Gene Therapy Approaches to Mucolipidosis IV (MLIV)
20220372520 · 2022-11-24
Inventors
Cpc classification
C12N2830/50
CHEMISTRY; METALLURGY
C07K14/705
CHEMISTRY; METALLURGY
C12N2750/14143
CHEMISTRY; METALLURGY
C12N2830/48
CHEMISTRY; METALLURGY
A61K48/005
HUMAN NECESSITIES
C12N2830/42
CHEMISTRY; METALLURGY
A01K2267/0318
HUMAN NECESSITIES
C12N2830/008
CHEMISTRY; METALLURGY
A61K48/0075
HUMAN NECESSITIES
International classification
Abstract
Described herein are compositions comprising AAV vectors comprising a sequence encoding mucolipin 1, and methods of use thereof for gene therapy of Mucolipidosis IV (MLIV).
Claims
1. An adeno-associated (scAAV) viral vector comprising a sequence encoding Mucolipin-1 (MCOLN1) protein, operably linked to a promoter that drives expression of the MCOLN1 protein in a cell.
2. The AAV of claim 1, which is a self-complementary scAAV or single-stranded AAV-PHP.b.
3. The AAV of claim 1, further comprising one or more cis-regulatory elements that increase expression of the MCOLN1.
4. The AAV of claim 3, wherein the cis-regulatory elements comprise one or more enhancers; posttranscriptional regulatory elements; cell penetrating peptides; polyadenylation sequences; and/or an intron.
5. The AAV of claim 4, wherein the posttranscriptional regulatory element is HBV Posttranscriptional Regulatory Element (HPRE) or woodchuck hepatitis virus post-transcriptional regulatory element (WPRE), or a variant thereof.
6. The AAV of claim 4, wherein the intron is SV40 intron, F.IX truncated intron 1; β-globin SD/immunoglobin heavy chain SA; Adenovirus SD/immunoglobulin SA; SV40 late SD/SA (19S/16S); Hybrid adenovirus SD/IgG SA; or minute virus of mice (MVM) intron.
7. The AAV of claim 1, wherein the MCOLN1 protein is at least 80% identical to SEQ ID NO:1.
8. The AAV of claim 1, wherein the promotor is a ubiquitous promoter, preferably Jet promoter, or a neuron-specific promoter, preferably a synapsin I (Syn1) promoter.
9. The AAV of claim 1, wherein the AAV is AAV9 serotype and comprises a JeT promoter or a Syn1 promoter and polyadenylation sequence.
10. A method of treating mucolipidosis IV in a subject, the method comprising administering to the subject a therapeutically effective amount of the AAV of claim 1.
11. The method of claim 10, wherein the AAV is administered to the subject by direct administration into the CNS or eye of the subject.
12. The method of claim 11, wherein administration into the CNS is by intrathecal or intracerebroventicular injection.
13. The method of claim 10, wherein the subject has developed one or more symptoms of mucolipidosis IV selected from spasticity, hypotonia, an inability to walk independently, ptosis, myopathic facies, drooling, difficulties in chewing and swallowing, impaired fine-motor function, and progressive blindness.
14. The method of claim 13, wherein the one or more symptoms of mucolipidosis IV are improved.
15. The method of claim 10, wherein the AAV is administered once, twice, three times, or more.
16.-21. (canceled)
22. The method of claim 15, wherein the AAV is administered once weekly, once monthly, biweekly, bimonthly, every three months, every four months, every five months, every six months, or annually.
Description
DESCRIPTION OF DRAWINGS
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
DETAILED DESCRIPTION
[0027] Mucolipidosis IV (MLIV) is a neurodevelopmental disorder caused by aberrant lysosomal storage of lipids and water-soluble substances, generally caused by a transport defect in the late steps of endocytosis, resulting in a defect in organization of white matter in the brain and reduced maintenance of cells in the retina and optic nerve. See, e.g., Schiffmann et al., Mucolipidosis IV 2005 Jan. 28 [Updated 2015 Jul. 30]. In: Adam M P, Ardinger H H, Pagon R A, et al., editors. GeneReviews® [Internet]. Seattle (Wash.): University of Washington, Seattle; 1993-2020. Available from: ncbi.nlm.nih.gov/books/NBK1214/.
[0028] Described herein are compositions comprising viral vectors for use in treatment of subjects with MLIV, to deliver sequences encoding MCOLN1 to rescue, reduce, or reverse deficits caused by the disease.
[0029] Methods of Treatment
[0030] The methods described herein include methods for the treatment of Mucolipidosis IV (MLIV). Generally, the methods include administering a therapeutically effective amount of a vector comprising a sequence encoding MCOLN1 as described herein, to a subject who is in need of, or who has been determined to be in need of, such treatment.
[0031] MLIV causes neurodegeneration in some individuals, with reduced life expectancy as compared to healthy individuals. Typically, subjects present with severe psychomotor delay by the end of the first year of life, as well as (sometimes later-developing) visual impairment caused by a combination of corneal clouding and retinal degeneration. A diagnosis can be made based on typical clinical findings and elevated plasma gastrin concentration (normal range is 0-200 pg/mL) or polymorphic lysosomal inclusions in skin or conjunctival biopsy, or based on detection of the presence of biallelic pathogenic variants in the MCOLN1 gene. Methods for detecting pathogenic variants include exome sequencing, genome sequencing, and mitochondrial sequencing, sequence analysis, deletion/duplication analysis, gene-targeted deletion/duplication analysis or a genotyping assay specifically designed to detect deletions (e.g., breakpoint PCR or allele-specific primer extension) can be employed.
[0032] The following table presents a non-limiting list of known pathogenic mutations in MCOLN1.
TABLE-US-00001 DNA change (cDNA) Effect on Protein c.237 + 1G > A p.? c.406 − 2A > G p.? c.681 − 104T > G p.(=) c.694A > C p.Thr232Pro) c.707G > A p.(Arg236Gln) c.920del p.(Leu307ProfsTer65) c.1084G > T p.(Asp362Tyr) c.1221_1223delCTT p.Phe408del) c.1406A > G p. (Phe454_Asn569del) 6.4-kb deletion beginning in the 5′UTR and extending into exon 6
[0033] The present methods and compositions can be used in subjects who have symptoms, as well as pre-symptomatic individuals, e.g., identified by genetic screening before symptoms develop.
[0034] As used in this context, to “treat” means to ameliorate at least one symptom of MLIV. Often, MLIV results in neurological symptoms including spasticity, hypotonia, an inability to walk independently, ptosis, myopathic facies, drooling, difficulties in chewing and swallowing, and severely impaired fine-motor function, and ophthalmic symptoms including progressive blindness in the second decade of life; thus, a treatment comprising administration of a therapeutically effective amount of a compound described herein can result in a reduction in one or more of these symptoms, or a delay or reduction in risk of development of one or more of these symptoms.
[0035] Preferably, the vectors are administered by direct injection into the CNS, e.g., by intracranial (e.g., intrathecal or intracerebroventicular) administration, and/or by ocular administration (e.g., intraocular injection or ocular topical application). The methods can be administered, once, twice, three times, or more, e.g., on a routine schedule, e.g., once weekly, once monthly, biweekly, bimonthly, every three months, every four months, every five months, every six months, or annually. The methods include administering a therapeutically effective dose; in some embodiments, the dose in the range of 5×10{circumflex over ( )}13 vg−5×10{circumflex over ( )}14 vg.
[0036] Mucolipin-1 (MCOLN1)
[0037] The methods and compositions described herein provide for delivery of sequences encoding MCOLN1. For treatment of human subjects, a sequence encoding human MCOLN1 is preferably used. An exemplary sequence of human MCOLN1 protein is provided in GenBank at RefSeq ID NP_065394.1, reproduced here as SEQ ID NO:1.
TABLE-US-00002 Mucolipin-1, Homo sapiens (SEQ ID NO: 1) 1 MTAPAGPRGS ETERLLTPNP GYGTQAGPSP APPTPPEEED LRRRLKYFFM SPCDKFRAKG 61 RKPCKLMLQV VKILVVTVQL ILFGLSNQLA VTFREENTIA FRHLFLLGYS DGADDTFAAY 121 TREQLYQAIF HAVDQYLALP DVSLGRYAYV RGGGDPWTNG SGLALCQRYY HRGHVDPAND 181 TFDIDPMVVTDCIQVDPPER PPPPPSDDLTLLESSSSYKN LTLKFHKLVN VTIHFRLKTI 241 NLQSLINNEI PDCYTFSVLI TFDNKAHSGR IPISLETQAH IQECKHPSVF QHGDNSFRLL 301 FDVVVILTCS LSFLLCARSL LRGFLLQNEF VGFMWRQRGR VISLWERLEF VNGWYILLVT 361 SDVLTISGTI MKIGIEAKNL ASYDVCSILL GTSTLLVWVG VIRYLTFFHN YNILIATLRV 421 ALPSVMRFCCCVAVIYLGYCFCGWIVLGPY HVKFRSLSMV SECLFSLINGDDMFVTFAAM 481 QAQQGRSSLV WLFSQLYLYS FISLFIYMVL SLFIALITGA YDTIKHPGGA GAEESELQAY 541 IAQCQDSPTS GKFRRGSGSA CSLLCCCGRD PSEEHSLLVN
[0038] An exemplary nucleic acid sequence encoding human MCOLN1 is provided in GenBank at RefSeq ID NM 020533.3, reproduced here as SEQ ID NO:2.
