignant melanoma, renal cell carcinoma, NSCLC and colorectal cancer.
[0092] In a particularly preferred embodiment, the immune checkpoint inhibitor is pembrolizumab or an isolated anti-PD-1 antibody comprising a heavy chain variable region comprising the heavy chain variable region amino acid sequence of pembrolizumab and/or a light chain variable region comprising the light chain variable region amino acid sequence of pembrolizumab. The heavy chain sequence of pembrolizumab is:
TABLE-US-00003 (SEQIDNO:33) QVQLVQSGVEVKKPGASVKVSCKASGYTFTNYYMYWVRQAPGQGLEWMGG INPSNGGTNFNEKFKNRVTLTTDSSTTTAYMELKSLQFDDTAVYYCARRD YRFDMGFDYWGQGTTVTVSSASTKGPSVFPLAPCSRSTSESTAALGCLVK DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKT YTCNVDHKPSNTKVDKRVESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDT LMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTY RVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYT LPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
The light chain sequence of pembrolizumab is:
TABLE-US-00004 (SEQIDNO:34) EIVLTQSPATLSLSPGERATLSCRASKGVSTSGYSYLHWYQQKPGQAPRL LIYLASYLESGVPARFSGSGSGTDFTLTISSLEPEDFAVYYCQHSRDLPL TFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKV QWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEV THQGLSSPVTKSFNRGE
[0093] In some preferred embodiments, the checkpoint inhibitor comprises a heavy chain and/or a light chain sequence at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 98%, at least 99% or 100% to the heavy chain and/or light chain sequence of pembrolizumab.
[0094] In preferred embodiments, an immune checkpoint inhibitor of the combination is selected from a CTLA-4, PD-1 or PD-L1 inhibitor, such as, without limitation, pembrolizumab, ipilimumab, tremelimumab, labrolizumab, nivolumab, pidilizumab, AMP-244, MEDI-4736, MPDL33280A, or MIH1. Known inhibitors of these immune checkpoint proteins may be used as such or analogues may be used, in particular chimerized, humanized or human forms of antibodies.
[0095] As the skilled person will know, alternative and/or equivalent names may be in use for certain antibodies mentioned above. Such alternative and/or equivalent names are interchangeable in the context of the present invention. For example it is known that lambrolizumab is also known under the alternative and equivalent names MK-3475 and pembrolizumab.
[0096] Other immune checkpoint inhibitors of the combination include, without limitation, agents targeting immune checkpoint proteins and pathways involving PD-L2, LAG3, BTLA, B7H4, TIM3 and TIGIT. For example, human PD-L2 inhibitors known in the art include MIH18 (described in Pfistershammer et al., Eur J Immunol. 36:1104-1113 (2006)). LAG3 inhibitors known in the art include soluble LAG3 (IMP321, or LAG3-Ig disclosed in U.S. Patent Application Publication No. 2011-0008331, incorporated herein by reference, and in Brignon et al., Clin. Cancer Res. 15:6225-6231 (2009)) as well as mouse or humanized antibodies blocking human LAG3 (for instance IMP701 and others described U.S. Patent Application Publication No. 2010-0233183, incorporated herein by reference), or fully human antibodies blocking human LAG3 (such as BMS-986016 and the antibodies disclosed in U.S. Patent Application Publication No. 2011-0150892, incorporated herein by reference).
[0097] BTLA inhibitors of the combination, include without limitation antibodies blocking human BTLA interaction with its ligand (such as 4C7 disclosed in U.S. Pat. No. 8,563,694, incorporated herein by reference).
[0098] B7H4 checkpoint inhibitors include, without limitation, antibodies to human B7H4 (disclosed in WO 2013025779 Al, and in U.S. Patent Application Publication No. 2014/0294861, incorporated herein by reference) or soluble recombinant forms of B7H4 (such as disclosed in U.S. Patent Application Publication No. 2012/0177645, incorporated herein by reference, or Anti-human B7H4 clone H74: eBiocience #14-5948).
[0099] B7-H3 checkpoint inhibitors, include, without limitation, antibodies neutralizing human B7-H3 (e.g. MGA271 disclosed as BRCA84D and derivatives in U.S. Patent Application Publication No. 2012/0294796, incorporated herein by reference).
[0100] TIM3 checkpoint inhibitors include, without limitation, antibodies targeting human TIM3 (e.g. as disclosed in U.S. Pat. No. 8,841,418, incorporated herein by reference, or the anti-human TIM3, blocking antibody F38-2E2 disclosed by Jones et al., J Exp Med., 205(12):2763-79 (2008)). KIR checkpoint inhibitors include, without limitation, Lirilumab (described in Romagne et al., Blood, 114(13):2667-2677 (2009)) Known inhibitors of immune checkpoint proteins may be used in their known form or analogues may be used, in particular chimerized forms of antibodies, most preferably humanized forms. TIGIT checkpoint inhibitors preferably inhibit interaction of TIGIT with polovirus receptor (CD155) and include, without limitation, antibodies targeting human TIGIT, such as those disclosed in U.S. Pat. No. 9,499,596 and U.S. Patent Application Publication Nos. 20160355589, 20160176963 and polovirus variants such as those disclosed in U.S. Pat. No. 9,327,014.
[0101] In some aspects, the combination described herein includes (i) more than one immune checkpoint inhibitor and (ii) an oncolytic virus within the various aspects of the invention. Preferably, the more than one immune checkpoint inhibitor is selected from a CTLA-4, a PD-1 or a PD-L1 inhibitor. For example concurrent therapy of ipilimumab (anti-CTLA4) with Nivolumab (anti-PD1) has demonstrated clinical activity that appears to be distinct from that obtained in monotherapy (Wolchok et al., N. Eng. J. Med., 369:122-33 (2013)). Other examples include a LAG3 checkpoint inhibitor and an anti-PD-1 checkpoint inhibitor (Woo et al., Cancer Res. 72:917-27 (2012)) or a LAG3 checkpoint inhibitor and a PD-L1 checkpoint inhibitor (Butler et al., Nat. Immunol., 13:188-195 (2011)).
