ANTI-PD-1 ANTIBODY AND USE THEREOF
20190023782 ยท 2019-01-24
Inventors
Cpc classification
A61P1/04
HUMAN NECESSITIES
A61P29/00
HUMAN NECESSITIES
A61P31/00
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
A61P1/14
HUMAN NECESSITIES
A61P9/10
HUMAN NECESSITIES
C07K2317/33
CHEMISTRY; METALLURGY
C07K2317/70
CHEMISTRY; METALLURGY
A61P1/16
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
C07K2317/24
CHEMISTRY; METALLURGY
A61P7/04
HUMAN NECESSITIES
A61P21/00
HUMAN NECESSITIES
C07K2317/76
CHEMISTRY; METALLURGY
A61P33/02
HUMAN NECESSITIES
A61P37/06
HUMAN NECESSITIES
International classification
Abstract
This invention provides antibodies or functional fragments thereof that bind to PD-1 with high affinity. The invention provides nucleic acid molecules encoding the antibodies or the fragments thereof according to the present invention, expression vectors and host cells for expressing the antibodies or the functional fragments thereof according to the present invention, as well as methods for producing the antibodies or the functional fragments thereof according to the present invention. The present invention also provides immunoconjugates and pharmaceutical compositions comprising the antibodies or the functional fragments thereof according to the present invention. The present invention additionally provides methods for treating a plurality of diseases (comprising cancers, infectious diseases and inflammatory diseases) by using the antibodies or the functional fragments thereof disclosed herein.
Claims
1. An antibody or a functional fragment thereof that can bind to the programmed cell death 1 (PD-1) protein and comprises a heavy-chain comprising a heavy-chain complementarity-determining region (CDR) having an amino acid sequence selected from the group consisting of SEQ ID NO: 1, 2, 3, 7, 8, 9, 13, 14 and 15, and/or a light-chain comprising a light-chain CDR having an amino acid sequence selected from the group consisting of SEQ ID NO: 4, 5, 6, 10, 11, 12, 16, 17 and 18.
2. The antibody or functional fragment thereof according to claim 1, wherein: the amino acid sequences of CDR1, CDR2 and CDR3 of said heavy chain CDR are selected from any of the following groups of amino acid sequences: TABLE-US-00007 HCDR1 HCDR2 HCDR3 A SEQ ID NO: 1 SEQ ID NO: 2 SEQ ID NO: 3 B SEQ ID NO: 7 SEQ ID NO: 8 SEQ ID NO: 9 C SEQ ID NO: 13 SEQ ID NO: 14 SEQ ID NO: 15 and/or the amino acid sequences of CDR1, CDR2 and CDR3 of said light-chain CDR are selected from any of the following groups of amino acid sequences: TABLE-US-00008 LCDR1 LCDR2 LCDR3 A SEQ ID NO: 4 SEQ ID NO: 5 SEQ ID NO: 6 B SEQ ID NO: 10 SEQ ID NO: 11 SEQ ID NO: 12 C SEQ ID NO: 16 SEQ ID NO: 17 SEQ ID NO: 18
3. The antibody or functional fragment thereof according to claim 1, whose amino acid sequences of CDR1, CDR2 and CDR3 of the heavy chain and CDR1, CDR2 and CDR3 of the light chain are selected from any of the following groups of amino acid sequences; TABLE-US-00009 HCDR1 HCDR2 HCDR3 LCDR1 LCDR2 LCDR3 A SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID NO: 1 NO: 2 NO: 3 NO: 4 NO: 5 NO: 6 B SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID NO: 7 NO: 8 NO: 9 NO: 10 NO: 11 NO: 12 C SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID SEQ ID NO: 13 NO: 14 NO: 15 NO: 16 NO: 17 NO: 18
4. The antibody or functional fragment thereof according to claim 1, which comprises a variable region of the heavy chain having an amino acid sequence selected from the group consisting of SEQ ID NO: 19, 21 and 23 or a variant having at least 95% sequence identity with SEQ ID NO: 19, 21 or 23, and/or a variable region of the light chain having an amino acid sequence selected from the group consisting of SEQ ID NO: 20, 22, 24, and a variant having at least 95% sequence identity with SEQ ID NO: 20, 22, or 24.
5. The antibody or functional fragment thereof according claim 4, wherein said variable region of the heavy chain is SEQ ID NO: 19 or a variant that has at least 95% sequence identity with SEQ ID NO: 19, and said variable region of the light chain is SEQ ID NO: 20 or a variant that has at least 95% sequence identity with SEQ ID NO: 20, or wherein said variable region of the heavy chain is SEQ ID NO: 21 or a variant that has at least 95% sequence identity with SEQ ID NO: 21 and said variable region of the light chain is SEQ ID NO: 22 or a variant that has at least 95% sequence identity with SEQ ID NO: 22, or wherein said variable region of the heavy chain is SEQ ID NO: 23 or a variant that has at least 95% sequence identity with SEQ ID NO: 23 and said variable region of the light chain is SEQ ID NO: 24 or a variant that has at least 95% sequence identity with SEQ ID NO: 24.
6. The antibody or functional fragment thereof according to claim 1, wherein the antibody or functional fragment thereof is a chimeric antibody, a humanized antibody or a fully human antibody.
7. The antibody or functional fragment thereof according to claim 1 comprising a variable region of the heavy chain having a sequence selected from the group consisting of SEQ ID NO: 33, 35, 36, and a variant that has at least 95% sequence identity with SEQ ID NO: 33, 35, or 36, and/or a variable region of the light chain having a sequence selected from the group consisting of SEQ ID NO: 34, 37, and a variant that has at least 95% sequence identity with SEQ ID NO: 33, 35, or 36.
8. The antibody or functional fragment thereof according to claim 1, wherein said variable region of the heavy chain is SEQ ID NO: 33 or a variant that has at least 95% sequence identity with SEQ ID NO: 33 and said variable region of the light chain is SEQ ID NO: 34 or a variant that has at least 95% sequence identity with SEQ ID NO: 34; or wherein said variable region of the heavy chain is SEQ ID NO: 35 or a variant that has at least 95% sequence identity with SEQ ID NO: 35 and said variable region of the light chain is SEQ ID NO: 34 or a variant that has at least 95% sequence identity with SEQ ID NO: 34 or wherein said variable region of the heavy chain is SEQ ID NO: 36 or a variant that has at least 95% sequence identity with SEQ ID NO: 36 and said variable region of the light chain is SEQ ID NO: 34 or a variant that has at least 95% sequence identity with SEQ ID NO: 34 or wherein said variable region of the heavy chain is SEQ ID NO: 35 or a variant that has at least 95% sequence identity with SEQ ID NO: 35 and said variable region of the light chain is SEQ ID NO: 37 or a variant that has at least 95% sequence identity with SEQ ID NO: 37.