TABLE-US-00003 Homo sapiens mucolipin 1 (MCOLN1) (SEQ ID NO: 2) 1 acagatcagc tgatgccgga gggtttgaag ccgcgccgcg agggagcgag gtcgcagtga 61 cagcggcggg cgatcggacc caggctgccc cgccgtaccc gcctgcgtcc cgcgctcccg 121 ccccagcatg acagccccgg cgggtccgcg cggctcagag accgagcggc ttctgacccc 181 caaccccggg tatgggaccc aggcggggcc ttcaccggcc cctccgacac ccccagaaga 241 ggaagacctt cgccgtcgtc tcaaatactt tttcatgagt ccctgcgaca agtttcgagc 301 caagggccgc aagccctgca agctgatgct gcaagtggtc aagatcctgg tggtcacggt 361 gcagctcatc ctgtttgggc tcagtaatca gctggctgtg acattccggg aagagaacac 421 catcgccttc cgacacctct tcctgctggg ctactcggac ggagcggatg acaccttcgc 481 agcctacacg cgggagcagc tgtaccaggc catcttccat gctgtggacc agtacctggc 541 gttgcctgac gtgtcactgg gccggtatgc gtatgtccgt ggtgggggtg acccttggac 601 caatggctca gggcttgctc tctgccagcg gtactaccac cgaggccacg tggacccggc 661 caacgacaca tttgacattg atccgatggt ggttactgac tgcatccagg tggatccccc 721 cgagcggccc cctccgcccc ccagcgacga tctcaccctc ttggaaagca gctccagtta 781 caagaacctc acgctcaaat tccacaagct ggtcaatgtc accatccact tccggctgaa 841 gaccattaac ctccagagcc tcatcaataa tgagatcccg gactgctata ccttcagcgt 901 cctgatcacg tttgacaaca aagcacacag tgggcggatc cccatcagcc tggagaccca 961 ggcccacatc caggagtgta agcaccccag tgtcttccag cacggagaca acagcttccg 1021 gctcctgttt gacgtggtgg tcatcctcac ctgctccctg tccttcctcc tctgcgcccg 1081 ctcactcctt cgaggcttcc tgctgcagaa cgagtttgtg gggttcatgt ggcggcagcg 1141 gggacgggtc atcagcctgt gggagcggct ggaatttgtc aatggctggt acatcctgct 1201 cgtcaccagc gatgtgctca ccatctcggg caccatcatg aagatcggca tcgaggccaa 1261 gaacttggcg agctacgacg tctgcagcat cctcctgggc acctcgacgc tgctggtgtg 1321 ggtgggcgtg atccgctacc tgaccttctt ccacaactac aatatcctca tcgccacact 1381 gcgggtggcc ctgcccagcg tcatgcgctt ctgctgctgc gtggctgtca tctacctggg 1441 ctactgcttc tgtggctgga tcgtgctggg gccctatcat gtgaagttcc gctcactctc 1501 catggtgtct gagtgcctgt tctcgctcat caatggggac gacatgtttg tgacgttcgc 1561 cgccatgcag gcgcagcagg gccgcagcag cctggtgtgg ctcttctccc agctctacct 1621 ttactccttc atcagcctct tcatctacat ggtgctcagc ctcttcatcg cgctcatcac 1681 cggcgcctac gacaccatca agcatcccgg cggcgcaggc gcagaggaga gcgagctgca 1741 ggcctacatc gcacagtgcc aggacagccc cacctccggc aagttccgcc gcgggagcgg 1801 ctcggcctgc agccttctct gctgctgcgg aagggacccc tcggaggagc attcgctgct 1861 ggtgaattga ttcgacctga ctgccgttgg accgtaggcc ctggactgca gagacccccg 1921 cccccgaccc cgcttattta tttgtagggt ttgcttttaa ggatcggctc cctgtcgcgc 1981 ccgaggaggg cctggacctt tcgtgtcgga cccttggggg cggggagact gggtggggag 2041 ggtgttgaat aaaagggaaa ataaatgtgt cgttttcatt ttta
Preferably, a sequence that encodes a protein that is at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to the exemplary sequence (SEQ ID NO:1) is used, and that retains the activity of the exemplary sequence. Of course, no mutations identified as pathogenic (e.g., in the table above) should be included. In some embodiments a sequence that encodes a protein comprising SEQ ID NO:1, that is at least 80%, 85%, 90%, 95%, 97%, 98%, or 99% identical to the SEQ ID NO:2, is used. For example, in some embodiments, the nucleic acid sequences used in the present methods and compositions are codon-optimized for increased expression in humans. See, e.g., Fuglsang, Protein Expr Purif. 2003; 31:247-249.
MCOLN1 Activity
[0039] Relevant activity of the exemplary (wild type) sequence includes localization of MCOLN1 or TFEB to intracellular vesicular membranes including lysosomes, functioning as a cation channel that is permeable to Ca.sup.2+, Fe.sup.2+, Na.sup.+, K.sup.+, and H.sup.+; and/or functioning in regulating TFEB activation, or other assays, including the following: Localization with lysosome:
[0040] MCOLN1 localization with lysosomes can be confirmed by immunocyto- or histochemical analysis of colocalization of the GFP-tagged mucolipin-1 with either the lysosomal marker LAMP1 or LysoTracker (25).
TFEB Activation:
[0041] Functional causality between activation of MCOLN1 and TFEB is well-established and has been experimentally demonstrated in multiple cellular systems (26-30). Activation of TFEB can be measured via TFEB nuclear localization assay a-TFEB antibodies (26). TFEB nuclear translocation analysis will be performed as previously described (26, 31).
MCOLN1 Cationic Transfer:
[0042] Fe permeability measurements (32): HEK293T cells were either transfected with EGFP-MCOLN1 alone or co-transfected with mCherry-MCOLN1 and EGFP-LAMP1 (a marker for LEL). The size of the LEL is usually, 0.5 mm, which is suboptimal for patch clamping. We therefore treated cells with 1 mM vacuolin-1 (for 1-2 h), a small chemical known to increase the size of endosomes and lysosomes selectively. Large vacuoles (up to 3 mm) were observed in most vacuolin-treated cells. Occasionally, enlarged LEL could also been obtained from TRPML1-transfected cells without vacuolin-1 treatment. No significant difference in TRPML channel properties was seen for enlarged LEL with or without vacuolin-1 treatment. The vacuoles that were positive for both mCherry-TRPML1 and EGFP-LAMP1 were considered as enlarged LEL. Whole-lysosome, lysosome-attached and lysosome luminal-side-out recordings were performed on isolated enlarged LEL, similar to what was performed in enlarged endosomes. In brief, a patch pipette (electrode) was pressed against a cell and then quickly pulled away from the cell to slice the cell membrane. Enlarged LEL were released into the dish and identified by monitoring the TRPML1-EGFP, the TRPML1-mCherry or the LAMP1-EGFP fluorescence.
[0043] Ca.sup.2+ Permeability (25) Measurement:
[0044] Patch-clamp: Whole-lysosome planar patch-clamp recordings and preparation of lysosomes (HEK293, Human Fibroblast) were performed as follows: late endosomes and lysosomes were enlarged by treating the cells with 1 mM vacuolin-1 overnight. The following day, cells were homogenized in homogenization buffer (0.25 M sucrose, 10 mM Tris-Cl, pH 7.4) on ice using a potter homogenizer to obtain whole-cell lysates. The lysates were centrifuged at 14,000 g for 15 min at 4 C. The supernatant was treated with 8 mM CaCl2 (final concentration) on ice for 5 min, followed by a second centrifugation step at 25,000 g for 15 min at 4 C. The supernatant was collected and the pellet washed in 150 mM KCl, 10 mM Tris-Cl, pH 7.4, followed by a final centrifugation step at 25,000 g for 15 min at 4 C. The planar patch-clamp technology combined with a pressure control system and microstructured glass chips containing an aperture of B1 mm diameter (resistances of 10-15 MO) (Port-a-Patch, Nanion Technologies) were applied. Currents were recorded using an EPC-10 patch-clamp amplifier and PatchMaster acquisition software (HEKA). Data were digitized at 40 kHz and filtered at 2.8 kHz. Cytoplasmic solution contained (in mM) 60 KF, 70 K-MSA (methanesulfonate), 0.2 Ca-MSA, 10 HEPES (pH adjusted with KOH to 7.2). Luminal solution was 60 Ca-MSA, 70 K-MSA, 10 HEPES (pH adjusted with MSA to 4.6). The membrane potential was held at 60 mV, and 500 ms voltage ramps from 200 to
100 mV were applied every 5 s. Due to high luminal calcium used to ensure giga seals when performing whole-endolysosomal patch-clamp on the port-a-patch system 37,38, the inward currents are less rectifying and reverse at more positive potentials, depending on current amplitude and protein expression level. All recordings were obtained at room temperature and were analysed using PatchMaster (HEKA) and Origin 6.1 (OriginLab) software. Liquid junction potential was corrected. Water-soluble diC8-PIP2, PI(3,5)P2 were purchased from A.G. Scientific. For the application of all activators, cytoplasmic (external) solution was completely exchanged by a solution containing the respective activator. The EC50 values of graded dose-response curves were fitted with the Hill equation.