[0102] In other aspects, the combination described herein includes (i) one or more checkpoint inhibitors and one or more additional therapeutic agents that have been shown to improve the efficacy of the one or more checkpoint inhibitors and (ii) an oncolytic virus. For example, Lirilumab (also known as anti-KIR, BMS-986015 or IPH2102, as disclosed in U.S. Pat. No. 8119775 in combination with ipilimumab (clinicaltrials.gov NCT01750580) or in combination with nivolumab (clinicaltrials.gov NCT01714739). Another example is an agent targeting ICOS and a CTLA-4 checkpoint inhibitor (Fu et al., Cancer Res., 71:5445-54 (2011), or an agent targeting 4-1BB (e.g. urelumab) and a CTLA-4 checkpoint inhibitor (Curran et al., PloS 6(4):9499 (2011)). Other examples include PD-1/PD-L1 checkpoint inhibitors and pazopanib, sunitinib, dasatinib, INCR024360, PegIFN-2b, Tarceva, Cobimetinib, and/or Trametinib, Debrafinib. In some preferred embodiments, the combination comprises an oncolytic rhabdovirus and (i) Nivolumab+Pazopanib/Sunitinib/Ipilumamb, (ii) Nivolumab+Dasatinib, (iii) Pembrolizumab+INCR024360 (iv) Pembrolizumab+pazopanib (v) Pembrolizumab+PegIFN-2b (vi) MED14736+Dabrafenib/Trametinib (vii) MPDL3280A+Tarceva or (viii) MPDL3280A+Cobimetinib.
[0103] The checkpoint inhibitor as disclosed herein can be administered by various routes including, for example, orally or parenterally, such as intravenously, intramuscularly, subcutaneously, intraorbitally, intracapsularly, intraperitoneally, intrarectally, intracisternally, intratumorally, intravasally, intradermally or by passive or facilitated absorption through the skin using, for example, a skin patch or transdermal iontophoresis, respectively. The checkpoint inhibitor also can be administered to the site of a pathologic condition, for example, intravenously or intra-arterially into a blood vessel supplying a tumor.
[0104] The total amount of an agent to be administered in practicing a method of the invention can be administered to a subject as a single dose, either as a bolus or by infusion over a relatively short period of time, or can be administered using a fractionated treatment protocol, in which multiple doses are administered over a prolonged period of time. One skilled in the art would know that the amount of the composition to treat a pathologic condition in a subject depends on many factors including the age and general health of the subject as well as the route of administration and the number of treatments to be administered. In view of these factors, the skilled artisan would adjust the particular dose as necessary. In general, the formulation of the composition and the routes and frequency of administration are determined, initially, using Phase I and Phase II clinical trials.
[0105] In certain embodiments, the checkpoint inhibitor is administered in 0.01-0.05 mg/kg, 0.05-0.1 mg/kg, 0.1-0.2 mg/kg, 0.2-0.3 mg/kg, 0.3-0.5 mg/kg, 0.5-0.7 mg/kg, 0.7-1 mg/kg, 1-2 mg/kg, 2-3 mg/kg, 3-4 mg/kg, 4-5 mg/kg, 5-6 mg/kg, 6-7 mg/kg, 7-8 mg/kg, 8-9 mg/kg, 9-10 mg/kg, at least 10 mg/kg, or any combination thereof doses. In certain embodiments the checkpoint inhibitor is administered at least once a week, at least twice a week, at least three times a week, at least once every two weeks, at least once every three weeks, or at least once every month or multiple months. In related embodiments, the checkpoint inhibitor is administered once per week, once every other week, once every three weeks or once every month. In certain embodiments, the checkpoint inhibitor is administered as a single dose, in two doses, in three doses, in four doses, in five doses, or in 6 or more doses. In a preferred embodiment, the checkpoint inhibitor is pembrolizumab and is administered at a schedule of 2 mg/kg (preferably as an intravenous infusion over 30 minutes) once every 3 weeks.
EXAMPLES
[0106] The following examples are given for the purpose of illustrating various embodiments of the invention and are not meant to limit the present invention in any fashion. One skilled in the art will appreciate readily that the present invention is well adapted to carry out the objects and obtain the ends and advantages mentioned, as well as those objects, ends and advantages inherent herein. The present examples, along with the methods described herein are presently representative of preferred embodiments, are exemplary, and are not intended as limitations on the scope of the invention. Changes therein and other uses which are encompassed within the spirit of the invention as defined by the scope of the claims will occur to those skilled in the art.
Example 1
Oncolytic Rhabdovirus+Checkpoint Inhibitor
[0107] The effects of co-administering a checkpoint inhibitor and an oncolytic rhabdovirus were assessed in a clinically relevant immunocompetent syngeneic tumor model.
Materials and Methods
[0108] BALB/c mice were engrafted with 5?10.sup.5 CT26 (colon carcinoma) cells subcutaneously. Tumors were allowed to grow until they reached approximately 250 mm.sup.3. Mice were randomized to one of 4 groups (Table 1) ensuring equal mean tumour and variances:
TABLE-US-00005 TABLE 1 Group Treatment Number 1 Control 5 2 MG1/GFP 5 3 MG1/GFP + 9 CTLA4 4 CTLA4 5
MG1/GFP, a genetically modified Maraba strain rhabdovirus containing a G protein mutation
[0109] (Q242R) and an M protein mutation (L123W) and expressing the heterologous protein GFP (green fluorescent protein) was administered at a dose of 2?10.sup.8 plaque forming units (PFUs) intravenously on days 1 and 3 and 5?10.sup.8 PFU intravenously on day 5. Mouse-derived anti-CTLA4 monoclonal antibody (Clone 9D9; BioXCell Cat. No. BE0164) was administered by intraperitoneal injection at a dose of 100 ?g every three days. The co-administration regimen is depicted at
[0110] Immune analyses were performed on Day 10 following the first dose of MG1/GFP. Immune analyses were completed on peripheral blood mononuclear cells (PBMCs) by ex vivo peptide re-stimulation and were stained for a panel of cytokines to assess the quantity of CT26 AH1-specific T cells as well as determining poly-functionality. Polyfunctionality was assessed by quantifying IFN-? single positive and IFN-?/TNF-? double positive. Antibodies for flow cytometry were from BD Biosciences: IFN?-APC Cat #554413; TNF?-FITC Cat #554418; CD107a-PE Cat #558661 or from eBiosciences: CD8-Alexa700 Cat #56-0081-82; CD4-PerCp-Cy5.5 Cat #45-0042-82. Peptides for restimulation were from Biomer Technology: CT26 AH1-SPSYVYHQF; VSV/MG1 N-MPYLIDFGL. Briefly, CT26-specific T cell responses were measured on Day 10. Peripheral blood mononucleated cells were incubated in complete RPMI with CT26 AH1 peptide for CT26-specific CD8+ T-cell (re-)stimulation. Incubation was performed in incubator (37 C., 5% CO.sub.2, 95% humidity) for 5 hours and 40 minutes, with brefeldin A (1 ?g/ml) during the last 4 hours. Cells were treated with antibodies targeting CD16/CD32 before staining with fluorescent-labeled antibodies targeting T-cell surface markers. Then, cells were permeabilized and fixed and stained for intracellular cytokines. Data were acquired using a FACSCanto flow cytometer.