9. A isolated nucleic acid molecule, which encodes said antibody or functional fragment thereof according to claim 1.
10. An expression vector, which comprises said nucleic acid molecule according to claim 9.
11. A host cell, which comprises said expression vector according to claim 10.
12. A method of producing an anti-PD-1 antibody or a functional fragment thereof comprising: culturing a host cell according to claim 11 under conditions that allow production of said antibody or functional fragment thereof, and recovering said antibody or functional fragment thereof so produced.
13. An immunoconjugate, comprising said antibody or functional fragment thereof according to claim 1 that is coupled with a therapeutic agent, wherein said therapeutic agent is a toxin, radioisotope, drug, or cytotoxic agent.
14. A pharmaceutical composition comprising the antibody or functional fragment thereof according to claim 1 and a pharmaceutical carrier.
15. A method used to prevent or treat diseases or conditions through removing, inhibiting or lowering the activity of PD-1, which comprises administration of effective treatment dose of the antibody or functional fragment thereof according to claim 1 or a pharmaceutical composition comprising the antibody or functional fragment thereof to a subject in need, where said diseases or conditions are selected from the group consisting of cancers, infectious diseases or inflammatory diseases, said cancers are preferably selected from melanoma, renal cancer, prostate cancer, breast cancer, colon cancer, lung cancer, bone cancer, pancreatic cancer, skin cancer, head or neck cancer, cutaneous or intraocular malignant melanoma, uterine cancer, ovarian cancer, rectal cancer, anal region cancer, stomach cancer, testicular cancer, uterine cancer, fallopian tube cancer, endometrial cancer, cervical cancer, vaginal cancer, vulva cancer, Hodgkin's disease, non-Hodgkin's lymphoma, esophagus cancer, small intestinal cancer, endocrine system cancer, thyroid cancer, parathyroid cancer, adrenal cancer, soft tissue sarcoma, urethra cancer, penile cancer, chronic or acute leukemia which includes acute myeloid leukemia, chronic myeloid leukemia, acute lymphoblastic leukemia, chronic lymphocytic leukemia, solid tumors during childhood, lymphocytic lymphoma, bladder cancer, kidney or ureter cancer, renal pelvis cancer, central nervous system vegetation, primary central nervous system lymphoma, tumor angiogenesis, spinal axis tumors, brain stem glioma, pituitary adenoma, Kaposi's sarcoma, epidermoid carcinoma, squamous cell cancer, T cell lymphoma, environmentally induced cancers which include those induced by asbestos and the combination of said cancers, said infectious diseases are preferably selected from HIV, influenza, herpes, giardiasis, malaria, leishmaniasis, pathogenic infections caused by the following viruses: hepatitis viruses (hepatitis A, B and C), herpes virus (such as VZV, HSV-1, HAV-6, HSV-II, and CMV, Epstein Barr virus), adenovirus, influenza virus, flaviviruses, echovirus, rhinovirus, coxsackie virus, coronavirus, respiratory syncytial virus, mumps virus, rotavirus, measles virus, rubella virus, parvovirus, vaccinia virus, HTLV virus, dengue virus, papilloma virus, molluscum virus, polio virus, rabies virus, JC virus and arboviral encephalitis virus, pathogenic infections by the following bacteria: chlamydia, rickettsia, mycobacteria, staphylococcus, streptococcus, pneumococcus, meningococcus and conococci, klebsiella, proteus, serratia, pseudomonas, legionella, diphtheria, salmonella, tuberculosis, cholera, tetanus, botulism, anthrax, plague, leptospirosis and Lyme disease bacteria, pathogenic infections by the following fungi: Candida (Candida albicans, Candida krusei, Candida glabrata, Candida tropicalis, etc.), Cryptococcus neoformans, aspergillus (fumigatus, aspergillus niger, etc.), genus of Mucor (mucor, absidia, rhizopus), Sporothrix schenckii, dermatitis yeast bud, Paracoccidiodes brasiliensis, Coccidioides immitis and Histoplasma capsulatum, pathogenic infections by the following parasites: Entamoeba histolytica, Colon balantidium, fernando's worms, amoeba spine, suction blow Giardia, cryptosporidium, Pneumocystis carinii, P. vivax, voles Babesia, Trypanosoma brucei, Cruz trypanosoma, Leishmania donovani, Toxoplasma gondii and Nippostrongylus brasiliensis, said inflammatory diseases are preferably selected from acute disseminated encephalomyelitis, Addison's disease, ankylosing spondylitis, antiphospholipid antibody syndrome, autoimmune hemolytic anemia, autoimmune hepatitis, arthritis, Behcet's disease, bullous blistering day sores, celiac disease, Chagas disease, Crohn's disease, dermatomyositis, type-1 diabetes, pulmonary hemorrhagenephritic syndrome, graft versus host disease, Graves' disease, GuillainBarre syndrome, Hashimoto's disease, hyperimmunoglobulin E syndrome, idiopathic thrombocytopenic purpura, lupus erythematosus, multiple sclerosis, myasthenia gravis, pemphigus, pernicious anemia, polymyositis, primary biliary cirrhosis, psoriasis disease, rheumatoid arthritis, Sjogren's syndrome, temporal arteritis, vasculitis and Wegener's granulomatosis.
Description
BRIEF DESCRIPTION OF THE SEVERAL VIEWS OF THE DRAWINGS
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
DETAILED DESCRIPTION OF THE INVENTION
[0041] Unless otherwise defined, all the technical terms used in this patent have the same meanings understandable by the ordinary technicians in the art. As for the definitions and terms in the art, the professionals can specifically refer to Current Protocols in Molecular Biology (Ausubel). The abbreviation of amino acid residues employs a form of the standard code of 3 letters and/or 1 letter used in the field for each of the 20 commonly-used L-amino acids.
[0042] The present invention provides an anti-PD-1 antibody and a functional fragment thereof, which can bind to the programmed cell death 1 (PD-1). The antibody and the functional fragment thereof according to the present invention has at least one of the following features: the ability to block the interaction between PD-1 and PD-L1 via high affinity, or bind to PD-1 with high specificity but not to other CD28 family members (such as ICOS, CTLA-4 and CD28), or activate tumor-specific T cells to kill the tumor cells and promote CD8+ to enter the tissue of solid tumor so as to increase greatly the levels of the immune effectors such as IFN?.
[0043] The present invention also provides a humanized anti-PD-1 antibody and a functional fragment thereof. Said humanized antibody is obtained by computer simulation design of the mouse-derived antibody produced by immunized mouse in combination with bacteriophage display technology. Its binding epitopes are also identified accordingly based on its binding characteristics with PD-1 proteins of various species. Except the advantageous characteristics of the anti-PD-1 antibody and the functional fragment thereof described above, said humanized anti-PD-1 antibody and the functional fragment thereof according to the present invention also binds to PD-1 proteins of human or Macaca fascicularis via high affinity, but does not interact with the mouse-derived PD-1 protein.