[0045] Ca-imaging: Calcium imaging experiments can be performed using fura-2. HEK293 cells are plated onto glass coverslips, grown overnight and transiently transfected with the respected cDNAs using TurboFect transfection reagent (Thermo Scientific). After 24-48 h, cells are loaded for 1 h with the fluorescent indicator fura-2-AM (4 mM; Invitrogen) in a standard bath solution containing (in mM) 138 NaCl, 6 KCl, 2 MgCl2, 2 CaCl2, 10 HEPES and 5.5 D-glucose (adjusted to pH 7.4 with NaOH). Cells were washed in standard bath solution for 30 min before measurement. Calcium imaging was performed using a monochromator-based imaging system (Polychrome IV monochromator, TILL Photonics).
[0046] Percent Identity
[0047] To determine the percent identity of two amino acid sequences, or of two nucleic acid sequences, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second amino acid or nucleic acid sequence for optimal alignment and non-homologous sequences can be disregarded for comparison purposes). In a preferred embodiment, the length of a reference sequence aligned for comparison purposes is at least 80% of the length of the reference sequence, and in some embodiments is at least 90% or 100%. The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position (as used herein amino acid or nucleic acid “identity” is equivalent to amino acid or nucleic acid “homology”). The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which need to be introduced for optimal alignment of the two sequences.
[0048] The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. For example, the percent identity between two amino acid sequences can determined using the Needleman and Wunsch ((1970) J. Mol. Biol. 48:444-453) algorithm which has been incorporated into the GAP program in the GCG software package (available on the world wide web at gcg.com), using the default parameters, e.g., a Blossum 62 scoring matrix with a gap penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.
[0049] Vectors
[0050] Sequences encoding MCOLN1 can be delivered to a subject, e.g., to the brain of a subject, using a viral vector. Described herein are expression vectors for in vivo transfection and expression of a polynucleotide that encodes MCOLN1. Expression constructs can be administered in any effective carrier, e.g., any formulation or composition capable of effectively delivering the component gene to the cells.
[0051] An exemplary approach for in vivo introduction of nucleic acid into a cell is by use of a viral vector containing nucleic acid, e.g., a cDNA. Infection of cells with a viral vector has the advantage that a large proportion of the targeted cells can receive the nucleic acid. Additionally, molecules encoded within the viral vector, e.g., by a cDNA contained in the viral vector, are expressed efficiently in cells that have taken up viral vector nucleic acid.
[0052] Viral vectors can be used as a recombinant gene delivery system for the transfer of exogenous genes in vivo, particularly into humans. These vectors provide efficient delivery of genes into cells, and in some cases the transferred nucleic acids are stably integrated into the chromosomal DNA of the host. Protocols for producing recombinant viruses and for infecting cells in vitro or in vivo with such viruses can be found in Ausubel, et al., eds., Gene Therapy Protocols Volume 1: Production and In Vivo Applications of Gene Transfer Vectors, Humana Press, (2008), pp. 1-32 and other standard laboratory manuals.
[0053] A preferred viral vector system useful for delivery of nucleic acids is the adeno-associated virus (AAV). Adeno-associated virus is a naturally occurring defective virus that requires another virus, such as an adenovirus or a herpes virus, as a helper virus for efficient replication and a productive life cycle. (For a review see Muzyczka et al., Curr. Topics in Micro and Immunol. 158:97-129 (1992); see also Domenger and Grimm, Human Molecular Genetics, 28(R1):R3-R14 (October 2019)). AAV vectors efficiently transduce various cell types and can produce long-term expression of transgenes in vivo. Although AAV vector genomes can persist within cells as episomes, vector integration has been observed (see for example Deyle and Russell, Curr Opin Mol Ther. 2009 August; 11(4): 442-447; Asokan et al., Mol Ther. 2012 April; 20(4): 699-708; Flotte et al., Am. J. Respir. Cell. Mol. Biol. 7:349-356 (1992); Samulski et al., J. Virol. 63:3822-3828 (1989); and McLaughlin et al., J. Virol. 62:1963-1973 (1989)). AAV vectors, particularly AAV2, have been extensively used for gene augmentation or replacement and have shown therapeutic efficacy in a range of animal models as well as in the clinic; see, e.g., Mingozzi and High, Nature Reviews Genetics 12, 341-355 (2011); Deyle and Russell, Curr Opin Mol Ther. 2009 August; 11(4): 442-447; Asokan et al., Mol Ther. 2012 April; 20(4): 699-708. AAV vectors containing as little as 300 base pairs of AAV can be packaged and can produce recombinant protein expression. Space for exogenous DNA is limited to about 4.5 kb.
[0054] A variety of nucleic acids have been introduced into different cell types using AAV vectors (see for example the references cited above and those cited in Asokan et al., Molecular Therapy (2012); 20 4, 699-708; and Hermonat et al., Proc. Natl. Acad. Sci. USA 81:6466-6470 (1984); Tratschin et al., Mol. Cell. Biol. 4:2072-2081 (1985); Wondisford et al., Mol. Endocrinol. 2:32-39 (1988); Tratschin et al., J. Virol. 51:611-619 (1984); and Flotte et al., J. Biol. Chem. 268:3781-3790 (1993); Hammond et al., PLoS One. 2017 Dec. 15; 12(12):e0188830; Haggert et al., Mol Ther Methods Clin Dev. 2019 Nov. 26; 17:69-82. In some embodiments, viral vectors used herein are, or comprise capsid proteins from, adeno-associated virus type 1, 2, 5, 7, 8, 9, rh.10, AAV2/1, AAVDJ8, PHP.B, or Anc80. See, e.g., US PGPub 20190100560; Hammond et al., PLoS One. 2017 Dec. 15; 12(12):e0188830; Haggert et al., Mol Ther Methods Clin Dev. 2019 Nov. 26; 17:69-82; Jackson et al., Frontiers in Molecular Neuroscience (9) (2016); doi.org/10.3389/fnmol.2016.00116; Choi et al., Curr. Gene Ther. 2005; 5: 299-310.
[0055] In some embodiments, a self-complementary AAV is used, which contains an inverted repeat genome that folds to make double-stranded DNA, and wherein the right (3′) Inverted Terminal Repeat (ITR) contains a deletion of the D-sequence (the packaging signal). See, e.g., Hirata and Russell and Russell, J. Virol. (2000) 74:4612-4620; Raj et al., Expert Rev Hematol. 2011 October; 4(5): 539-549; US 20170362608; McCarty et al., Gene Therapy. 8 (16): 1248-54 (2001); McCarty et al., Mol. Ther. 2008; 16: 1648-1656; McCarty et al., Gene Ther. 2003; 10: 2112-2118; US20020006664, US20030153519, US 20030139363; US20040029106; U.S. Pat. Nos. 9,783,824; 6,547,099; 6,506,559; and 4,766,072; PCT Application Nos. WO 2001/92551, WO 2001/68836, and WO 2003/010180.
[0056] Other viruses, e.g., retroviruses or adenovirus-derived vectors, can also be used.