Results
[0111] Anti-Tumor responses. Co-administration of anti-CTLA4 antibody with MG1/GFP led to an increased anti-CT26 immune response.
[0112] Tumor Size. Tumors in control animals (Control,
[0113] Survival Analysis. Survival of animals from each treatment Group was analyzed. The data are presented in
[0114] Combination treatment with a checkpoint inhibitoranti-CTLA-4and an oncolytic rhabdovirusMG1/GFP, significantly delayed tumor growth compared to either treatment alone and a significant survival benefit was observed with the combination treatment compared to either agent alone.
Example 2
Checkpoint Inhibitor+Oncolytic Rhabdovirus Prime-Boost
[0115] The impact of co-administering a checkpoint inhibitoranti-PD-1 antibodyand a Maraba rhabodvirus expressing a tumor antigen (following a priming administration with the same tumor antigen, as described in Pol et al., Mol Ther 22(2):420-429 (2014), the entire contents of which are incorporated herein by reference) on the anti-tumor immune response was assessed in a clinically relevant syngeneic B16 lung metastasis model.
[0116] Material and Methods. C57BL/6 mice were engrafted with 2.5?10.sup.5 B 16F10 mouse melanoma cells intravenously and tumors were allowed to seed for 5 days. Mice were assigned to one of 4 groups (Table 2)
TABLE-US-00006 TABLE 2 Group Group name Drug Treatment (Days) Number 1 Control Control No treatment 5 2 Anti-PD-1 Anti-PD-1 D8, 10, 13, 15, 17, 20, 5 22, 24, 27, 29, 31 3 Prime/boost Ad-hDCT: Ad hDCT: D5 10 MG1 hDCT MG1 hDCT: D14, 17 4 Combination Ad-hDCT: Ad hDCT: D5 9 MG1 hDCT + MG1 hDCT: D14, 17 (evaluable) anti-PD-1 Anti-PD-1: D8, 10, 13, 15, 17, 20, 22, 24, 27, 29, 31, 34, 36, 38
Ad-hDCT, a replication-deficient adenovirus (E1/E3-deletion) based on human serotype 5 engineered to express the human dopachrome tautomerase (hDCT) transgene, was administered at a dose of 2?10.sup.8 pfu intramuscularly. MG1-hDCT, the MG1 Maraba virus engineered to express the hDCT transgene, was administered intravenously at a dose of 1?10.sup.9 pfu. Anti-PD-1 antibody (BioXCell Cat. No. BE0146) was administered by intraperitoneal injection at a dose of 250 ?g 3 days a week for 5 weeks. A graphical overview of the treatment schema is at
[0117] Immune analyses were performed on Day 14 (following prime) and Day 20 (anticipated peak boost) and Day 27. Immune analyses were completed on PBMCs by ex vivo peptide re-stimulation and were stained for a panel of cytokines to assess the quantity of DCT-specific T cells as well as determining poly-functionality. Polyfunctionality was assessed by quantifying IFN-? single positive, IFN-?/TNF-? double positive, and IFN-?/TNF-?/IL-2 triple positive cells. CD107a marker staining detects cytolytic activity of CD8+ T cells by measuring degranulation, a prerequisite for cytolysis. Antibodies for flow cytometry were from BD Biosciences: IFN-?-APC Cat #554413; TNF?-FITC Cat #554418; IL-2-BV421 Cat #562969; CD107a-PE Cat #558661 or from eBiosciences: CD8-Alexa700 Cat #56-0081-82; CD4-PerCp-CY5.5 Cat #45-0042-82. Peripheral blood mononucleated cells were incubated in complete RPMI with SVY peptide (corresponding to the immunodominant epitope of DCT (DCT.sub.180-188) that binds to H-2K.sup.b; 2 ?g/ml) for DCT-specific CD8+ T-cell (re-)stimulation. Incubation was performed in incubator (37 C., 5% CO.sub.2, 95% humidity) for 5 hours and 40 minutes, with brefeldin A (1 ?g/ml) during the last 4 hours. Cells were treated with antibodies targeting CD16/CD32 before staining with fluorescent-labeled antibodies targeting T-cell surface markers. Then, cells were permeabilized and fixed and stained for intracellular cytokines. Data were acquired using a FACSCanto flow cytometer
[0118] Survival was recorded for all mice. Mice were considered at endpoint if exhibiting severe respiratory distress.