[0044] On the premise of not substantially influencing the activity of the antibody, those skilled in the art can replace, add and/or remove one or more (such as 1, 2, 3, 4, 5, 6, 7, 9 or 10 or more) amino acids of the sequence according to the present invention so as to produce a variant of the sequence of said antibody or the functional fragment thereof. They are all deemed to be included in the protection scope of the present invention. For example, the amino acid in the variable region can be replaced with that of similar property. The sequence of said variant according to the present invention can have an identity of at least 95%, 96%, 97%, 98% or 99% to its source sequence. Said sequence identity described in the present invention can be measured by sequence analysis software, for example, the computer program BLAST using default parameter, especially BLASTP or TBLASTN.
[0045] The antibody according to the present invention can be full length (for example, IgG1 or IgG4 antibody) or comprises only the part that binds an antigen (for example, Fab, F(ab)2 or scFv fragment), or an antibody that has been modified to affect its function. The present invention comprises the anti-PD-1 antibody comprising modified glycosylation pattern. In some applications, it is useful to conduct modification to remove the undesirable glycosylation sites or avoid the part of fucose on the oligosaccharide chain to, for example, enhance the antibody of antibody-dependent cellular cytotoxicity (ADCC) function. In some other applications, the modification of galactosylation can be conducted to change the complement-dependent cytotoxcity (CDC).
[0046] The terms used in this patentfunctional fragment refers to especially the antibody fragment such as Fv, scFv (sc refers to single strand), Fab, F(ab)2, Fab, scFv-Fc fragment or diabody, or any fragment whose half life should be possibly increased by means of chemical modification or incorporating into the liposome. Said chemical modification is, for example, adding polyalkylene glycol such as polyethylene glycol (pegylation, PEGylated) (referred to as a pegylated fragment such as Fv-PEG, scFv-PEG, Fab-PEG; F(ab)2-PEG or Fab-PEG) (PEG is polyalkylene glycol) and said fragment has EGFR binding activity. Preferably, said functional fragment comprises a partial sequence of the heavy or light variable chain of their source antibody. Said partial sequence maintains sufficient antigen-binding specificity and affinity, which are the same as those of its source antibody. As for PD-1, the affinity is preferably at least 1/100, and more preferably at least 1/10, of the affinity of its source antibody. Said functional fragment comprises at least 5 amino acids and preferably comprises 10, 15, 25, 50 and 100 continuous amino acids of its source antibody sequence.
[0047] Technicians skilled in the art can clone the DNA molecule encoding said anti-PD-1 antibody according to the present invention into a vector and then transform to host cell. In this way, the present invention can also provide a type of recombinant DNA vector, which comprises a DNA molecule encoding said anti-PD-1 antibody according to the present invention.
[0048] Preferably, said recombinant DNA vector is a type of expression vector. Technicians skilled in the art can clone the DNA molecule of said antibody into the expression vector and transform it into host cell to get antibody by means of induction expression. The expression vector according to the present invention comprises the encoding DNA sequence of the variable region of the heavy chain, the variable region of the light chain and/or constant region of the anti-PD-1 antibody. Nevertheless, two types of expression vectors can also be constructed separately: one comprising the variable region of the heavy chain and constant region and another comprising the variable region of the light chain and constant region. The two types of expression vectors are then introduced into the same mammal. In one preferred embodiment, said expression vector further comprises a promoter and a DNA sequence encoding the secreting signal peptide as well as at least one type of drug-resistant gene used to screen.
[0049] The host cells according to the present invention can be prokaryotic host cell, eukaryotic host cell or bacteriophage. Said prokaryotic host cell can be Escherichia coli, Bacillus subtilis, Streptomyces or Proteus mirabilis, etc. Said eukaryotic host cell can be fungi such as Pichia pastoris, Saccharomyces cerevisiae, fission yeast and Trichoderma, insect cells such as Spodoptera frugiperda, plant cells such as tobacco, mammalian cells such as BHK cell, CHO cell, COS cell and myeloma cell. In some embodiments, the host cells according to the present invention are preferably mammalian cells, more preferably, BHK cells, CHO cells, NSO cells or COS cells.
[0050] The term pharmaceutical composition used herein refers to the combination of at least one kind of drug and randomly selected pharmaceutical carriers or excipients for a special purpose. In some embodiments, said pharmaceutical composition includes the combinations, which are separated in time and/or space provided that they can function synergistically to realize the purpose of the present invention. For example, the ingredients contained in said pharmaceutical composition (for example, the antibody, nucleic acid molecule, combination and/or conjugate of nucleic acid molecule) can be administered to the subject as a whole or separately. In the case that the ingredients contained in said pharmaceutical composition are administered separately to the subject, they can be used simultaneously or in turn. Preferably, said pharmaceutical carrier is water, buffer aqueous solution, isotonic saline solutions such as PBS (phosphate buffer), glucose, mannitol, dextrose, lactose, starch, magnesium stearate, cellulose, magnesium carbonate, 0.3% glycerol, hyaluronic acid, ethanol or polyalkylene glycols such as polypropylene glycol, triglyceride and others. The type of the pharmaceutical carrier can be selected based on whether the composition according to the present invention is formulated to be administered via oral, intranasal, intradermal, subcutaneous, intramuscular or intravenous route. The composition according to the present invention can comprise a wetting agent, an emulsifier or a buffer solution as additive.
[0051] The pharmaceutical composition according to the present invention can be administered via any appropriate route, for example, oral, intranasal, intradermal, subcutaneous, intramuscular or intravenous.
[0052] In one relevant aspect, the present invention provides a pharmaceutical composition comprising an anti-PD-1 antibody and a second therapeutic agent. In one embodiment, the second therapeutic agent is any agent advantageous to combine with anti-PD-1 antibody. Examples of such agent advantageous to combine with anti-PD-1 antibody include, but are not limited to, other agents that can inhibit the activity of PD-1 (including the fragments, the peptide inhibitor, the small molecule antagonists, etc., binding to other antibodies or antigens) and/or the agents that can interfere with the transduction of upstream or downstream signals of PD-1.
[0053] The terms prevent or treat diseases or conditions through removing, inhibiting or lowering the activity of PD-1 refers to the diseases or conditions caused by expression of PD-1 or those diseases or conditions with the symptoms/features of PD-1 expression. In some embodiments, said diseases or conditions are cancers or infectious diseases. Said cancers include, but are not limited to, lung cancer, liver cancer, ovarian cancer, cervical cancer, skin cancer, bladder cancer, colon cancer, breast cancer, glioma, renal cancer, gastric cancer, esophageal cancer, oral squamous cell carcinoma, head/neck cancer. Said infectious diseases include, but are not limited to, HIV infection and Hepatitis B virus infection.
