Methods for Mass Spectrometry-Based Structure Determination of Biomacromolecules
20190018928 ยท 2019-01-17
Assignee
Inventors
Cpc classification
G16B40/00
PHYSICS
H01J49/0036
ELECTRICITY
G16B40/10
PHYSICS
G16B5/00
PHYSICS
International classification
Abstract
Methods and tools for determining the structure of biomacromolecules such as proteins in a sample using mass spectrometry. More particularly the methods allow determining the presence of a biomacromolecule of an organism in a sample by comparing an observed mass spectrum of the sample with a theoretical fragment ion spectrum comprising theoretical fragment ion masses.
Claims
1. A computer-implemented method for determining the presence of a biomacromolecule of an organism in a sample, said biomacromolecule being a protein or a nucleic acid, the method comprising: obtaining an observed mass spectrum of the sample from mass spectrometry instrumentation, thereby obtaining a set of query peaks; subtracting a mass-charge ratio m/z value of every query peak from theoretical fragment ion masses of a target proteome or genome of said organism obtained by determining theoretical fragment ion spectra comprising theoretical fragment ion masses for the protein or nucleic acid sequences of said target proteome or genome, respectively, to obtain differences; clustering and scoring the resulting differences, thereby obtaining scores representative of the likelyhood of the presence of a specific protein or gene in said sample; and respectively assigning the observed mass spectrum to a protein of said proteome, or to a gene of said genome, based on said scores, thereby identifying the presence of said protein or gene in said sample.
2. The method according to claim 1; wherein the biomacromolecule is a protein.
3. The method according to claim 1; wherein the observed mass spectrum is obtained by tandem mass spectroscopy.
4. The method according to claim 1; wherein said theoretical fragment ion spectra are respectively obtained by: assuming that at least 25% of all possible ions are generated from the protein sequences in said proteome; or assuming that at least 25% of all possible ions are generated from the gene sequences in said genome.
5. The method according to claim 1, further comprising: generating theoretical ion masses for the target proteome or genome and computing error intervals for every fragment ion mass based on an error tolerance of the mass spectrometry instrumentation.
6. The method according to claim 5, further comprising: selecting a theoretical fragment ion spectrum i corresponding to a given protein or chromosome and comparing it to an observed fragment ion spectrum j.
7. The method according to claim 6, further comprising: for every observed fragment mass, selecting a mass value py from the observed fragment ion spectrum j, selecting a mass value mx from the theoretical fragment ion spectrum i, and aligning the observed fragment ion spectrum j to the theoretical fragment ion spectrum j by: computing a mass shift xy=mxpy; and adjusting the observed fragment ion masses by adding xy, such that the new mass of peak py now equals mx.
8. The method according to claim 7, further comprising: searching for a pattern and scoring said pattern by a method comprising the steps of: a) computing the number of fragment ion masses that coincide with the adjusted masses of the observed fragment ion spectrum given the precomputed error tolerance intervals (count.sub.xy); and b) computing the sum of the intensities of the observed fragment ion masses coinciding with theoretical fragment ion masses (sum.sub.xy).
9. The method of claim 8, further comprising: modeling a distribution of the number of coinciding fragment ions by a Poisson model and generating for each location a p-value for a probability of a match between an observed fragment ion spectrum and a part of a theoretical ion spectrum, and optionally correlating a local score distribution for additional confidence, wherein positions with a p-value smaller than a pre-determined significance level are regarded as statistically significant.
10. The method of claim 8, further comprising: annotating the observed fragment ion spectrum j to show which peaks were matched by the theoretical ion fragments and updating the sequence to show which subsequence had observed matching ion fragments.
11. The method according to claim 1; wherein the theoretical fragment ion masses are adjusted by assuming a charge state z: the theoretical fragment ion masses are updated to (theoretical fragment masses)/z.
12. The method according to claim 1; wherein the sample comprises more than one biomacromolecule from said organism.
13. The method according to claim 1; wherein the biomacromolecule is a nucleic acid.
14. A data-processing system comprising: a processor; and a non-transitory computer readable medium having computer readable instructions stored thereon, which, when executed by the processor, configures the processor to perform the method according to claim 1.
15. A non-transitory computer readable medium having computer readable instructions stored thereon, which, when executed by a computing device or system, cause the computing device or system to perform the method according to claim 1.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0042] The following description of the figures of specific embodiments of the invention is merely exemplary in nature and is not intended to limit the present teachings, their application or uses.
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050] Throughout the figures, the following numbering is adhered to: 1spectrum collection; 2spectral matching; 3spectral assignment; 4protein database; 5theoretical fragment ion spectra; 6sequence coverage protein i.