[0057] The vectors preferably include inverted terminal repeats (ITRs); promoters, enhancers (e.g., CMV enhancer), other cis-regulatory elements, and/or capsid serotype variants that control and drive expression of the MCOLN1 protein. With regard to promoters, vectors can include promoters that drive expression in many cell types (e.g., human β-actin, human elongation factor-1α, chicken β-actin combined with cytomegalovirus early enhancer, cytomegalovirus (CMV), simian virus 40 (SC40), herpes simplex virus thymidine kinase (HSVTK), JeT (US20020098547), PGK, CAG, sCAG, or CASI) or specifically in neurons (e.g., synapsin I (Syn1), calcium/calmodulin-dependent protein kinase II, tubulin alpha I, neuron-specific enolase and platelet-derived growth factor beta chain promoters, and hybrid promoters created by fusing cytomegalovirus enhancer (E) to those neuron-specific promoters (Hioki et al., Gene Therapy 14:872-882 (2007)). Other cis-regulatory elements can include posttranscriptional regulatory elements; 2A enhancers; polyadenylation sequences; and/or an intron. Posttranscriptional regulatory elements can include HBV Posttranscriptional Regulatory Element (HPRE), woodchuck hepatitis virus post-transcriptional regulatory element (WPRE) or variants thereof (e.g., WPRE2, WPRE3 see, e.g., Kalev-Zylinska M L, During MJJ Neurosci. 2007 Sep. 26; 27(39):10456-67; Zanta-Boussif et al., Gene Therapy (16): 605-619 (2009); Choi et al., Mol Brain. 7:17 (2014); U.S. Pat. No. 6,136,597). One or more 2A sequences can be used, e.g., 18-22 aa-long peptides that share a core sequence motif of DxExNPGP (SEQ ID NO:3) and induce ribosomal skipping during translation of a protein in a cell. Exemplary polyadenylation sequences, which include SV40, human growth hormone (hGH), bovine growth hormone (bGH), synthetic polyadenylation (spA), and rbGlob, preferably include the sequence motif AAUAAA that promotes both polyadenylation and termination (Buck and Wijnholds, Int J Mol Sci. 2020 June; 21(12): 4197). Commonly used 2A sequences include P2A, E2A, F2A and T2A. F2A is derived from foot-and-mouth disease virus 18; E2A is derived from equine rhinitis A virus; P2A is derived from porcine teschovirus-1 2A; T2A is derived from thosea asigna virus 2A. See, e.g., Lewis et al., J Neurosci Methods. 2015 Dec. 30; 256: 22-29; Liu et al., Sci Rep. 2017 May 19; 7(1):2193. In some embodiments, the AAV also includes a furin cleavage sequence (see Fang et al., Nat Biotechnol 23: 584-590). Introns can include SV40 intron, F.IX truncated intron 1; β-globin SD/immunoglobin heavy chain SA; Adenovirus SD/immunoglobulin SA; SV40 late SD/SA (19S/16S); Hybrid adenovirus SD/IgG SA; or minute virus of mice (MVM) intron (see Powell and Rivera-Soto, Discov Med. 2015 January; 19(102): 49-57. Capsid variants can include PHP.B and those described in Castle et al., Methods Mol. Biol. 2016; 1382: 133-149; Davidsson et al., PNAS. 116 (52) 27053-27062 (2019); Lee et al., Current Opinion in Biomedical Engineering (7):58-63 (2018). In some embodiments, the AAV includes a cell penetrating peptide (CPP); see Liu et al., Mol Ther Methods Clin Dev. 2014; 1: 12; Tan et al., Nature Communications 10:3733 (2019). For additional disclosure regarding viral vectors, see also Li and Samulski, Nature Reviews Genetics 21:255-272 (2020); Nair et al., iScience. 2020 Mar. 27; 23(3):100888; Haery et al., Front Neuroanat. 2019; 13: 93; Domenger and Grimm, Human Molecular Genetics, 28(R1):R3-R14 (October 2019); and WO/2019/200286, and references cited therein.
[0058] Exemplary vectors are shown in
[0059] Also provided herein are compositions and formulations comprising the vectors, e.g., in a sterile carrier. Formulation of pharmaceutically-acceptable excipients and carrier solutions is well-known to those of skill in the art. As used herein, “carrier” includes any and all solvents, dispersion media, vehicles, coatings, diluents, antibacterial and antifungal agents, isotonic and absorption delaying agents, buffers, carrier solutions, suspensions, colloids, and the like. The use of such media and agents for pharmaceutical active substances is well known in the art. Supplementary active ingredients can also be incorporated into the compositions. The phrase “pharmaceutically-acceptable” refers to molecular entities and compositions that do not produce an allergic or similar untoward reaction when administered to a host.
[0060] Delivery vehicles such as liposomes, nanocapsules, microparticles, microspheres, lipid particles, vesicles, and the like, may be used for the introduction of the compositions of the present disclosure into suitable host cells. In particular, the AAV can be formulated for delivery encapsulated in a lipid particle, a liposome, a vesicle, a nanosphere, or a nanoparticle (e.g., conjugated to a nanoparticle) or the like.
[0061] Also provided herein are methods of making the AAV, as well as host cells comprising the AAV. Methods for obtaining recombinant AAVs having a desired capsid protein are well known in the art. (See, e.g., US 2003/0138772 and WO 2019/200286, the contents of which are incorporated herein by reference in their entirety). Typically the methods involve culturing a host cell which contains a nucleic acid sequence encoding an AAV capsid protein; a functional rep gene; a recombinant AAV vector composed of AAV inverted terminal repeats (ITRs) and a transgene; and sufficient helper functions to permit packaging of the recombinant AAV vector into the AAV capsid proteins.
EXAMPLES
[0062] The invention is further described in the following examples, which do not limit the scope of the invention described in the claims.
[0063] Materials and Methods
[0064] The following materials and methods were used in the Examples below.
[0065] Animals
[0066] Mcoln1.sup.−/− mice were maintained and genotyped as previously described (1). The Mcoln1.sup.−/− breeders for this study were obtained by backcrossing onto a C57Bl6J background for more than 10 generations. Experimental cohorts were obtained from either Mcoln1.sup.+/−×Mcoln1.sup.+/− or Mcoln1.sup.+/−×Mcoln1.sup.−/− mating. Mcoln1.sup.+/− littermates were used as controls. Experiments were performed according to the Institutional and National Institutes of Health guidelines and approved by the Massachusetts General Hospital Institutional Animal Care and Use Committee. Animals were assigned to the experimental groups in a random order and handling and testing was performed by investigator blinded to treatment group info.
[0067] Constructs
[0068] Three plasmids were used for MCOLN1 expression: pAAVss-CMV-MCOLN1-FF2A-eGFP, pAAVsc-JeT-MCOLN1 and pAAVsc-SYN1-MCOLN1. The expression vectors were obtained from Dr. Vandenberghe's lab at MEEI. pAAVss-CMV-MCOLN1-FF2A-eGFP had a bGH polyA, and a human MCOLN1 cDNA was synthesized and subcloned (ncbi.nlm.nih.gov/gene/57192). To produce pAAVsc-JeT-MCOLN1 and pAAVsc-SYN1-MCOLN1 we used the original pAAV SC.CMV.EGFP.BGH vector, where the CMV-eGFP-bGHpolyA expression cassette was replaced by human MCOLN1 cDNA with short synthetic polyA (2) and either minimal synthetic JeT (3) or human SYN1 (4) promoters.
[0069] Virus Preparation
[0070] AAV-PHP.B-CMV-MCOLN1-FF2A-eGFP (referred to as PHP.b-MCOLN1 in the text) and scAAV9-JeT MCOLN1 and scAAV9-SYN1-MCOLN1 viral stocks were prepared at the Gene Transfer Vector Core (vector.meei.harvard.edu) at Massachusetts Eye and Ear Infirmary. AAV preparations were produced by triple-plasmid transfection as described previously (5). Near-confluent monolayers of HEK293 cells were used to perform large scale polyethylenimine transfections of AAVcis, AAVtrans, and adenovirus helper plasmid in a ten-layer hyperflask (Corning, Corning, N.Y.). Downstream purification process, titration and evaluation of purity was performed as described previously (Lock, 2010).
[0071] ICV Injections
[0072] The viral solution was diluted in sterile saline (0.9% NaCl) with 0.05% trypan blue. Each pup was injected with a maximal injection volume of 5 ul via a 10 ul Hamilton syringe (Hamilton Company, Reno, Nev.) with a 30G needle. Pups were anesthetized on ice for 5 min until loss of pedal withdrawal reflex. The pup was then placed on a fiber optic light source to illuminate ventricles for injection. The injection site was marked with non-toxic laboratory pen about 0.25 mm lateral to sagittal suture and 0.50-0.75 mm rostral to neonatal coronary suture (0.25 mm lateral to confluence of sinuses). Pups were injected with either saline, scAAV9-JeT-MCOLN1 at a dose of 2×10.sup.10 vg/mouse, 1×10.sup.10 vg/mouse or 0.4×10.sup.10 vg/mouse or scAAV9-JeT-MCOLNJ at a dose of 2×10.sup.10 vg/mouse. After, injection the pup was placed under a warming lamp and monitored for 5-10 min for recovery until movement and responsiveness was fully restored.
[0073] IV Injections
[0074] Mice were restrained in a plexiglass restrainer. The tail veins were dilated in warm water for 1 minute. 30G-needle insulin syringes (Cat. No 328466,BD, San Diego, Calif.) were used with total injection volume of 70-100 ul per mouse. Mice were injected with either saline, AAV-PHP.b-CMV-MCOLN1 at a dose of 1×10.sup.12 vg/mouse or scAAV9-JeT-MCOLN1 at a dose of 5×10.sup.11 vg/mouse.
[0075] Behavioral Testing
[0076] Open field testing was performed on naive male and female mice at either two or four months of age under regular light conditions. Each mouse was placed in the center of a 27×27 cm2 Plexiglas arena, and the horizontal and vertical activity were recorded by the Activity Monitor program (Med Associates Fairfax, Vt.). Data were analyzed during the first 15 minutes in the arena. Zone analysis was performed to measure movements/time spent in the central (8×8 cm.sup.2) versus peripheral (residual) zone of the arena. Statistical significance was determined using an unpaired T-test.