[0054] The term effective treatment dose used in this patent refers to a dose sufficient to confer benefit to the application target. The dose administered, the administration rate and the duration may depend on the conditions and severity of the target to treat. The prescription of treatment (for example, determination of dose) is determined by a physician, who may consider the factors such as the disease to treat, the condition of individual patient, the administration site, and the administration method.
[0055] The term subject used in this patent refers to mammals such as human or other animals, for example, wild animals (heron, stork, crane, etc), livestock (duck, goose, etc) or laboratory animals (orangutan, monkey, rate, mouse, rabbit and guinea pig, etc)
[0056] The following Examples are provided to prove and further explain some preferred embodiments according to the present invention. Nevertheless, they should not be interpreted as limiting the scope of the present invention.
EXAMPLES
Example 1
Clone Human PD1 Extracellular Structural Region into Eukaryotic Expression Plasmid
[0057] Total RNA from human peripheral blood cells (Beijing Red Cross Blood Center) was extracted with TRIzol? RNA extraction kit (Invitrogen) and cDNA was obtained with reverse transcription kit by Invitrogen. The PD1 extracellular fragment was obtained by PCR amplification of the cDNA using the upstream primer 5-GTACGCTAGCCACCATGCAGATCCCACAGGC-3 (SEQ ID NO.31) and the downstream primer 5-GATCCTCGAGCCACCAGGGTTTGGAACTG-3 (SEQ ID NO.32),. The amplified product was digested by Nhe I and Xho I and cloned into the eukaryotic expression plasmid system of pCDNA3.1. 293T cells (ATCC) were transfected with this plasmid for 3 days, the supernatant of the cell culture was collected to purify h-PD1. Total RNA from the peripheral blood cells of Macaca fascicularis were also extracted and the produced cDNA was cloned into the a eukaryotic expression vector.
[0058] As shown in
Example 2
Test the Combination of the PD-1 on Cells and the Ligand PD-L1
[0059] 1. Isolate T Cells from Human Peripheral Blood Cells
[0060] When the suspension of peripheral blood cells (Beijing Blood Institute) flows through nylon-fiber column (Beijing Hede Biotechnology Company), the B cells, plasma cells, mononuclear cells and some ancillary cells will adhere selectively to the nylon fiber although most T cells pass through nylon-fiber column and hence yield the enriched T cell population. The procedure is simply described as follows: take a 50-ml glass syringe, pull out the syringe core and fit a rubber hose with clip into the syringe nozzle. Tie up some nylon fibers and insert them into the syringe. Fix the syringe on the support and pour RPMI cell culture fluid at 37? C. to pre-treat the nylon fibers. Close the valve, open the valve after 0.5 hours to release the cell culture fluid. Dilute the cell fluid to be separated with pre-heated RPMI culture fluid to an appropriate concentration about 5.00?10.sup.7 cells/ml. Pour the cell fluid into the syringe and submerge the nylon-fiber column. Cover the syringe and incubate at 37? C. for 1 hour. Open the lower opening, release the fluid slowly (1 drip/min) and collect in a centrifuge tube. Centrifuge at 1000?g for 10 minutes to yield the desired T lymphocytes.
2. Conjugate rh-PD-L1 Recombinant Protein with Biotin
[0061] Mix 100 ug rh-PD-L1 recombinant protein (purchased from Beijing Sino Biological Inc.) with the biotin-amino-caproic acid-NETS (Thermo) dissolved in DMSO at a molar ratio of 1:4 and keep the mixture still at room temperature for 1 hour. Then pass the reaction mixture through G25 gel column (Thermo) to separate the biotinmarked rh-PD-L1 and the free biotins.
3. Combine the Biotin-Marked rh-PD-L1 with Human T Cells
[0062] rh-PD-L1 recombinant protein conjugated with different concentrations of biotins was mixed with 10.sup.5 T cells isolated according to the method above. The mixture was incubated at 4? C. for 15 minutes. After washing three times with PBS, a streptavidin-allophycocyanin (Thermo) (SA-APC) to 0.2 ug/ml was added and incubated with the mixture at 4? C. for 20 minutes. After washing three more times with PBS, samples were measured at 660 nm using the Beckman Dickson FACSCalibur. As shown in
Example 3
Preparation of Anti rh-PD-1 Antibody
1. Animal Immunization
[0063] 10 ug rh-PD-1 recombinant protein of 1mg/ml as antigen was mixed with equivalent immune adjuvants (Freund adjuvant (SigmaAldrich)) and immunized subcutaneously three female FVB mice of 6-week old. After the first immunization, the same dose is administered once per week to boost the immunization.
2. Cell Fusion
[0064] After the last shot of enhanced immunization, lymph nodes at the thigh root of mice were collected and milled in the normal saline. The produced suspension, enriched with B cells, was fused with the SP2/0 cells via the conventional method of electrophoretic transfer (see BTX electroporator manual). The fusion cells were cultured at the condition of 5% CO.sub.2 and 37? C. in the RPMI-1640 whole culture medium containing HAT (Sigma) to culture.
Example 4
Experiment of Blocking Ligand and Receptor
[0065] From 20000 of monoclonal hybridoma cell lines, the enzyme label (Elisa) reaction was employed to screen out the 1220 clones of secreted antibodies, which can bind to PD-1 proteins. Five of these 1220 clones of antibodies had the ability to inhibit the binding between the biotin-marked PD-L1 and the PD-1 receptor on T cells to various degrees.
[0066] 1 ug/ml of each of the five antibodies described as above were incubated with 312 ng/ml of biotin-marked rh-PD-L1 (concentration) at room temperature for 20 minutes. The mixture was then incubated with T cells isolated from human peripheral blood cells at 4? C. for 15 minutes. After washing three times with normal saline and 0.2 ug/ml of SA-APC was added to the mixture and incubated at 4? C. for 15 minutes. After washing three times with normal saline, samples were measured with BD's flow cytometer to verify whether the antibodies can inhibit the binding of rh-PD-L1 and PD-1 receptor on the surface of T cell.
[0067] As shown in
Example 5
Binding of the Antibody Candidates to Other CD28 Family Members
[0068] In order to further test the binding specificity of antibody candidate Clones 1, 10, 11, 55 and 64, 1 ug/ml of rh-PD-1 or the other CD28 family members, i.e., ICOS, CTLA-4 and CD28 (R&D System) in the carbonate buffer solution (0.05M PH9) was used to coat a 96-well enzyme-label plate and kept at 4? C. overnight. The next day, solution was removed from the wells and the wells were washed three times with a washing buffer (PBS+0.5% TWEEN). PBS solution containing 3% BSA was added to the wells to block for 20 minutes. After washing three times with the washing buffer, 100 ul of each antibody clone was added at 1 ug/ml and incubated at room temperature for 1 hour. After three washes with the washing buffer, HRP cross-linked goat anti mouse antibody (Jackson Immunoresearch) was diluted in the washing buffer 1: 0000, and added to the sample wells and incubated at room temperature for 1 hour. After three washes with the washing buffer, 50 ul TMB (tetramethyl benzidine) substrate solution was added to develop the color. The color reaction was terminated after the reaction was continued for 10 minutes at room temperature by adding 25 ul of 0.5M sulfuric acid solution to the reaction mixture. The absorbance was then measured at 450 nm.