[0119] Results. Intracellular cytokine staining (ICS) following 5 hours and 40 minutes of peptide stimulations of peripheral blood (staining with antibodies recognizing IFN-?, TNF-? and IL-2) at the peak prime timepoint (Day 14) revealed an increase in the percentage of CD8+ T cells staining for the following cytokine(s): IFN-? (single positive), IFN-?+TNF-? (double positive) and IFN-?+TNF-?+IL-2 (triple positive) for the combination treatment group versus either treatment alone. The results are illustrated at
[0120] ICS staining using the same conditions for peripheral blood collected at the peak boost time point (Day 20) demonstrated a statistically significant increase in CD8+ T cell frequency and number in blood in the combination treatment group (Prime:boost PD1) relative to single treatment groups (PD1 or Prime:Boost). See
[0121] ICS staining using the same conditions for peripheral blood collected at the later boost time point (Day 27 of the study) demonstrated an increase in the frequency of CD8+T cells in blood in the combination group when compared to the prime/boost group (
[0122] Analysis of subject survival was performed. The data is shown at
[0123] The effect of combination therapy with anti-PD-1 and MG1 Maraba rhabdovirus expressing hDCT following a priming administration of hDCT (prime-boost) on mouse weight was assessed compared to prime-boost alone. As can be seen from
[0124] The effect of combination therapy with anti-PD-1 and MG1 Maraba rhabdovirus expressing hDCT following a priming administration of hDCT (prime-boost) on Maraba virus titer was assessed compared to prime-boost alone. As can be seen from
[0125] Addition of a checkpoint inhibitoranti-PD-1modifies the ad-DCT prime, both in terms of tumor-specific CD8+ T cell frequency and quality in B16 tumor-bearing animals. Addition of anti-PD-1 also enhances the Maraba-DCT boost, as exemplified by tumor-specific CD8+ T cell counts (approximately twice as many Ag-specific T cells). Importantly, these beneficial effects of combination therapy were associated with a profound increase in survival when compared to prime/boost or anti-PD-1 treatment alone. No toxic side effects were observed for the combination therapy nor did combination therapy negatively affect delivery of the oncolytic virus.
Example 3
The Combination of MG1 and Immune Checkpoint Inhibitor is Greatly Improves Efficacy in a Triple Negative Breast Cancer Model
[0126] Background
[0127] Triple-negative breast cancer is an aggressive systemic disease for which limited treatments are available. Triple-negative breast cancers (TNBC) are negative for the expression of the estrogen receptor, progesterone receptor and human epidermal growth factor receptor-2 and thus are refractory to conventional endocrine treatments including Tamoxifen and Trastuzumab which are commonly used for hormone-sensitive breast cancers (Hudis, C. A. & Gianni, L. Triple-negative breast cancer: an unmet medical need. Oncologist 16 Suppl 1, 1-11 (2011)) and the disseminated nature of late-stage forms further complicates treatment. The lack of options for patients with chemotherapy-resistant forms is pushing forward the rapid development of alternative strategies.
[0128] Using the clinical trial candidate rhabdovirus Maraba MG1, the importance of this immune response for TNBC treatment is demonstrated. Development of a clinically relevant model is described in which animals are re-challenged with orthotopic tumors following surgical resection of treated primary tumors. To mimic the recurrence of the disease in a clinically relevant setting for TNBC, development of a murine model of forced relapse is described in which primary tumors are treated with MG1 prior to surgical resection and implantation of new tumors. The virus induces an efficient tumor-specific immune response and recruits immune cells to the tumor. Importantly, the treatment with MG1 causes the induction of PDL1 by tumor cells and active regulatory T cells were found in greater amounts in the tumors.
Methods
[0129] Cell lines and culture Vero kidney epithelial, 4T1 and EMT6 murine mammary carcinoma cell lines were purchased from the American Type Culture Collection (Manassas, VA). Cells were maintained in Dulbecco's Modified Eagle's Medium (DMEM) (Corning cellgro, Manassas, Va.) supplemented with 10% fetal bovine serum (FBS) (Sigma life science, St-Louis, Mo.) and cultured at 37? C. with 5% CO.sub.2.
[0130] Virus production and quantification The expansion and purification of MG1-GFP was previously described (Brun, J. et al. Identification of genetically modified Maraba virus as an oncolytic rhabdovirus. Mol. Ther. 18, 1440-9 (2010)). Briefly, Vero cells were infected at an MOI of 0.01 for 24 h prior to harvesting, filtration (0.22 ?m bottle top filter (Millipore, Mass., USA)) and centrifugation (90 minutes at 30100 g) of the culture supernatant. The pellet was resuspended in Dulbecco's phosphate buffered saline (DPBS) (Corning cellgro, Manassas, Va.) and stored at ?80? C. Viral titers were determined by plaque assay. Briefly, serially diluted samples were transferred to monolayers of Vero cells, incubated for 1 h and then overlaid with 0.5% agarose/DMEM supplemented with 10% FBS. Plaques were counted 24 h later. In some experiments the virus was irradiated by exposure to 120 mJ/cm.sup.2 for 2 minutes using a Spectrolinker XL-1000 UV crosslinker as described previously (Zhang, J. et al. Maraba MG1 virus enhances natural killer cell function via conventional dendritic cells to reduce postoperative metastatic disease. Mol. Ther. 22, 1320-32 (2014)).
[0131] Microarray Analysis Monolayers of 4T1 or EMT6 cells were treated at an MOI of 3 for 24 h with either MG1-GFP or irradiated MG1-GFP. Culture supernatants were collected for CBA and ELISA analysis and the RNA was extracted from the cells using the RNeasy RNA extraction kit (Qiagen). Duplicate total RNA samples were processed and analysed on a MoGene2.0-st Affymetrix chip. Raw files were analyzed using the Transcriptome Analysis Console v3.0 (Affymetrix) software. Normalized transcript expression values further processed with R. Heatmaps were produced using the R package pheatmap v1.0.8. GO Term Enrichment analysis was performed using the online EnrichR tool (PMID 27141961). Genes selected for enrichment analysis are the subset of genes upregulated by MG1 infection relative to non-infected cells by at least 4-fold.
[0132] Flow cytometry Analysis Splenocytes were processed as previously described (Roy, D. G. et al. Programmable insect cell carriers for systemic delivery of integrated cancer biotherapy. J. Control. Release 220, 210-221 (2015)). Briefly, spleens were harvested and mashed through a 70 ?m strainer (Fisher Scientific, Waltham, Mass.) prior to lysis of red blood cells using ACK lysis buffer and resuspension in FACS buffer (PBS, 3% FBS). For tumor cell extraction, we used the mouse tumor cocktail (Miltenyi) according the manufacturer's protocol with gentleMACS tubes and a gentleMACS Dissociator (Miltenyi). Cells were stained using various combinations of CD45, CD3, CD4, FoxP3 and PDL1 (all from BD Bioscience) and fixed using IC fixation buffer (eBioscience). For intranuclear staining, the FoxP3 staining buffer set was used (eBioscience). Flow cytometry analysis was performed on a Cyan ADP 9 (Beckman Coulter, Mississauga, ON).