[0077] Motor coordination and balance was tested in on an accelerating rotarod (Med Associates, VT). Latency to fall from the rotating rod was recorded in 3 trials per day (accelerating speed from 4 to 40 rpm over 5 min) during 2 days of testing. To follow the progression of motor decline, performance of mice was tested monthly starting at 4 months until the motor dysfunction in Mcoln1.sup.−/− mice made it impossible to perform the task. Cox-regression and log-rank analysis was used to determine probability of falling from the rod.
[0078] RNA Extraction and qPCR Analysis
[0079] Mouse tissues were disrupted and homogenized using QIAzol lysis reagent (Qiagen, Hilden, Germany) and the Tissue Lyser instrument (Qiagen, Hilden, Germany). 30 mg of snap frozen tissues were processed adding 1 ml of QIAzol reagent in presence of one 5 mm stainless steel bead (Qiagen, Hilden, Germany). Total RNA isolation from homogenized tissues was performed using Qiagen RNeasy kit (Qiagen, Hilden, Germany) and genomic DNA was eliminated performing DNase (Qiagen, Hilden, Germany) digestion on columns following procedures indicated by the provider. cDNA was generated using High-Capacity cDNA Reverse Transcription kit (Applied Biosystems, Foster City, Calif.) according to manual instruction. cDNA produced from 500 ng of starting RNA was diluted and 40 ng were used to perform qPCR using LightCycler 480 Probes Master mix (Roche Diagnostics, Mannheim, Germany). The real-time PCR reaction was run on LightCycler 480 (Roche Diagnostics, Mannheim, Germany) using TaqMan premade gene expression assays (Applied Biosystems, Foster City, Calif.). Mus musculus: GAPDH (FAM)-Mm99999915_g1, MBP, (FAM)-Mm01266402_m1, GFAP (FAM)-Mm01253033_m1, CD68 (FAM)-Mm03047343_m1; Homo Sapiens Mucolipin-1 (FAM)-Hs01100653_m1. The ΔΔCt method was used to calculate relative gene expression, where Ct corresponds to the cycle threshold. ΔCt values were calculated as the difference between Ct values from the target gene and the housekeeping gene GAPDH.
[0080] Tissue Collection and Processing
[0081] Mice were sacrificed using a carbon dioxide chamber. Immediately after euthanasia, mice were transcardially perfused with ice-cold phosphate buffered saline (PBS). After bisecting the brain across the midline, half was used to isolate cerebellum and cortex. The other half was post-fixed in 4% paraformaldehyde in PBS for 48 h, washed with PBS, cryoprotected in 30% sucrose in PBS for 24 h, frozen in isopentane and stored at −80° C. In addition to brain tissue, liver, muscle and sciatic nerve tissue were collected and snap-frozen over dry ice before storage at −80° C.
[0082] Immunohistochemistry, Imaging, and Analysis
[0083] For histological analysis, 40 μm coronal sections were cut using a cryostat (Leica Microsystems, Wetzlar, Germany) and collected into 96 well plates containing cryoprotectant (TBS, 30% ethylene glycol, 15% sucrose). These sections were stored at 4° C. prior or frozen at −80° C. Prior to staining for LAMP1 and Myelin Basic Protein (MBP), samples were randomized and coded to create blinded conditions for analysis. Staining of free-floating sections was done in a 96 well plate. Sections were blocked in 0.1% Triton X-100, 10% normal horse serum (NHS), 2% bovine serum albumin (BSA), and 1% glycine in PBS and incubated with primary antibodies diluted in antibody buffer: 10% NHS and 2% BSA overnight. The following primary antibodies were used: a-LAMP1 antibody (Rat 1:1000, BD San Diego, Calif., Cat ID: 553792); MBP (Mouse, 1:1000, Millipore Sigma, Jaffrey, NH, NE1019). Sections were washed in PBS-Tween (0.05%) at room temperature then incubated with secondary antibodies in antibody buffers for 1 hour at room temperature. The following secondary antibodies were used: goat-anti-rat AlexaFluor 546 (1:500; Invitrogen, Eugene, OR), goat-anti-mouse AlexaFluor 555 (1:500; Invitrogen, Eugene, Oreg.). Sections were counterstained with NucBlue nuclear stain (Life Technologies, Eugene, Oreg.). After staining, sections were mounted onto glass SuperFrost plus slides (Fisher Scientific, Pittsburgh, Pa.) with Immu-Mount (Fisher Scientific, Pittsburgh, Pa.).
[0084] Images were acquired on DM8i Leica Inverted Epifluorescence Microscope with Adaptive Focus (Leica Microsystems, Buffalo Grove, Ill.) with Hamamatsu Flash 4.0 camera and advanced acquisition software package MetaMorph 4.2 (Molecular Devices, LLC, San Jose, Calif.) using an automated stitching function. The exposure time was kept constant for all sections within the same IHC experiment. Image analysis was performed using Fiji software (NIH, Bethesda, Md.). For corpus callosum area measurements areas of interest were selected on MBP images in each section and normalized to the whole section area. For LAMP1 images particle analysis and % of area measurements were made after same thresholding settings were allied to all images. All images were decoded after the measurements were taken. Area and mean pixel intensity values were averaged per genotype/treatment group and compared between genotypes using unpaired T-test.
[0085] Statistical Analysis
[0086] Data presented as mean values and SEM or median values and interquartile range. Statistical analysis was performed in GraphPad Prism 7.04 software (GraphPad, La Jolla, Calif.) using either unpaired T-test, two-way ANOVA or log-rank as tests detailed in specific subsections of Methods. P values were indicated as follows throughout the manuscript: n.s.=p<0.05; * p=<0.05; ** p=<0.01, *** p=<0.001,**** p=<0.0001.
[0087] Exemplary Viral Sequences:
TABLE-US-00004 >pAAV SC.JeT.Mcoln.pA (5158 bp) (SEQ ID NO: 4) CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGGGCGACCTT TGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGTTAAGCTAGCGA ATTCGGGCGGAGTTAGGGCGGAGCCAATCAGCGTGCGCCGTTCCGAAAGTTGCCTTTTA TGGCTGGGCGGAGAATGGGCGGTGAACGCCGATGATTATATAAGGACGCGCCGGGTGTG GCACAGCTAGTTCCGTCGCAGCCGGGATTTGGGTCGCGGTTCTTGTTTGTGGATCCCTG TGATCGTCACTTGACAGTGTCCAGGCGGCCGCCACCATGACAGCCCCGGCGGGTCCGCG CGGCTCAGAGACCGAGCGGCTTCTGACCCCCAACCCCGGGTATGGGACCCAGGCGGGGC CTTCACCGGCCCCTCCGACACCCCCAGAAGAGGAAGACCTTCGCCGTCGTCTCAAATAC TTTTTCATGAGTCCCTGCGACAAGTTTCGAGCCAAGGGCCGCAAGCCCTGCAAGCTGAT GCTGCAAGTGGTCAAGATCCTGGTGGTCACGGTGCAGCTCATCCTGTTTGGGCTCAGTA ATCAGCTGGCTGTGACATTCCGGGAAGAGAACACCATCGCCTTCCGACACCTCTTCCTG CTGGGCTACTCGGACGGAGCGGATGACACCTTCGCAGCCTACACGCGGGAGCAGCTGTA CCAGGCCATCTTCCATGCTGTGGACCAGTACCTGGCGTTGCCTGACGTGTCACTGGGCC GGTATGCGTATGTCCGTGGTGGGGGTGACCCTTGGACCAATGGCTCAGGGCTTGCTCTC TGCCAGCGGTACTACCACCGAGGCCACGTGGACCCGGCCAACGACACATTTGACATTGA TCCGATGGTGGTTACTGACTGCATCCAGGTGGATCCCCCCGAGCGGCCCCCTCCGCCCC CCAGCGACGATCTCACCCTCTTGGAAAGCAGCTCCAGTTACAAGAACCTCACGCTCAAA TTCCACAAGCTGGTCAATGTCACCATCCACTTCCGGCTGAAGACCATTAACCTCCAGAG CCTCATCAATAATGAGATCCCGGACTGCTATACCTTCAGCGTCCTGATCACGTTTGACA ACAAAGCACACAGTGGGCGGATCCCCATCAGCCTGGAGACCCAGGCCCACATCCAGGAG TGTAAGCACCCCAGTGTCTTCCAGCACGGAGACAACAGCTTCCGGCTCCTGTTTGACGT