[0069] As shown in
[0070] Candidate hybridoma cells were cultured until reaching a total count of 10.sup.7. The cells were collected by centrifugation at 1000 rpm for 10 minutes and total RNA from the cells was extracted with TRIzol? reagent kit (Invitrogen). The total RNA was used as the template to synthesize the first strand cDNA (Qiagen), which, in turn, was used as a template to amplify the DNA sequence of the variable region of the respective hybridoma cells. The primer sequence used in the amplification reaction is complementary to the first framework region and the constant region of the variable region of antibody (Larrick, J. W., et al., (1990) Scand. J. Immunol., 32, 121-128 and Coloma, J. J. et al., (1991) BioTechniques, 11,152-156 et al.). In a 50 ?l reaction system, 1 ?l of cDNA, 5 ?l of 10?PCR buffer solution, each 1 ?l (25 pmol) of upstream and downstream primer, 1 ?l of dNTP, 1 ?l of 25 mmol/L MgCl.sub.2, 39 ?l of H.sub.2O, were added separately. The initial denaturation of the template was conducted at 95? C. for 10 minutes. 1 ?l of Taq enzyme (Invitrogen) was added to the reaction to start temperature cycles of the PCR amplification. The reaction conditions are as follows: denaturing at 94? C. for 1 minute, annealing at 58? C. for 1 minute, and extending at 72? C. for 115 minutes. The cycle was repeated 30 times before the reaction mixture was kept at 72? C. for 10 minutes.
[0071] The amplified product is sequenced and the sequences of variable regions of the heavy chain and light chain of Clone 1, 10 and 11 of hybridoma are shown below:
TABLE-US-00004 Clone1: Heavychain(SEQIDNO.19) <------------FR1-------------> CDR1<----FR2----> CDR2 QGQLQQSGAELVRPGASVTLTCKASGYTFTDYEMHWVKQTPIHGLEWIGVIESETGGTAYNQKFKG <-------------FR3--------------> CDR3<---FR4---> KAKLTADKSSSTAYMELRSLTSEDSAVYYCTREGITTVATTYYWYFDVWGTGTTVTVSS Nucleicacidsequence(SEQIDNO.25) CAGGGTCAACTGCAGCAGTCTGGGGCTGAGCTGGTGAGGCCTGGGGCTTCAG TGACGGTGACCTGCAAGGCTTCGGGCTACACATTTACTGACTATGAAATGCACT GGGTGAAGCAGACACCTATACATGGCCTGGAATGGATTGGAGTTATTGAATCTG AAACTGGTGGTACTGCCTACAATCAGAAGTTCAAGGGCAAGGCCAAACTGACT GCAGACAAATCCTCCAGCACAGCCTACATGGAGCTCCGCAGCCTGACATCTGA GGACTCTGCCGTCTATTACTGTACAAGAGAGGGTATTACTACGGTAGCAACTAC GTACTACTGGTACTTCGATGTCTGGGGCACAGGGACCACGGTCACCGTCTCCTC A Lightchain(SEQIDNO.20) <--------FR1---------> CDR1<-----FR2----> CDR2 DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWLQKPGQSPELLIYKVYNRFS <-------------FR3--------------> CDR2<--FR4--> GVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGSGTKLEIK Nucleicacidsequence(SEQIDNO.26) GATGTTTTGATGACCCAGACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAA GCCTCCATCTCTTGCAGATCTAGTCAGAGCATTGTACATAGTAATGGAAACACCT ATTTAGAATGGTACCTGCAGAAACCAGGCCAGTCTCCAGAGCTCCTGATCTACA AAGTTTACAACCGATTTTCTGGGGTCCCAGACAGGTTCAGTGGCAGTGGATCA GGGACAGATTTCACACTCAAGATCAGCAGAGTGGAGGCTGAGGATCTGGGAGT TTATTACTGCTTTCAAGGTTCACATGTTCCATTCACGTTCGGCTCGGGGACAAA GTTGGAAATAAAA Heavychain(SEQIDNO.21) <------------FR1-------------> CDR1<----FR2----> CDR2 QVQLQQSGAELVRPGASVTLSCKASGYTFTDYEMHWVKQTPVHGLEWIGAIDPETGGAAYNQKFKG <-------------FR3--------------> CDR3<---FR4---> KAILTADKSSSTAYMELRSLTSEDSAVYYCTREGITTSVVTYYWYFDVWGTGTTVTVSS Nucleicacidsequence(SEQIDNO.27) CAGGTTCAACTGCAGCAGTCTGGGGCTGAGCTGGTGAGGCCTGGGGCTTCAGT GACGCTGTCCTGCAAGGCTTCGGGCTACACATTTACTGACTATGAAATGCACTG GGTGAAGCAGACACCTGTGCATGGCCTGGAATGGATtGGAGCTATTGATCCTGA AACTGGTGGTGCTGCCTACAATCAGAAGTTCAAGGGCAAGGCCATACTGACTG CAGACAAATCCTCCAGCACAGCCTACATGGAGCTCCGCAGCCTGACATCTGAG GACTCTGCCGTCTATTACTGTACAAGAGAGGGTATTACTACGTCAGTGGTTACGT ACTACTGGTACTTCGATGTCTGGGGCACAGGGACCACGGTCACCGTCTCCTCA Lightchain(SEQIDNO.22) <--------FR1---------> CDR1<-----FR2----> CDR2 DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWLQKPGQSPKLLIYKVSNRFS <-------------FR3--------------> CDR2<--FR4--> GVPDRFSGSGSGTDFTLRISRVEPEDLGVYYCFQGSHVPLTFGSGTKLEIK Nucleicacidsequence(SEQIDNO.28) GATGTTTTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAA GCCTCCATCTCTTGCAGATCTAGTCAGAGCATTGTACATAGTAATGGAAACACCT ATTTAGAATGGTACCTGCAGAAACCAGGCCAGTCTCCAAAGCTCCTGATCTACA AAGTTTCCAACCGATTTTCTGGGGTCCCAGACAGGTTCAGTGGCAGTGGATCA GGGACAGATTTCACACTCAGGATCAGCAGAGTGGAGCCTGAGGATCTGGGAGT TTATTACTGCTTTCAAGGTTCACATGTTCCACTCACGTTCGGCTCGGGGACAAA GTTGGAAATAAAA Clone11: Heavychain(SEQIDNO.23) <------------FR1-------------> CDR1<----FR2----> CDR2 QVTLKESGPGILQPSQTLSLTCSFSGFSLSTFGMGVGWIRQPSGKGLEWLAHIWWDDDKYYNPALKS <-------------FR3--------------> CDR2<---FR4---> RLTISKNTSKNQVFLKIANVDTEDTATYYCARIEERFRWYFDVWGTGTTVTVSS Nucleicacidsequence(SEQIDNO.29) CAGGTTACTCTGAAAGAGTCTGGCCCTGGGATATTGCAGCCCTCCCAGACCCTC AGTCTGACTTGTTCTTTCTCTGGGTTTTCACTGAGCACTTTTGGTATGGGTGTCG GCTGGATTCGTCAGCCTTCAGGGAAGGGTCTGGAGTGGCTGGCACACATTTGG TGGGATGATGATAAGTACTATAATCCCGCCCTGAAGAGTCGGCTCACAATCTCC AAGAATACCTCCAAAAACCAGGTATTCCTCAAGATCGCCAATGTGGACACTGA