[0133] In vivo experiments and tumor models 4T1 tumors were implanted into Balb/c mice (Charles River Laboratories). For the orthotopic models, 1?10.sup.5 cells were injected into the second right mammary fat pad. For treatments, the virus 1?10.sup.8 (plaque forming unitspfu) in a total volume of 100 uL of PBS was injected intratumorally (IT) or intravenously (IV) at the indicated time points using insulin syringes (The Stevens Co, Montreal, QC). The immune checkpoint inhibitors (anti-PD1 (clone RMPI-14, BioXcell) and anti-CTLA4 (clone 9D9, BioXcell)) were injected intraperitoneally (IP) at a dose of 100 ?g each every second day for a total of 5 injections. For the tumor rechallenge model, 1?10.sup.5 cells were injected subcutaneously to the left flank of the animals. The tumors were treated at the indicated time points and resected 7 days after the first treatment. Four days after surgery, a higher dose of tumor cells (3?10.sup.5 cells) was seeded into the second right fat pad. The subset of mice that were rechallenged a second time more than 100 days post-tumor seeding were injected with 3?10.sup.5 EMT6 and 4T1 cells intra fat-pad bi-laterally.
Results
[0134] Pro-inflammatory signals are required to activate immune cells, but often also trigger the expression of the immune checkpoint inhibitor (ICI) PDL1 (Ritprajak, P. & Azuma, M. Intrinsic and extrinsic control of expression of the immunoregulatory molecule PD-L1 in epithelial cells and squamous cell carcinoma. Oral Oncol. 51, 221-228 (2015)). In order to shed light into the mechanisms by which the virus induces anti-tumor immunity, we performed a microarray analysis of 4T1 and EMT6 tumor cells infected in vitro with virus or irrMG1. Surprisingly, our results demonstrate that irrMG1 weakly induces only a few genes, which is in sharp contrast with MG1 which upregulates numerous genes at levels up to 300-fold higher then uninfected cells. Microarray analysis also showed the upregulation of PDL1 by both 4T1 and EMT6 cells with
[0135] MG1 treatment respectively (
[0136] Additionally, virus-cleared 4T1 conditioned media induced the surface expression of PDL1 as determined by flow cytometry (
[0137] While cytokines and chemokines are induced by virus treatment, the immune checkpoint inhibitor (ICI) molecule PDL1 is also upregulated by tumor cells following MG1 infection.
[0138] Given that virus treatment induces an anti-tumor immune response, cancers that would otherwise be refractory to ICI therapy could now be rendered sensitive. Given the recent success of ICI therapy, we investigated if the combination with this second treatment could further improve outcomes. Data demonstrates that the combination of MG1 with ICIs effectively cured most of the animals. The combination of both treatments increased survival to 60% in the aggressive 4T1 TNBC murine model.
Example 4
PDL Expression Levels in Tumor Biopsies Form Patients Pre- and Post-Treatment with an Oncolytic Virus Vaccine
Background
[0139] MG1MA3 is an RNA oncolytic virus (Maraba Rhabdovirus MG1) expressing human MAGE-A3 (transgenic MAGE-A3 insertion) that has the potential to selectively kill cancer cells through at least two major mechanisms. These include selective viral replication in cancer cells through a defective interferon response relative to normal cells. In addition to the replication of this virus in cancer cells the virus has also been engineered to express MAGE-A3 tumor associated antigens. Thus the host will generate a T cell immune response to this tumor antigen at the same time that the host immune system responds to the foreign viral protein. This immune response is considerably amplified if another virus (AdMA3; replication-defective, E1- and E3-deleted adenovirus serotype 5 with a transgene encoding human MAGE-A3) is used to initiate or prime a specific immune response to the MAGE-A3 tumor antigen prior to delivery of MG1MA3. The oncolytic virus vaccine leads to increased efficacy of MG1MA3.
Oncolytic Virus Vaccine Clinical Trial
[0140] Inclusion Criteria A Phase I/II study of MG1 Maraba/MAGE-A3 (MG1MA3) with and Without Adenovirus Vaccine (AdMA3) was initiated in patients with incurable advanced/metastatic MAGE-A3-expressing solid tumors. In phase 1, enrolled patients have histologically confirmed, unresectable locally advanced/metastatic solid tumors with positive expression of MAGE-A3 (primary or metastatic lesion) and for which there is no known life prolonging standard therapy. In phase II, enrolled patients have histologically confirmed, unresectable locally advanced/metastatic solid tumors with positive expression of MAGE-A3 (primary or metastatic lesion) as follows: Non-small cell lung cancer (NSCLC) specifically adenocarcinoma and squamous cell carcinoma; Breast cancer that is ER/PR?HER2+; triple negative; ER and/or PR+ HER2; Esophageal/GEJ (gastro-esophageal junction) cancer.
[0141] Trial Design; Arm AMG1MA3 (virus) alonepatients receive a starting dose of MG1MA3 at a dose level of 1?10.sup.10 pfu administered IV on day 1 and day 4. MG1MA3 dose is escalated until a Dose Limiting Toxicity (DLT) is reached. Arm BAdMA3 (vaccine prime) alonepatients receive prime AdMA3 vaccine at a dose of 1?10.sup.10 pfu administered IM on day (14). No dose escalation is planned. Arm CAdMA3 plus MG1MA3 (prime+boost)patients receive prime AdMA3 vaccine administered as a single dose of 1?10.sup.10 pfu IM on day (14) followed by dose escalation of MG1MA3 boost, IV administered on day 1 and day 4 at a starting dose of 1 log below the recommended Maximum Tolerated Dose (MTD) as determined in Arm A of the study. MG1MA3 dose will be escalated until a DLT is reached in a majority of the patients receiving that dose. For arms A and C a minimum of 3 patients are entered at each dose level, until the MTD is reached. Core/excisional tumor biopsies will be taken pre-treatment and post-treatment and analyzed for changes in gene expression of key markers in the tumor microenvironment including PDL 1.