GGTGGTCATCCTCACCTGCTCCCTGTCCTTCCTCCTCTGCGCCCGCTCACTCCTTCGAG GCTTCCTGCTGCAGAACGAGTTTGTGGGGTTCATGTGGCGGCAGCGGGGACGGGTCATC AGCCTGTGGGAGCGGCTGGAATTTGTCAATGGCTGGTACATCCTGCTCGTCACCAGCGA TGTGCTCACCATCTCGGGCACCATCATGAAGATCGGCATCGAGGCCAAGAACTTGGCGA GCTACGACGTCTGCAGCATCCTCCTGGGCACCTCGACGCTGCTGGTGTGGGTGGGCGTG ATCCGCTACCTGACCTTCTTCCACAACTACAATATCCTCATCGCCACACTGCGGGTGGC CCTGCCCAGCGTCATGCGCTTCTGCTGCTGCGTGGCTGTCATCTACCTGGGCTACTGCT TCTGTGGCTGGATCGTGCTGGGGCCCTATCATGTGAAGTTCCGCTCACTCTCCATGGTG TCTGAGTGCCTGTTCTCGCTCATCAATGGGGACGACATGTTTGTGACGTTCGCCGCCAT GCAGGCGCAGCAGGGCCGCAGCAGCCTGGTGTGGCTCTTCTCCCAGCTCTACCTTTACT CCTTCATCAGCCTCTTCATCTACATGGTGCTCAGCCTCTTCATCGCGCTCATCACCGGC GCCTACGACACCATCAAGCATCCCGGCGGCGCAGGCGCAGAGGAGAGCGAGCTGCAGGC CTACATCGCACAGTGCCAGGACAGCCCCACCTCCGGCAAGTTCCGCCGCGGGAGCGGCT CGGCCTGCAGCCTTCTCTGCTGCTGCGGAAGGGACCCCTCGGAGGAGCATTCGCTGCTG GTGAATTAATAAGCTTAATAAAAGATCTTTATTTTCATTAGATCTGTGTGTTGGTTTTT TGTGTGCTCGAGTTAAGGGCGAATTCCCGATAAGGATCTTCCTAGAGCATGGCTACGTA GATAAGTAGCATGGCGGGTTAATCATTAACTACAAGGAACCCCTAGTGATGGAGTTGGC CACTCCCTCTCTGCGCGCTCGCTCGCTCACTGAGGCCGGGCGACCAAAGGTCGCCCGAC GCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGAGCGCGCAGCCTTAATTAACCT AATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACT TAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCA CCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGGACGCGCCCTGTAGC GGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTGACCGCTACACTTGCCAG CGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCTCGCCACGTTCGCCGGCT TTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCCGATTTAGTGCTTTACGG CACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGTAGTGGGCCATCGCCCTG ATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTTTAATAGTGGACTCTTGT TCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTTTTGATTTATAAGGGATT TTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTAACAAAAATTTAACGCGAA TTTTAACAAAATATTAACGTTTATAATTTCAGGTGGCATCTTTCGGGGAAATGTGCGCG GAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTCATGAGACAA TAACCCTGATAAATGOTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTT CCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAG AAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATC GAACTGGATCTCAATAGTGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCC AATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTATTGACGCCG GGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCA CCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGC CATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCGA AGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGG GAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGTAGT AATGGTAACAACGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGC AACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCC CTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGG TATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGA CGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCA CTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTT AAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGA CCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATC AAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAA ACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGA AGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAG TTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCT GTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGAC GATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCC AGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCTATGAGAAAG CGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAA CAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTGTC GGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAG CCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGCGGTT TTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCC TTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAG CGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTC ATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCA ATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGC TCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCTATGACC ATGATTACGCCAGATTTAATTAAGG >pAAV SC.hSyn1.Mcoln.pA (5411 bp) (SEQ ID NO: 5) CTGCGCGCTCGCTCGCTCACTGAGGCCGCCCGGGCAAAGCCCGGGCGTCGGGCGACCTT TGGTCGCCCGGCCTCAGTGAGCGAGCGAGCGCGCAGAGAGGGAGTGGTTAAGCTAGCAG TGCAAGTGGGTTTTAGGACCAGGATGAGGCGGGGTGGGGGTGCCTACCTGACGACCGAC CCCGACCCACTGGACAAGCACCCAACCCCCATTCCCCAAATTGCGCATCCCCTATCAGA GAGGGGGAGGGGAAACAGGATGCGGCGAGGCGCGTGCGCACTGCCAGCTTCAGCACCGC GGACAGTGCCTTCGCCCCCGCCTGGCGGCGCGCGCCACCGCCGCCTCAGCACTGAAGGC GCGCTGACGTCACTCGCCGGTCCCCCGCAAACTCCCCTTCCCGGCCACCTTGGTCGCGT CCGCGCCGCCGCCGGCCCAGCCGGACCGCACCACGCGAGGCGCGAGATAGGGGGGCACG GGCGCGACCATCTGCGCTGCGGCGCCGGCGACTCAGCGCTGCCTCAGTCTGCGGTGGGC AGCGGAGGAGTCGTGTCGTGCCTGAGAGCGCAGGTGTCCAGGCGGCCGCCACCATGACA GCCCCGGCGGGTCCGCGCGGCTCAGAGACCGAGCGGCTTCTGACCCCCAACCCCGGGTA TGGGACCCAGGCGGGGCCTTCACCGGCCCCTCCGACACCCCCAGAAGAGGAAGACCTTC GCCGTCGTCTCAAATACTTTTTCATGAGTCCCTGCGACAAGTTTCGAGCCAAGGGCCGC AAGCCCTGCAAGCTGATGCTGCAAGTGGTCAAGATCCTGGTGGTCACGGTGCAGCTCAT CCTGTTTGGGCTCAGTAATCAGCTGGCTGTGACATTCCGGGAAGAGAACACCATCGCCT TCCGACACCTCTTCCTGCTGGGCTACTCGGACGGAGCGGATGACACCTTCGCAGCCTAC ACGCGGGAGCAGCTGTACCAGGCCATCTTCCATGCTGTGGACCAGTACCTGGCGTTGCC TGACGTGTCACTGGGCCGGTATGCGTATGTCCGTGGTGGGGGTGACCCTTGGACCAATG GCTCAGGGCTTGCTCTCTGCCAGCGGTACTACCACCGAGGCCACGTGGACCCGGCCAAC GACACATTTGACATTGATCCGATGGTGGTTACTGACTGCATCCAGGTGGATCCCCCCGA GCGGCCCCCTCCGCCCCCCAGCGACGATCTCACCCTCTTGGAAAGCAGCTCCAGTTACA AGAACCTCACGCTCAAATTCCACAAGCTGGTCAATGTCACCATCCACTTCCGGCTGAAG ACCATTAACCTCCAGAGCCTCATCAATAATGAGATCCCGGACTGCTATACCTTCAGCGT CCTGATCACGTTTGACAACAAAGCACACAGTGGGCGGATCCCCATCAGCCTGGAGACCC AGGCCCACATCCAGGAGTGTAAGCACCCCAGTGTCTTCCAGCACGGAGACAACAGCTTC CGGCTCCTGTTTGACGTGGTGGTCATCCTCACCTGCTCCCTGTCCTTCCTCCTCTGCGC CCGCTCACTCCTTCGAGGCTTCCTGCTGCAGAACGAGTTTGTGGGGTTCATGTGGCGGC AGCGGGGACGGGTCATCAGCCTGTGGGAGCGGCTGGAATTTGTCAATGGCTGGTACATC CTGCTCGTCACCAGCGATGTGCTCACCATCTCGGGCACCATCATGAAGATCGGCATCGA GGCCAAGAACTTGGCGAGCTACGACGTCTGCAGCATCCTCCTGGGCACCTCGACGCTGC TGGTGTGGGTGGGCGTGATCCGCTACCTGACCTTCTTCCACAACTACAATATCCTCATC GCCACACTGCGGGTGGCCCTGCCCAGCGTCATGCGCTTCTGCTGCTGCGTGGCTGTCAT CTACCTGGGCTACTGCTTCTGTGGCTGGATCGTGCTGGGGCCCTATCATGTGAAGTTCC GCTCACTCTCCATGGTGTCTGAGTGCCTGTTCTCGCTCATCAATGGGGACGACATGTTT GTGACGTTCGCCGCCATGCAGGCGCAGCAGGGCCGCAGCAGCCTGGTGTGGCTCTTCTC CCAGCTCTACCTTTACTCCTTCATCAGCCTCTTCATCTACATGGTGCTCAGCCTCTTCA TCGCGCTCATCACCGGCGCCTACGACACCATCAAGCATCCCGGCGGCGCAGGCGCAGAG GAGAGCGAGCTGCAGGCCTACATCGCACAGTGCCAGGACAGCCCCACCTCCGGCAAGTT CCGCCGCGGGAGCGGCTCGGCCTGCAGCCTTCTCTGCTGCTGCGGAAGGGACCCCTCGG AGGAGCATTCGCTGCTGGTGAATTAATAAGCTTAATAAAAGATCTTTATTTTCATTAGA TCTGTGTGTTGGTTTTTTGTGTGCTCGAGTTAAGGGCGAATTCCCGATAAGGATCTTCC TAGAGCATGGCTACGTAGATAAGTAGCATGGCGGGTTAATCATTAACTACAAGGAACCC CTAGTGATGGAGTTGGCCACTCCCTCTCTGCGCGCTCGCTCGCTCACTGAGGCCGGGCG ACCAAAGGTCGCCCGACGCCCGGGCTTTGCCCGGGCGGCCTCAGTGAGCGAGCGAGCGC GCAGCCTTAATTAACCTAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAAC CCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAA TAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAAT GGGACGCGCCCTGTAGCGGCGCATTAAGCGCGGCGGGTGTGGTGGTTACGCGCAGCGTG ACCGCTACACTTGCCAGCGCCCTAGCGCCCGCTCCTTTCGCTTTCTTCCCTTCCTTTCT CGCCACGTTCGCCGGCTTTCCCCGTCAAGCTCTAAATCGGGGGCTCCCTTTAGGGTTCC GATTTAGTGCTTTACGGCACCTCGACCCCAAAAAACTTGATTAGGGTGATGGTTCACGT AGTGGGCCATCGCCCTGATAGACGGTTTTTCGCCCTTTGACGTTGGAGTCCACGTTCTT TAATAGTGGACTCTTGTTCCAAACTGGAACAACACTCAACCCTATCTCGGTCTATTCTT TTGATTTATAAGGGATTTTGCCGATTTCGGCCTATTGGTTAAAAAATGAGCTGATTTAA CAAAAATTTAACGCGAATTTTAACAAAATATTAACGTTTATAATTTCAGGTGGCATCTT TCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGT ATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGT ATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCC TGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTG CACGAGTGGGTTACATCGAACTGGATCTCAATAGTGGTAAGATCCTTGAGAGTTTTCGC CCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATT ATCCCGTATTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATG ACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAGTAAGA GAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGAC AACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAA CTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGAC ACCACGATGCCTGTAGTAATGGTAACAACGTTGCGCAAACTATTAACTGGCGAACTACT TACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGAC CACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGT GAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTAT CGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCG CTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATAT ATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCT TTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAG ACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGC TGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCT ACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCC TTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATAC CTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTAC CGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGG GTTCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAG CGTGAGCTATGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGT AAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGT ATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGC TCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCT GGCCTTTTGCTGCGGTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGG ATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAG CGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCC CGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGG GCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTA CACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACAC AGGAAACAGCTATGACCATGATTACGCCAGATTTAATTAAGG
Example 1. MCOLN1 Gene Transfer in Juvenile Pre-Symptomatic Mcoln1.SUP.−/− Mice Prevents Onset of Motor Deficits
[0088] Mcoln1.sup.−/− mice mimic all the main manifestations of the human mucolipidosis IV disease, including neurologic deficits and brain pathology, gastric pathology and high systemic gastrin, and eye pathology, with exception to corneal clouding (12). The earliest motor deficits appear in the form of reduced vertical activity in the open field test at the age of two months (
[0089] Here, we aimed to test whether CNS-targeted transfer of the human MCOLN1 gene in the juvenile KO mice prior to the first measurable symptom onset at the age of 5-6 weeks will be able to prevent motor deficits at the age of two months. We administered Mcoln1.sup.−/− and control Mcoln1.sup.−/− male mice either saline or AAV-PHP.b-CMV-MCOLN1-F[urin]F2a-eGFP (a.k.a PHP.b-MCOLN1) intravenously at the age of 5-6 weeks after they reached a body mass of 19 g. Four weeks after injections, at the age of 2 months, mice were tested in the open field arena and euthanized for tissue collection (Table 1). The open field test showed complete prevention of vertical activity decline in the PHP.b-MCOLN1-treated Mcoln1.sup.−/− mice (
[0090] The major histopathological hallmarks of MLIV in the Mcoln1.sup.−/− mouse brain at the age of two months are reduced brain myelination, microgliosis and astrocytosis (1, 7-9). Despite the observed strong effect of the MCOLN1 gene transfer on motor function in this cohort (
TABLE-US-00005 TABLE 1 All vector and trial summary. Route of Age at Age at Cohort Treatment group N administration Dose treatment takedown 1 WT-SALINE 9 IV 1e12 5-6 weeks 9-10 weeks HET-SALINE 18 vg/mouse (pre- KO-SALINE 9 symptomatic) KO-AAV-PHP.b- 14 MCOLN1 2 HET-SALINE 15 IV 1e12 2 months 11 months KO-SALINE 12 vg/mouse (symptomatic) untreated KO-AAV-PHP.b- 9 KO) MCOLN1 (around 7 months for 3 HET-SALINE 20 ICV P1 (neonatal) 9-10 weeks KO-SALINE 10 KO-scAAV9-JeT- 7 2e10 MCOLN1 vg/mouse KO-scAAV9-JeT- 16 1e10 MCOLN1 vg/mouse KO-scAAV9-JeT- 10 4e9 MCOLN1 vg/mouse KO-scAAV9- 10 2e10 SYN1-MCOLN1 vg/mouse 4 HET- SALINE 16 IV 5e11 2 months 7 months KO-SALINE 10 vg/mouse (symptomatic) KO-scAAV9-JeT- 9 MCOLN1
Example 2. MCOLN1 Gene Transfer in Symptomatic Mcoln1.SUP.−/− Mice Restores Motor Function and Delays Onset of Paralysis
[0091] In all MLIV patients, except for a few milder cases with some residual activity of mucolipin-1, motor deficits manifest very early during the first few months of life. Taking this into account, rescue of the existing motor deficits rather than delay of motor dysfunction onset may be a desirable outcome in a future MLIV clinical trial. To more closely mimic clinical trial design, we set out to test whether administration of the same vector after symptom onset will be able to restore normal motor function. In this experiment Mcoln1.sup.−/− and control Mcoln1.sup.+/− male mice were intravenously administered either saline or PHP.b-MCOLN1 at the age of two months (Table 1). Motor function was assessed in the open field test once at the age of 4 months. After that, mice were tested in the rotarod test monthly until the completion of the trial. Open field tests revealed significant rescue of vertical activity in the PHP.b-MCOLN1-treated Mcoln1.sup.−/− mice in the central zone of the arena (
[0092] qPCR analysis showed high long-term (tissues were collected 9 months after vector administration) human MCOLN1 transgene expression in the brain tissue, more specifically, in the cerebral cortex and cerebellum, and in peripheral organs, such as liver and muscle. Interestingly, we also saw high MCOLN1 transgene expression in the sciatic nerves, indicating transduction of the PNS (
[0093] Administration of the PHP.b-MCOLN1 vector to Mcoln1.sup.−/− mice at two months of age resulted in partial but statistically significant rescue of brain myelination marker Mbp in the cerebral cortex demonstrating for the first time that myelination deficits in MLIV can be rescued even after the developmental course of brain myelination is completed.