AGATACTGCCACATACTACTGTGCTCGAATAGAGGAGAGGTTCCGCTGGTACTT CGATGTCTGGGGCACAGGGACCACGGTCACCGTCTCCTCA Lightchain(SEQIDNO.24) <--------FR1---------> CDR1<-----FR2----> CDR2 RAGWTQESALTTSPGETVTLTCRSSTGAITTSNYANWVQKPDHLFTGLIGGTNNRAP <-------------FR3--------------> CDR2<--FR4--> GVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVL Nucleicacidsequence(SEQIDNO.30) AGGGCTGGTTGGACTCAGGAATCTGCACTCACCACATCACCTGGTGAAACAGT CACACTCACTTGTCGCTCAAGTACTGGGGCTATTACAACTAGTAACTATGCCAA CTGGGTCCAAGAAAAACCAGATCATTTATTCACTGGTCTAATAGGTGGTACCAA CAACCGAGCTCCAGGTGTTCCTGCCAGATTCTCAGGCTCCCTGATTGGAGACA AGGCTGCCCTCACCATCACAGGGGCACAGACTGAGGATGAGGCAATATATTTCT GTGCTCTATGGTACAGCAACCACTGGGTGTTCGOTGGAGGAACCAAACTGACT GTCCTA
Example 7
Construct the Expression Vector of Chimeric Antibody
[0072] The Fc fragment of the constant region of the heavy chain and the ?/? constant region of the light chain from human blood cells (Beijing Blood Institute) were cloned into the plasmid pCDNA3.1 (see Walls Mass., Hsiao H and Harris L J (1993), Nucleic Acids Research, Vol. 21, No. 12 2921 -2929) for modification. Said sequence fragments of the heavy chain and light chain described in Example 6 were synthesized by Genscript Corporation. The heavy chain sequence fragment, after digestion by Xho I and Age I enzymes, and the light chain sequence fragment, after digestion by Sma I and Dra III enzymes, were cloned into the plasmid pCDNA3.1 and sequenced to confirm the sequence of cloned DNA. The experimental materials in the description below were all obtained through transfecting the cells with this series of plasmids and purifying the products generated by the transfected cells.
Example 8
In Vitro Stimulation of T Cells by Chimeric AntibodyTetanus Toxin Stimulation Test
[0073] Freshly prepared peripheral blood mononuclear cell (PBMC) were placed into 96-well flat-bottom plate. After an overnight incubation, various concentrations of antibodies and 100 ng/ml of tetanus toxin (TT) (List Biological Laboratories) were added. Supernatant was collected from each of the sample well three days later,. The content of IFN? in the supernatant was measured by ELISA using the INFN? kit (R&D System). As shown in
[0074] Using the method described in Example 7, the light and heavy chains of the antibodies 1 and 10 were recombined reciprocally to generate recombinant antibodies H1L10 (heavy chain 1, light chain 10) and H10L1 (heavy chain 10, light chain 1). These antibodies, the original antibody 1 (heavy chain 1, light chain 1) and the original antibody 10 (heavy chain 10, light chain 10) were tested by ELISAs and the results of EC50s for these antibodies are shown in the table below:
TABLE-US-00005 Sample H1L1 H10L10 H1L10 H10L1 EC50 (pM) 338.1 426.3 270.1 528.1
[0075] The result shows that the antibodies produced after recombination can still bind to PD-1 protein effectively.
Example 10
Humanization Modification of Antibody
[0076] The humanization modification was conducted based on the sequence of variable region of the antibody secreted by the hybridoma cell obtained as described above. In brief, the process of humanization modification involved the following steps: Acomparing the gene sequences of the antibodies secreted by various hybridoma cells with the gene sequence of the human embryonic antibody to find the sequence of high homology; Banalyzing and testing the affinity of HLA-DR in order to select the framework sequence of human embryo with low affinity; Cusing computer analog technology to apply molecular docking to analyze the sequences of framework amino acids in the variable region and the surrounding, and examining its spatial stereo binding mode; calculating the electrostatic force, Van der Waals force, hydrophobicity-hydrophilicity and the entropy value to analyze the key individual amino acids in the gene sequences of the antibodies secreted by various hybridoma cell, which are critical for interacting with PD-1 and maintaining the antibodies' spatial configuration, grafting these key amino acids back to the selected gene framework of human embryo. The amino acid sites in the framework region which must be reserved were also identified and random primers were synthesized to construct the phage library. The humanized antibody library was then screened (Pini, A.et al., (1998). Design and Use of a Phage Display Library: HUMAN ANTIBODIES WITH SUBNANOMOLAR AFFINITY AGAINST A MARKER OF ANGIOGENESIS ELUTED FROM A TWO-DIMENSIONAL GEL., Journal of Biological Chemistry, 273(34): 21769-21776). A number of humanized antibodies were obtained from the screening, including the following clones. The light chain sequences of Clone 38, 39 and 41 are the same, and the heavy chain sequences of Clone 39 and 48 are the same.