DETAILED DESCRIPTION OF EMBODIMENTS
[0051] It is to be understood that the figures and descriptions of the present invention have been simplified to illustrate elements that are relevant for a clear understanding of the present invention, while eliminating, for purposes of clarity, many other elements which are conventional in this art. Those of ordinary skill in the art will recognize that other elements are desirable for implementing the present invention. However, because such elements are well known in the art, and because they do not facilitate a better understanding of the present invention, a discussion of such elements is not provided herein.
[0052] The present invention will now be described in detail on the basis of exemplary embodiments.
[0053] As used herein, the singular forms a, an, and the include both singular and plural referents unless the context clearly dictates otherwise.
[0054] The terms comprising, comprises and comprised of as used herein are synonymous with including, includes or containing, contains, and are inclusive or open-ended and do not exclude additional elements or method steps. The terms comprising, comprises and comprised of when referring to elements or method steps cited herein also include embodiments which consist of said elements or method steps cited herein.
[0055] Furthermore, the terms first, second, third and the like as used herein are used for distinguishing between similar elements and not necessarily for describing a sequential or chronological order, unless specified. It is to be understood that the terms so used are interchangeable under appropriate circumstances and that the embodiments of the invention described herein are capable of operation in other sequences than described or illustrated herein.
[0056] The term about as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, is meant to encompass variations of +/10% or less, preferably +/5% or less, more preferably +/1% or less, and still more preferably +/0.1% or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier about refers is itself also specifically, and preferably, disclosed.
[0057] The recitation of numerical ranges by endpoints includes all numbers and fractions subsumed within the respective ranges, as well as the recited endpoints.
[0058] Unless otherwise defined, all terms used in disclosing the invention, including technical and scientific terms, have the meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. By means of further guidance, definitions for the terms used in the description are included to better appreciate the teaching of the present invention. The terms or definitions used herein are provided solely to aid in the understanding of the invention.
[0059] In the present disclosure, the algorithms provided herein are mostly described in the context of protein sequencing, but it is to be understood that the algorithms are by no means limited to protein sequencing as such. The underlying principles are equally applicable to determining the structure of other biomacromolecules such as nucleic acids and polysaccharides. In particular, DNA, proteins, peptides, carbohydrates, like sugars and fibres are bio-polymers that are composed of a well-defined alphabet. In the case of DNA this is {ACGT} and we have a 20-letter alphabet in the case of proteins and peptides. Any fragmentation technique for mass spectroscopy (MS), e.g. tandem MS, that produces reproducible fragment ions for the biopolymers will generate data that is compatible with the present methods, which allows relating en observed fragment pattern to a text pattern. The present disclosure focuses on peptide to protein mapping, but a skilled person understands that the same principles also hold for e.g. gene to chromosome matching.
[0060] The present inventors have identified a new way which allows for the identification of biomacromolecules in a sample based on the matching of peptide spectra. Generally, in some embodiments, the method comprises the step of comparing an observed mass spectrum of a sample with a theoretical fragment ion spectrum.
[0061] In some embodiments, the observed spectrum is generated from a sample of a target organism. Also, accurate-mass clustering may be applied to said spectrum, for example by taking into account precomputed error intervals, as is detailed below. The observed spectra may correspond to a single peptide, or they may be chimeric or mixed (i.e. comprising ions from more than one peptide).
[0062] The theoretical fragment ion spectrum typically comprises theoretical fragment ion masses and theoretical fragment ion series.
[0063] In some embodiments, the observed mass spectrum is compared to the theoretical ion-series of every intact biomacromolecule in the set of the particular biomacromolecules present in a target organism.
[0064] When the present methods are applied to proteins, the method preferably involves comparing an observed mass spectrum with a theoretical fragment ion spectrum which comprises predicted ion series of every intact protein in the target organism's proteome. Preferably, the theoretical fragment ion spectrum is clustered before the comparison, wherein the clustering preferably takes into account the accuracy of the mass spectrometer by which the observed mass spectrum is obtained. This clustering step is explained in detail below. The result is an assignment of peaks from the spectra to sub-sequences in the protein database.
[0065] When applied to proteins, methods according to the invention typically require only an observed mass spectrum and a FASTA file of the reference proteome. In particular, any information about precursor masses, digestion protocols, fragmentation techniques, expected PTMs (post-translational modifications) or mutations is typically not required.