Methods
[0142] RNA was extracted from core patient biopsies using RNEasy Fibrous Tissue Mini Kit as per kit protocol (Qiagen, 74704). Briefly, tissue was disrupted in RLT buffer using Qiagen TissueRuptor homogenizer. RNA was then extracted using an automated QIAcube sample preparation as per protocol. Following extraction RNA was quantified on a 2100 Bioanalyzer (Agilent Technologies) and then up to 100 ?g was used for analysis using a custom Nanostring Elements CodeSet and nCounter 144-plex Elements TagSet. The resulting data was analyzed using nCounter analysis software (Nanostring Technologies).
Results
[0143] Clinical PDL1 expression data was generated by NanoString analysis of tumor biopsies pre-treatment and two days post-treatment after the first dose of MG1. NanoString analysis looks at PDL1 transcript levels, results were expressed as fold change in pre-treatment levels versus post-treatment levels and calculated by dividing post-treatment expression levels by pre-treatment expression levels and graphed 2 different ways.
Example 5
Oncolytic Virus Vaccine Plus Checkpoint Inhibitor Combination Treatment Clinical Trial
[0144] A phase I/II, multicenter, open-label clinical trial of MG1 Maraba/MAGE-A3 (MG1MA3) with adenovirus vaccine with trangenic MAGE-A3 insertion (AdMA3) (prime:boost regimne) in combination with Pembrolizumab in patients with previously treated metastatic non-small cell lung cancer (NSCLC) is described. MG1MA3 and Pembrolizumab will be administered as standard therapies.
[0145] Patients will have histological subtype squamous or non-squamous NSCLC tumors with positive expression of MAGE-A3 (primary or metastatic lesion) who have completed a first standard therapy with a platinum-based chemotherapy.
[0146] Patients will receive a single dose of prime AdMA3 vaccine at a dose of 1?10.sup.10 pfu administered intramuscularly (IM) on day (14) and will be administered MG1MA3 by IV infusion at a dose level of 1?10.sup.10 pfu on day 1 and day 4 (boost). If this dose is tolerated in combination with pembrolizumab, a second cohort will be treated with 1?10.sup.11 MG1MA3 on day 1 and 4. Patients will receive Prembrolizumab at a dose of 200 mg IV on day (13), day 8, and every 3 weeks thereafter until confirmed radiographic progression is observed. Tumor biopsies will be taken pre-treatment and post-treatment and analyzed for changes in gene expression of key markers in the tumor microenvironment including PDL1. The objective tumor response rate (ORR) based on RECIST v1.1 will be evaluated in phase 2.
TABLE-US-00007 APPENDIXA ProteinandNucleotideSequenes Proteinsequenceoffulllength,wildtype,human MAGEA3(SEQIDNO:35): MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTL GEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPD LESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSWGNWQYFFPVIF SKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGL LIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHYV QENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHMVKISGGPHISY PPLHEWVLREGEE* DNAsequenceencodingfulllength,wildtype, humanMAGEA3(SEQIDNO:36): ATGCCTCTTGAGCAGAGGAGTCAGCACTGCAAGCCTGAAGAAGGCCTTGA GGCCCGAGGAGAGGCCCTGGGCCTGGTGGGTGCGCAGGCTCCTGCTACTG AGGAGCAGGAGGCTGCCTCCTCCTCTTCTACTCTAGTTGAAGTCACCCTG GGGGAGGTGCCTGCTGCCGAGTCACCAGATCCTCCCCAGAGTCCTCAGGG AGCCTCCAGCCTCCCCACTACCATGAACTACCCTCTCTGGAGCCAATCCT ATGAGGACTCCAGCAACCAAGAAGAGGAGGGGCCAAGCACCTTCCCTGAC CTGGAGTCCGAGTTCCAAGCAGCACTCAGTAGGAAGGTGGCCGAGTTGGT TCATTTTCTGCTCCTCAAGTATCGAGCCAGGGAGCCGGTCACAAAGGCAG AAATGCTGGGGAGTGTCGTCGGAAATTGGCAGTATTTCTTTCCTGTGATC TTCAGCAAAGCTTCCAGTTCCTTGCAGCTGGTCTTTGGCATCGAGCTGAT GGAAGTGGACCCCATCGGCCACTTGTACATCTTTGCCACCTGCCTGGGCC