TABLE-US-00006 HeavychainofClone38(SEQIDNO.33(peptide);SEQIDNO.38(nucleotide)) <------------FR1-------------> CDR1<----FR2----> CDR2 QGQLVQSGAEVKKPGASVKVSCKASGYTFTDYEMHWVRQAPIHGLEWIGVIESETGGTAYNQKFKG <-------------FR3--------------> CDR3<---FR4---> RVTITADKSTSTAYMELSSLRSEDTAVYYCAREGITTVATTYYWYFDVWGQGTTVTVSS CAGGGCCAGCTGGTGCAGAGCGGCGCCGAGGTGAAGAAGCCCGGCGCCAGCG TGAAGGTGAGCTGCAAGGCCAGCGGCTACACCTTCACCGACTACGAGATGCAC TGGGTGAGACAGGCCCCCATCCACGGCCTGGAGTGGATCGGCGTGATCGAGAG CGAGACCGGCGGCACCGCCTACAACCAGAAGTTCAAGGGCAGAGTGACCATC ACCGCCGACAAGAGCACCAGCACCGCCTACATGGAGCTGAGCAGCCTGAGAA GCGAGGACACCGCCGTGTACTACTGCGCCAGAGAGGGCATCACCACCGTGGCC ACCACCTACTACTGGTACTTCGACGTGTGGGGCCAGGGCACCACCGTGACCGT GAGCAGC LightchainofClone38(SEQIDNO.34(peptide);SEQIDNO.30(nucleotide)) <--------FR1---------> CDR1<-----FR2----> CDR2 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWYLQKPGQSPQLLIYKVSNRFS <-------------FR3--------------> CDR --FR4--> GVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPFTFGQGTKLEIK GATGTGGTGATGACCCAGAGCCCGCTGAGCCTGCCGGTGACCCTGGGCCAGCC GGCGAGCATTAGCTGCCGCAGCAGCCAGAGCATTGTGCATAGCAACGGCAACA CCTATCTGGAATGGTATCTGCAGAAACCGGGCCAGAGCCCGCAGCTGCTGATTT ATAAAGTGAGCAACCGCTTTAGCGGCGTGCCGGATCGCTTTAGCGGCAGCGGC AGCGGCACCGATTTTACCCTGAAAATTAGCCGCGTGGAAGCGGAAGATGTGGG CGTGTATTATTGCTTTCAGGGCAGCCATGTGCCGCTGACCTTTGGCCAGGGCAC CAAACTGGAAATTAAA HeavychainofClone39(SEQIDNO.39(peptide);SEQIDNO.40(nucleotide)) <------------FR1-------------> CDR1<----FR2----> CDR2 QGQLVQSGAEVKKPGASVKVSCKASGYTFTDYEMHWVRQAPGQGLEWMGVIESETGGTAYNQKFKG <-------------FR3--------------> CDR3<---FR4---> RAKITADKSTSTAYMELSSLRSEDTAVYYCTREGITTVATTYYWYFDVWGQGTTVTVSS CAGGGCCAGCTGGTGCAGAGCGGCGCCGAGGTGAAGAAGCCCGGCGCCAGCG TGAAGGTGAGCTGCAAGGCCAGCGGCTACACCTTCACCGACTACGAGATGCAC TGGGTGAGACAGGCCCCCGGCCAGGGCCTGGAGTGGATGGGCGTGATCGAGA GCGAGACCGGCGGCACCGCCTACAACCAGAAGTTCAAGGGCAGAGCCAAGAT CACCGCCGACAAGAGCACCAGCACCGCCTACATGGAGCTGAGCAGCCTGAGA AGCGAGGACACCGCCGTGTACTACTGCACCAGAGAGGGCATCACCACCGTGGC CACCACCTACTACTGGTACTTCGACGTGTGGGGCCAGGGCACCACCGTGACCG TGAGCAGC LightchainofClone39(SEQIDNO.34(peptide);SEQIDNO.30)) <--------FR1---------> CDR1<-----FR2----> CDR2 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWLQKPGQSPQLLIYKVSNRFS <-------------FR3--------------> CDR3<--FR4--> GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPLTFGQGTKLEIK GATGTGGTGATGACCCAGAGCCCGCTGAGCCTGCCGGTGACCCTGGGCCAGCC GGCGAGCATTAGCTGCCGCAGCAGCCAGAGCATTGTGCATAGCAACGGCAACA CCTATCTGGAATGGTATCTGCAGAAACCGGGCCAGAGCCCGCAGCTGCTGATTT ATAAAGTGAGCAACCGCTTTAGCGGCGTGCCGGATCGCTTTAGCGGCAGCGGC AGCGGCACCGATTTTACCCTGAAAATTAGCCGCGTGGAAGCGGAAGATGTGGG CGTGTATTATTGCTTTCAGGGCAGCCATGTGCCGCTGACCTTTGGCCAGGGCAC CAAACTGGAAATTAAA HeavychainofClone41(SEQIDNO.36(peptide);SEQIDNO.41(nucleotide)) <------------FR1-------------> CDR1<----FR2----> CDR2 QGQLVQSGAEVKKPGASVKVSCKASGYTFTDYEMHWVRQAPGQGLEWMGVIESETGGTAYNQKFQG <-------------FR3--------------> CDR3<---FR4---> RVTLTADKSSSTAYMELSSLRSEDTVYYCTREGITTVATTYYWYFDVWGQGTLVTVSS CAGGGCCAGCTGGTGCAGAGCGGCGCGGAAGTGAAAAAACCGGGCGCGAGC GTGAAAGTGAGCTGCAAAGCGAGCGGCTATACCTTTACCGATTATGAAATGCAT TGGGTGCGCCAGGCGCCGGGCCAGGGCCTGGAATGGATGGGCGTGATTGAAA GCGAAACCGGCGGCACCGCGTATAACCAGAAATTTCAGGGCCGCGTGACCCTG ACCGCGGATAAAAGCAGCAGCACCGCGTATATGGAACTGAGCAGCCTGCGCAG CGAAGATACCGCGGTGTATTATTGCACCCGCGAAGGCATTACCACCGTGGCGAC CACCTATTATTGGTATTTTGATGTGTGGGGCCAGGGCACCCTGGTGACCGTGAG CAGC LightchainofClone41(SEQIDNO.34(peptide);SEQIDNO.30(nucleotide)) <--------FR1---------> CDR1<-----FR2----> CDR2 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWYLQKPGQSPQLLIYKVSNRFS <-------------FR3--------------> CDR3<--FR4--> GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPLTFGQGTKLEIK GATGTGGTGATGACCCAGAGCCCGCTGAGCCTGCCGGTGACCCTGGGCCAGCC GGCGAGCATTAGCTGCCGCAGCAGCCAGAGCATTGTGCATAGCAACGGCAACA CCTATCTGGAATGGTATCTGCAGAAACCGGGCCAGAGCCCGCAGCTGCTGATTT ATAAAGTGAGCAACCGCTTTAGCGGCGTGCCGGATCGCTTTAGCGGCAGCGGC AGCGGCACCGATTTTACCCTGAAAATTAGCCGCGTGGAAGCGGAAGATGTGGG CGTGTATTATTGCTTTCAGGGCAGCCATGTGCCGCTGACCTTTGGCCAGGGCAC CAAACTGGAAATTAAA HeavychainofClone48(SEQIDNO.35(peptide);SEQIDNO.40(nucleotide)) <------------FR1-------------> CDR1<----FR2----> CDR2 QGQLVQSGAEVKKPGASVKVSCKASGYTFTDYEMHWVRQAPGQGLEWMGVIESETGGTAYNQKFQG <-------------FR3--------------> CDR3<---FR4---> RAKITADKSTSTAYMELSSLRSEDTAVYYCTREGITTVATTYYWYFDVWGQGTLVTVSS CAGGGCCAGCTGGTGCAGAGCGGCGCCGAGGTGAAGAAGCCCGGCGCCAGCG TGAAGGTGAGCTGCAAGGCCAGCGGCTACACCTTCACCGACTACGAGATGCAC TGGGTGAGACAGGCCCCCGGCCAGGGCCTGGAGTGGATGGGCGTGATCGAGA GCGAGACCGGCGGCACCGCCTACAACCAGAAGTTCAAGGGCAGAGCCAAGAT CACCGCCGACAAGAGCACCAGCACCGCCTACATGGAGCTGAGCAGCCTGAGA AGCGAGGACACCGCCGTGTACTACTGCACCAGAGAGGGCATCACCACCGTGGC CACCACCTACTACTGGTACTTCGACGTGTGGGGCCAGGGCACCACCGTGACCG TGAGCAGC LightchainofClone48(SEQIDNO.37(peptide);SEQIDNO.42(nucleotide)) <--------FR1---------> CDR1<-----FR2----> CDR2 DVVMTQSPLSLPVTLGQPASISCRSSQSIVHSNGNTYLEWYLQKPGQSPQLLIYKVSNRFS <-------------FR3--------------> CDR