[0094] Notably, despite robust rescue of the motor function and high expression in the brain tissue, we observed no changes in the expression of the astrocytosis and microgliosis markers, Gfap and Cd68, in the cerebral cortex of PHP.b-MCOLN1-treated vs. saline-treated Mcoln1.sup.−/− mice (
Example 3. Intracerebroventricular Administration of Self-Complementary AAV9-JeT-MCOLN1 is Efficacious in the Mcoln1.SUP.−/− Mouse Model of MLIV
[0095] While AAV-PHP.b shows high brain transduction with systemic administration, its ability to penetrate the blood-brain barrier is species-specific with the highest transduction rate in the C57Bl6 mice and a very low brain transduction in non-human primates (NHP) (10, 11). Therefore, we designed an MCOLN1 expression vector suitable for gene transfer in humans based on the clinically proven self-complimentary AAV9 vector (12-14). To drive expression of MCOLN1 we selected a minimal synthetic promoter JeT, which is currently being used in a clinical trial of GAN gene transfer for giant axonal neuropathy (3, 12). For the most efficient and broad targeting of the CNS with scAAV9, we performed intracerebroventicular (ICV) injections in newborn mice at postnatal day 1. Three doses of the vector, 2×10.sup.10, 1×10.sup.10, and 4×10.sup.9 vg/mouse, were used. At birth, litters were randomly assigned to treatment with either saline or one of the three doses of the scAAV9-JeT-MCOLN1 vector. Injected mice were weaned and genotyped according to the standard procedure and subjected to open-field testing at the age of two months followed by euthanasia for tissue collection. qRT-PCR analysis revealed dose-dependent expression of the MCOLN1 transgene in the brain and peripheral tissues, with the highest overexpression in the cerebral cortex (
Example 4. Neuron-Specific Expression of hMCOLN1 is Sufficient to Rescue Early Motor Dysfunction in MLIV Mice
[0096] Neonatal intracerebroventricular delivery of scAAV9 vectors results in the widespread transduction of neurons and occasionally some glial cells in the mouse brain (15, 16) but also leads to transduction of peripheral organs, as shown by us (
Example 5. MCOLN1 Gene Transfer to Peripheral Organs Failed to Rescue Disease in Mcoln1.SUP.−/− Mice
[0097] While MLIV most deleteriously affects CNS, endogenous MCOLN1 is expressed ubiquitously, and the pathological manifestations of its loss have been reported in peripheral organs, such as muscles, peripheral nerves and stomach (6, 7, 18-20). We next tested whether systemic administration of scAAV9-JeT-MCOLN1 in young adult symptomatic mice would have a therapeutic effect in Mcoln1.sup.−/− mice. In this experiment Mcoln1.sup.−/− and control Mcoln1.sup.+/− mice were intravenously administered either saline or the scAAV9-JeT-MCOLN1 vector at the age of two months (Table 1). Motor function was assessed in the open field test once at the age of 4 months followed by rotarod testing monthly until the completion of the trial. The qRT-PCR analysis of MCOLN1 transgene expression showed very low expression in the brain and strong expression in peripheral organs such as skeletal muscle and sciatic nerve, with the highest expression values in the liver (
REFERENCES
[0098] 1. Grishchuk Y, Sri S, Rudinskiy N, Ma W, Stember K G, Cottle M W, et al. Behavioral deficits, early gliosis, dysmyelination and synaptic dysfunction in a mouse model of mucolipidosis IV. Acta neuropathologica communications. 2014; 2(1):133. [0099] 2. Levitt N, Briggs D, Gil A, Proudfoot N J. Definition of an efficient synthetic poly(A) site. Genes Dev. 1989; 3(7):1019-25. [0100] 3. Tornoe J, Kusk P, Johansen 1E, Jensen P R. Generation of a synthetic mammalian promoter library by modification of sequences spacing transcription factor binding sites. Gene. 2002; 297(1-2):21-32. [0101] 4. Challis R C, Ravindra Kumar S, Chan K Y, Challis C, Beadle K, Jang M J, et al. Systemic AAV vectors for widespread and targeted gene delivery in rodents. Nat Protoc. 2019; 14(2):379-414. [0102] 5. Zinn E, Pacouret S, Khaychuk V, Turunen H T, Carvalho L S, Andres-Mateos E, et al. In Silico Reconstruction of the Viral Evolutionary Lineage Yields a Potent Gene Therapy Vector. Cell reports. 2015; 12(6):1056-68. [0103] 6. Venugopal B, Browning M F, Curcio-Morelli C, Varro A, Michaud N, Nanthakumar N, et al. Neurologic, gastric, and opthalmologic pathologies in a murine model of mucolipidosis type IV. Am J Hum Genet. 2007; 81(5):1070-83. [0104] 7. Grishchuk Y, Pena K A, Coblentz J, King V E, Humphrey D M, Wang S L, et al. Impaired myelination and reduced brain ferric iron in the mouse model of mucolipidosis IV. Disease models & mechanisms. 2015; 8(12):1591-601. [0105] 8. Mepyans M, Andrzejczuk L, Sosa J, Smith S, Herron S, DeRosa S, et al. Early evidence of delayed oligodendrocyte maturation in the mouse model of mucolipidosis type IV. Disease models & mechanisms. 2020; 13(7). [0106] 9. Weinstock L, Furness A M, Herron S, Smith S S, Sankar S, DeRosa S G, et al. Fingolimod Phosphate Inhibits Astrocyte Inflammatory Activity in Mucolipidosis IV. Hum Mol Genet. 2018. [0107] 10. Hordeaux J, Wang Q, Katz N, Buza E L, Bell P, Wilson J M. The Neurotropic Properties of AAV-PHP.B Are Limited to C57BL/6J Mice. Molecular therapy: the journal of the American Society of Gene Therapy. 2018; 26(3):664-8. [0108] 11. Liguore W A, Domire J S, Button D, Wang Y, Dufour B D, Srinivasan S, et al. AAV-PHP.B Administration Results in a Differential Pattern of CNS Biodistribution in Non-human Primates Compared with Mice. Molecular therapy: the journal of the American Society of Gene Therapy. 2019; 27(11):2018-37. [0109] 12. Bailey R M, Armao D, Nagabhushan Kalburgi S, Gray S J. Development of Intrathecal AAV9 Gene Therapy for Giant Axonal Neuropathy. Mol Ther Methods Clin Dev. 2018; 9:160-71. [0110] 13. Meyer K, Ferraiuolo L, Schmelzer L, Braun L, McGovern V, Likhite S, et al. Improving single injection CSF delivery of AAV9-mediated gene therapy for SMA: a dose-response study in mice and nonhuman primates. Molecular therapy: the journal of the American Society of Gene Therapy. 2015; 23(3):477-87. [0111] 14. Mendell J R, Al-Zaidy S, Shell R, Arnold W D, Rodino-Klapac L R, Prior T W, et al. Single-Dose Gene-Replacement Therapy for Spinal Muscular Atrophy. N Engl J Med. 2017; 377(18): 1713-22. [0112] 15. Jackson K L, Dayton R D, Klein R L. AAV9 supports wide-scale transduction of the CNS and TDP-43 disease modeling in adult rats. Mol Ther Methods Clin Dev. 2015; 2:15036. [0113] 16. Jackson K L, Dayton R D, Deverman B E, Klein R L. Better Targeting, Better Efficiency for Wide-Scale Neuronal Transduction with the Synapsin Promoter and AAV-PHP.B. Front Mol Neurosci. 2016; 9:116. [0114] 17. DeGennaro L J, Kanazir S D, Wallace W C, Lewis R M, Greengard P. Neuron-specific phosphoproteins as models for neuronal gene expression. Cold Spring Harb Symp Quant Biol. 1983; 48 Pt 1:337-45. [0115] 18. Cheng X, Zhang X, Gao Q, Ali Samie M, Azar M, Tsang W L, et al. The intracellular Ca(2)(+) channel MCOLN1 is required for sarcolemma repair to prevent muscular dystrophy. Nat Med. 2014; 20(10):1187-92. [0116] 19. Chandra M, Zhou H, Li Q, Muallem S, Hofmann S L, Soyombo A A. A role for the Ca2+ channel TRPML1 in gastric acid secretion, based on analysis of knockout mice. Gastroenterology. 2011; 140(3):857-67. [0117] 20. Schiffmann R, Dwyer N K, Lubensky I A, Tsokos M, Sutliff V E, Latimer J S, et al. Constitutive achlorhydria in mucolipidosis type IV. Proc Natl Acad Sci USA. 1998; 95(3):1207-12. [0118] 21. Altarescu G., Sun M., Moore D. F., Smith J. A., Wiggs E. A., Solomon B. I., Patronas N. J., Frei K. P., Gupta S., Kaneski C. R. et al. (2002). The neurogenetics of mucolipidosis type IV. Neurology 59, 306-313. [0119] 22. Riedel K. G., Zwaan J., Kenyon K. R., Kolodny E. H., Hanninen L. and Albert D. M. (1985). Ocular abnormalities in mucolipidosis IV. Am. J. Ophthalmol. 99, 125-136. [0120] 23. Smith J. A., Chan C.-C., Goldin E. and Schiffmann R. (2002). Noninvasive diagnosis and ophthalmic features of mucolipidosis type IV. Ophthalmology 109, 588-594. [0121] 24. Wakabayashi K., Gustafson A. M., Sidransky E. and Goldin E. (2011). Mucolipidosis type IV: an update. Mol. Genet. Metab. 104, 206-213. [0122] 25. Chen C C, Keller M, Hess M, Schiffmann R, Urban N, Wolfgardt A, et al. A small molecule restores function to TRPML1 mutant isoforms responsible for mucolipidosis type IV. Nature communications. 2014; 5:4681. [0123] 26. Medina D L, Di Paola S, Peluso I, Armani A, De Stefani D, Venditti R, et al. Lysosomal calcium signalling regulates autophagy through calcineurin and TFEB. Nat Cell Biol. 2015; 17(3):288-99. [0124] 27. Settembre C, Medina D L. TFEB and the CLEAR network. Methods Cell Biol. 2015; 126:45-62. [0125] 28. Zhang X, Cheng X, Yu L, Yang J, Calvo R, Patnaik S, et al. MCOLN1 is a ROS sensor in lysosomes that regulates autophagy. Nature communications. 2016; 7:12109. [0126] 29. Wang W, Gao Q, Yang M, Zhang X, Yu L, Lawas M, et al. Up-regulation of lysosomal TRPML1 channels is essential for lysosomal adaptation to nutrient starvation. Proc Natl Acad Sci USA. 2015; 112(11):E1373-81. [0127] 30. Zhang X, Chen W, Gao Q, Yang J, Yan X, Zhao H, et al. Rapamycin directly activates lysosomal mucolipin TRP channels independent of mTOR. PLoS Biol. 2019; 17(5):e3000252. [0128] 31. Scotto Rosato A, Montefusco S, Soldati C, Di Paola S, Capuozzo A, Monfregola J, et al. TRPML1 links lysosomal calcium to autophagosome biogenesis through the activation of the CaMKKbeta/VPS34 pathway. Nat Commun. 2019; 10(1):5630. [0129] 32. Dong X P, Cheng X, Mills E, Delling M, Wang F, Kurz T, et al. The type IV mucolipidosis-associated protein TRPML1 is an endolysosomal iron release channel. Nature. 2008; 455(7215):992-6.
Other Embodiments
[0130] It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.