TCTCCTACGATGGCCTGCTGGGTGACAATCAGATCATGCCCAAGGCAGGC CTCCTGATAATCGTCCTGGCCATAATCGCAAGAGAGGGCGACTGTGCCCC TGAGGAGAAAATCTGGGAGGAGCTGAGTGTGTTAGAGGTGTTTGAGGGGA GGGAAGACAGTATCTTGGGGGATCCCAAGAAGCTGCTCACCCAACATTTC GTGCAGGAAAACTACCTGGAGTACCGGCAGGTCCCCGGCAGTGATCCTGC ATGTTATGAATTCCTGTGGGGTCCAAGGGCCCTCGTTGAAACCAGCTATG TGAAAGTCCTGCACCATATGGTAAAGATCAGTGGAGGACCTCACATTTCC TACCCACCCCTGCATGAGTGGGTTTTGAGAGAGGGGGAAGAGTGA CodonoptimizedDNAsequenceencodingfulllength, wildtype,humanMAGEA3protein(SEQIDNO:37): ATGCCCCTGGAGCAGCGGTCTCAGCATTGCAAGCCAGAGGAGGGCCTCGA GGCGAGGGGCGAGGCCCTCGGCTTGGTGGGGGCGCAGGCTCCTGCAACCG AGGAGCAAGAGGCCGCATCCAGTTCCTCTACCCTGGTTGAGGTGACCTTG GGTGAGGTGCCCGCCGCGGAGAGCCCCGACCCGCCTCAAAGCCCCCAGGG TGCCAGCTCCCTGCCCACAACAATGAACTACCCACTCTGGAGTCAGTCTT ACGAGGACAGTAGTAACCAAGAGGAGGAGGGACCCTCCACATTCCCAGAC CTGGAGTCTGAATTCCAGGCAGCATTGTCTAGAAAAGTGGCCGAATTGGT GCACTTCCTGCTGCTGAAGTATCGCGCCCGCGAGCCAGTCACAAAAGCTG AAATGCTGGGTTCTGTCGTGGGAAATTGGCAGTACTTCTTCCCCGTGATC TTCAGTAAAGCGTCCAGCTCCTTGCAGCTGGTCTTTGGTATCGAGCTGAT GGAGGTGGATCCCATCGGCCATCTGTATATCTTTGCCACATGCCTGGGCC TGAGCTACGATGGCCTGCTGGGCGACAACCAGATCATGCCAAAAGCTGGC CTGCTGATCATCGTTCTGGCTATCATCGCTAGAGAAGGAGATTGCGCCCC TGAAGAAAAGATCTGGGAGGAACTGAGCGTCCTGGAAGTCTTTGAGGGTC GTGAAGACAGCATTCTCGGGGATCCCAAGAAGCTGCTGACCCAGCACTTC GTGCAGGAGAACTATCTGGAGTACCGCCAGGTTCCCGGCAGCGACCCCGC TTGCTACGAGTTCCTGTGGGGCCCCAGGGCCCTGGTCGAGACATCCTACG TGAAGGTCCTGCACCATATGGTTAAAATCAGCGGCGGCCCCCATATCTCT TATCCGCCGCTCCACGAGTGGGTGCTCCGGGAGGGAGAGGAG Proteinsequenceofavariantoffulllength,wild type,humanMAGEA3(SEQIDNO:38): MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTL GEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPD LESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSWGNWQYFFPVIF SKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGL LIIVLAIIAREGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQFIF VQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLBHMVKISGGPHIS YPPLBEWVLREGEEDYKDDDDK* DNAsequenceencodingavariantoffulllength, wildtype,humanMAGEA3(SEQIDNO:39): ATGCCCCTGGAACAGCGGAGCCAGCACTGCAAGCCCGAGGAAGGCCTGGA AGCCAGAGGCGAAGCCCTGGGACTGGTGGGAGCCCAGGCCCCTGCCACAG AAGAACAGGAAGCCGCCAGCAGCAGCTCCACCCTGGTGGAAGTGACCCTG GGCGAAGTGCCTGCCGCCGAGAGCCCTGATCCCCCTCAGTCTCCTCAGGG CGCCAGCAGCCTGCCCACCACCATGAACTACCCCCTGTGGTCCCAGAGCT ACGAGGACAGCAGCAACCAGGAAGAGGAAGGCCCCAGCACCTTCCCCGAC CTGGAAAGCGAGTTCCAGGCCGCCCTGAGCCGGAAGGTGGCAGAGCTGGT GCACTTCCTGCTGCTGAAGTACAGAGCCCGCGAGCCCGTGACCAAGGCCG AGATGCTGGGCAGCGTGGTGGGAAACTGGCAGTACTTCTTCCCCGTGATC TTCTCCAAGGCCAGCAGCTCCCTGCAGCTGGTGTTCGGCATCGAGCTGAT GGAAGTGGACCCCATCGGCCACCTGTACATCTTCGCCACCTGTCTGGGCC TGAGCTACGACGGCCTGCTGGGCGACAACCAGATCATGCCCAAGGCCGGC CTGCTGATCATCGTGCTGGCCATCATTGCCCGCGAGGGCGACTGCGCCCC TGAGGAAAAGATCTGGGAGGAACTGAGCGTGCTGGAAGTGTTCGAGGGCA GAGAGGACAGCATCCTGGGCGACCCCAAGAAGCTGCTGACCCAGCACTTC GTGCAGGAAAACTACCTGGAATACCGCCAGGTGCCCGGCAGCGACCCCGC CTGTTACGAGTTCCTGTGGGGCCCCAGGGCTCTGGTGGAAACCAGCTACG TGAAGGTGCTGCACCACATGGTGAAAATCAGCGGCGGACCCCACATCAGC TACCCCCCACTGCACGAGTGGGTGCTGAGAGAGGGCGAAGAGGACTACAA GGACGACGACGACAAATGA ProteinsequenceofHPVE6/E7fusionprotein(SEQ IDNO:40): MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVY DFAFRDLCIVYRDGNPYAVDKLKFYSKISEYRHYCYSVYGTTLEQQYNKP LCDLLIRINQKPLCPEEKQRFILDKKQRFFINIRGRWTGRCMSCCRSSRT RRETQLGGGGGAAYMARFEDPTRRPYKLPDLCTELNTSLQDIEITCVYCK TVLELTEVFEFAFKDLFWYRDSIPHAAFIKIDFYSRIRELRHYSDSVYGD TLEKLTNTGLYNLLIRLRQKPLNPAEKLRFILNEKRRFFINIAGHYRGQC HSCCNRARQERLQRRRETQVGGGGGAAYMEGDTPTLHEYMLDLQPETTDL YQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVD IRTLEDLLMGTLGIVPICSQKPGGGGGAAYMITGPKATLQDIVLHLEPQN EIPVDLLQLSDSEEENDEIDGVNHQHLPARRAEPQRHTMLCMCCKCEARI KLWESSADDLRAFQQLFLNTLSFVPWCASQQ* DNAsequenceofHPVE6/E7fusionprotein(SEQID NO:41): ATGCATCAGAAGCGAACTGCTATGTTTCAGGACCCTCAGGAGCGGCCACG CAAACTGCCTCAGCTGTGCACCGAACTGCAGACAACTATCCACGACATCA