--FR4--> GVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHVPLTFGQGTKLEIK GA TGTGGTGATGACCCAGAGCCCGCTGAGCCTGCCGGTGACCCTGGGCCAGCCGG CGAGCATTAGCTGCCGCAGCAGCCAGAGCATTGTGCATAGCAACGGCAACACC TATCTGGAATGGTATCTGCAGAAACCGGGCCAGAGCCCGCGCCTGCTGATTTAT AAAGTGAGCAACCGCTTTAGCGGCGTGCCGGATCGCTTTAGCGGCAGCGGCAG CGGCACCGATTTTACCCTGAAAATTAGCCGCGTGGAAGCGGAAGATGTGGGCG TGTATTATTGCTTTCAGGGCAGCCATGTGCCGCTGACCTTTGGCCAGGGCACCA AACTGGAAATTAAA
Example 11
In Vitro Stimulation of T Cells by Humanized Antibody
[0077] Freshly prepared PBMCs (Beijing Blood Institute) were placed in the wells of a 96-well flat-bottom plate. After an overnight incubation, 10 ug/ml of antibody and 100 ng/ml of tetanus toxin (TT) were added to the PBMCs. After culturing it for 3 days, the supernatant was collected and the secretion level of IL2 of Clones 38, 39, 41, 48, and conIgG4 (control antibody) of the humanized antibodies were measured using Luminex? (Thermo Fisher Scientific, Inc.) and CD8+ cytokine assay detection kit (EMD Millipore, Inc.). The result (see
Example 12
Humanized Antibody can Stimulate T Cells to Kill Tumor Cells in Vitro
[0078] MD-MAB-453 cells were infected with the lentivirus (Qiagen) expressing PD-L1 protein to generate a MD-MAB-453 cell line, which stably expresses PD-L1. A GFP gene was also introduced to said cell line to allow the stable expression of the GFP protein. Dendritic cells (DC) isolated from the fresh human peripheral blood cells 300 cells/well were cultured with said MD-MAB-453 cells stably expressing both PD-L1 and GFP (300 cells/well) in a 96-well plate together for three days. T cells (1000 cells/well) isolated from human peripheral blood and 10 ug/ml of the humanized anti-PD-1 antibody Clones 38, 39, 41, 48 or the control antibody conIgG4 were added to the mixture and cultured together for 3 days to before the GFP fluorescence was measured. The result (see
Example 13
The Binding of Humanized Antibodies with PD-1 Proteins Derived from Various Species
[0079] 1 ug /ml of human-derived PD-1, Macaca fascicularis PD-1, and mouse-derived PD-1 (Sinobiological) in the carbonate buffer solution (0.05 M PH9) were prepared and used to coat the wells of the 96-well flat-bottom plates at 4? C. overnight. The next day, solution was removed from the wells and the wells were washed three times with a washing buffer. PBS solution containing 3% BSA was added to block the wells for 20 minutes. The wells were then washed three times with the washing buffer before 100 ul of various concentrations of candidate antibodies were added. The mixture was incubated at room temperature for 1 hour and then washed three times with a washing buffer. A HRP conjugated goat anti human antibody (Jackson Immunoresearch) was first diluted to 1: 10000 with the washing buffer and then added to the wells to incubate at room temperature for 1 hour. After washing three times with the washing buffer, 50 ul TMB substrate solution was added to the wells to develop the color. After 10 minutes at room temperature, the color development reaction was terminated with 25 ul 0.5M sulfuric acid solution and the absorbance was read at 450 nm. The results (
[0080] Compare PD-1 sequences of human, Macaca fascicularis and mouse (see
Example 14
Experiment of in Vitro Stimulation by Humanized Antibody to T Cell ProliferationTetanus Antigen Memory Response Experiment
[0081] Freshly prepared PBMC (Beijing Blood Institute) were placed into the wells of a 96-well flat-bottom plate. After incubation overnight, the cells were labeled with carboxyfluorescein succinimidyl ester (CFSE) and incubated with 10 ug/ml of humanized antibody (38, 39, 41 and 48) and 100 ng/ml of tetanus toxin (TT) (List Biological Laboratories). T cell proliferation at the 6.sup.th, 8.sup.th and 10.sup.th day was analyzed based on the dilution ratio of CSFE with the flow cytometry (FACS). As shown by the result of
Example 15
In Vitro Stimulation of T Cell Proliferation by Humanized AntibodyViral Polypeptides Antigen Memory Response Experiment
[0082] Freshly prepared PBMCs (Beijing Blood Institute) were placed into the wells of a 96-well flat-bottom plate. After an overnight incubation, the cells were labeled with CFSE. 10 ug/ ml of humanized antibody (38, 39, 41 and 48) and 1 ug/ml of peptide mixture of CMV, EBV and Influenza (CEF) were added to the wells. Quantitative analysis were conducted on T cell proliferation at the 6.sup.th, 8.sup.th and 10.sup.th day with the flow cytometry (FACS) based on the dilution ratio of CSFE. As shown by the result of FIG. 11, compared with the control IgG the immune cells activated by CEF mixed polypeptides stimulation induced through blocking the PD-1 signal was under further division and proliferation.