TTCTGGAATGCGTGTACTGTAAGCAGCAGCTGCTGAGGAGAGAGGTCTAT GACTTCGCTTTTCGCGATCTGTGCATCGTGTACCGAGACGGAAACCCATA TGCAGTCGATAAGCTGAAGTTCTACAGCAAGATCTCCGAATACAGGCATT ACTGTTACAGCGTGTACGGGACCACACTGGAGCAGCAGTATAACAAGCCC CTGTGCGACCTGCTGATCAGAATTAATCAGAAGCCCCTGTGCCCTGAGGA AAAACAGAGGCACCTGGATAAGAAACAGAGATTTCATAACATCCGAGGAC GATGGACCGGGCGGTGCATGTCCTGCTGTAGAAGCTCCCGGACTCGACGA GAGACCCAGCTGGGCGGAGGAGGAGGAGCAGCTTACATGGCACGATTCGA GGACCCTACCCGAAGGCCATATAAGCTGCCCGACCTGTGCACAGAACTGA ATACTTCTCTGCAGGACATCGAGATTACATGCGTGTACTGTAAAACCGTC CTGGAGCTGACAGAAGTGTTCGAGTTTGCTTTCAAGGACCTGTTTGTGGT CTACCGGGATTCAATCCCTCACGCAGCCCATAAAATCGACTTCTACAGCA GGATCAGGGAACTGCGCCACTACTCCGACAGCGTGTACGGGGATACACTG GAGAAGCTGACAAACACTGGCCTGTACAATCTGCTGATCCGACTGCGACA GAAGCCACTGAACCCAGCCGAAAAACTGAGACACCTGAACGAGAAGAGAC GGTTTCACAATATTGCAGGCCATTATAGGGGACAGTGCCATAGTTGCTGT AATCGAGCCAGGCAGGAAAGACTGCAGCGCCGAAGGGAGACTCAAGTCGG CGGAGGAGGAGGAGCTGCATACATGCACGGCGACACCCCCACACTGCATG AATATATGCTGGATCTGCAGCCTGAGACTACCGACCTGTACCAGCTGAAC GATTCTAGTGAGGAAGAGGACGAAATCGACGGACCAGCAGGACAGGCAGA GCCTGACCGGGCCCACTATAATATTGTGACATTCTGCTGTAAGTGCGATT CTACTCTGCGGCTGTGCGTGCAGAGTACTCATGTCGACATCCGCACCCTG GAGGATCTGCTGATGGGGACTCTGGGCATCGTCCCAATTTGTAGCCAGAA ACCAGGCGGCGGCGGCGGAGCAGCTTACATGCACGGACCCAAGGCTACCC TGCAGGACATCGTGCTGCATCTGGAACCTCAGAATGAGATTCCAGTCGAC CTGCTGCAGCTGAGTGATTCAGAAGAGGAAAACGACGAGATCGACGGCGT GAATCACCAGCATCTGCCTGCTAGACGGGCAGAGCCACAGCGACACACAA TGCTGTGCATGTGCTGTAAGTGTGAAGCCAGGATCAAGCTGGTGGTCGAG TCAAGCGCCGACGATCTGCGCGCCTTCCAGCAGCTGTTCCTGAATACTCT GTCATTTGTCCCTTGGTGTGCCTCCCAGCAGTGA ProteinsequenceofhuSTEAPprotein(SEQID NO:42): MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTA HADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLAT SHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLFINGTKYKK FPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQ VQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWRE FHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPI WLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQLKL* DNAsequenceofhuSTEAPprotein(SEQIDNO:43): ATGGAATCACGGAAGGACATCACTAATCAGGAGGAACTGTGGAAAATGAA GCCAAGAAGGAATCTGGAAGAGGACGACTATCTGCACAAGGACACCGGCG AAACAAGTATGCTGAAACGACCAGTGCTGCTGCACCTGCATCAGACTGCT CACGCAGACGAGTTTGATTGCCCCTCTGAACTGCAGCACACCCAGGAGCT GTTCCCACAGTGGCATCTGCCCATCAAGATTGCCGCTATCATTGCTTCAC TGACATTTCTGTACACTCTGCTGAGAGAAGTGATCCACCCCCTGGCCACC AGCCATCAGCAGTACTTCTATAAGATCCCTATCCTGGTCATCAACAAGGT CCTGCCAATGGTGAGCATCACACTGCTGGCCCTGGTCTACCTGCCTGGAG TGATCGCAGCCATTGTCCAGCTGCACAATGGGACAAAGTATAAGAAATTT CCACATTGGCTGGATAAGTGGATGCTGACTAGGAAACAGTTCGGACTGCT GTCCTTCTTTTTCGCCGTGCTGCACGCTATCTACAGCCTGTCCTATCCCA TGAGGAGGAGCTACCGGTATAAGCTGCTGAACTGGGCTTACCAGCAGGTG CAGCAGAACAAGGAGGACGCATGGATTGAACATGACGTGTGGCGCATGGA AATCTACGTGAGCCTGGGCATTGTCGGACTGGCCATCCTGGCTCTGCTGG CAGTGACCAGTATCCCTTCTGTCAGTGACTCACTGACATGGAGAGAGTTT CACTACATTCAGAGCAAGCTGGGGATCGTGTCCCTGCTGCTGGGCACCAT CCATGCACTGATTTTTGCCTGGAACAAGTGGATCGATATCAAGCAGTTCG TGTGGTATACTCCCCCTACCTTTATGATTGCCGTCTTCCTGCCCATCGTG GTCCTGATCTTCAAGTCCATCCTGTTCCTGCCTTGTCTGCGGAAGAAAAT CCTGAAAATTCGGCACGGATGGGAGGATGTCACCAAAATCAATAAGACTG AAATCTGTAGCCAGCTGAAGCTTTAA ProteinsequenceofNYESQ1MARprotein(SEQID NO:44): MQAEGRGTGGSTGDADGPGGPGIPDGPGGNAGGPGEAGATGGRGPRGAGA ARASGPGGGAPRGPHGGAASGLNGCCRCGARGPESRLLEFYLAMPFATPM EAELARRSLAQDAPPLPVPGVLLKEFTVSGNILTIRLTAADHRQLQLSIS SCLQQLSLLMWITQCFLPVFLAQPPSGQRR* DNAsequenceofNYES01MAR(SEQIDNO:45): ATGCAGGCCGAGGGCAGAGGCACAGGCGGATCTACAGGCGACGCCGATGG CCCTGGCGGCCCTGGAATTCCTGACGGACCTGGCGGCAATGCCGGCGGAC CCGGAGAAGCTGGCGCCACAGGCGGAAGAGGACCTAGAGGCGCTGGCGCC GCTAGAGCTTCTGGACCAGGCGGAGGCGCCCCTAGAGGACCTCATGGCGG AGCCGCCTCCGGCCTGAACGGCTGTTGCAGATGTGGAGCCAGAGGCCCCG AGAGCCGGCTGCTGGAATTCTACCTGGCCATGCCCTTCGCCACCCCCATG GAAGCCGAGCTGGCCAGACGGTCCCTGGCCCAGGATGCTCCTC