[0066] The methods allow for the interpretation of mass spectrometry-generated fragment ion spectra of amino acid sequences based on a search against a protein database that does not depend on user defined parameters. In the context of protein sequencing, the only two parameters are inferred from the experimental set-up and include the protein database (defined by the organism under scrutiny) and the mass accuracy (defined by the mass spectrometer).
[0067] The invention thus provides a computer-implemented method for determining the presence of a biomacromolecule of an organism in a sample wherein the method comprises the step of comparing an observed mass spectrum of the sample with a theoretical fragment ion spectrum comprising theoretical fragment ion masses. In some embodiments, the comparison involves spectral convolution of the observed mass spectrum with the theoretical fragment ion spectrum. Preferably, the biomacromolecule is selected from the list consisting of proteins, nucleic acids, and polysaccharides. When the biomacromolecule is a protein, the method may comprise comparing the obtained mass spectrum of the sample with the predicted a/x, b/y, and/or c/z series of the target proteome.
[0068] More particularly, the biomacromolecule is a protein or a nucleic acid and the method comprises the steps of: [0069] obtaining a tandem mass spectrum of the sample thereby obtaining a set of query peaks; [0070] subtracting the m/z value of every query peak from the theoretical fragment ion masses of the target proteome or genome of said organism obtained by determining theoretical fragment ion spectra comprising theoretical fragment ion masses for the protein or nucleic acid sequences of said target proteome or genome, respectively; [0071] clustering and scoring the resulting differences, thereby obtaining scores representative of the likelyhood of the presence of a specific protein or gene in said sample; and [0072] respectively assigning the spectrum to a protein of said proteome, or to a gene of said genome, based on said scores, thereby identifying the presence of said protein or gene in said sample.
[0073] The principle is illustrated in
[0074] In a particular, where the biomacromolecule is a protein, said method comprises the steps of: [0075] obtaining an observed mass spectrum of the sample thereby obtaining a set of query peaks; [0076] subtracting the m/z value of every query peak from the theoretical fragment ion masses of the target proteome of said organism obtained by determining theoretical fragment ion spectra comprising theoretical fragment ion masses for the protein sequences of said target proteome; [0077] clustering and scoring the resulting differences, thereby obtaining scores representative of the likelyhood of the presence of a specific protein in said sample; and [0078] respectively assigning the observed mass spectrum to a protein of said proteome, based on said scores, thereby identifying the presence of said protein in said sample.
[0079] As described herein, mass spectrometry refers to a spectroscopic technique of measuring the mass-to-charge ratio of ions to identify and quantify molecules in simple and complex mixtures.
[0080] In particular embodiments, the characterization procedure comprises the steps of collecting the spectrum (1), and spectral matching (2) so as to obtain an spectral assignment (3). In the spectrum collection step, an observed mass spectrum of a peptide is obtained. For the spectral matching, theoretical fragment ion spectra (5) are obtained from a protein database (4). The observed mass spectrum is compared to theoretical fragment ion spectra (5) in a spectral matching step (2). After the spectral matching step (2), the observed mass spectrum is assigned to a protein sequence. By repeating the above procedure for various observed mass spectra, proteins are sequenced.
[0081] Preferably, the theoretical fragment ion spectra comprise all fragment ions which might be created from a genome, glycome or proteome in a specific mass spectrometry fragmentation. However, the theoretical fragment ion spectra might comprise more theoretical fragment ions as well. For example, when the method is applied to the study of proteins, the theoretical fragment ion spectra might comprise all a-,b-,c-,x-,y-, and z-series of the target proteome even though it is known that the fragmentation technique used to obtain the observed fragment ion spectrum only produces b- and y-ions. Also, the theoretical fragment ion spectra may not comprise all fragment ions which occur in the sample. For example, the sample may comprise protein fragments comprising post-translational modifications and/or mutations which do not occur in the theoretical fragment ion spectra.
[0082] Accordingly, in particular embodiments said theoretical fragment ion spectra are respectively obtained by assuming at least 25% of all possible ions, more preferably at least 75% of all possible ions, most preferably by assuming about all possible ions generated from the protein sequences in said proteome; or by assuming at least 25% of all possible ions, more preferably at least 75% of all possible ions, most preferably by assuming all possible ions generated from the gene sequences in said genome. For amino acids, the recitation all possible ions as used herein refers to a set of ions which may comprise all possible ion fragments starting from the o-terminus and all possible ion fragments starting from the n-terminus. For proteins, the all possible ions may comprise all a- and x-fragments, all b- and y-fragments, and/or all c- and z-fragments. For proteins, the mass differences between different ions comprised in the all possible ions are preferably equal to the mass of an integer number of amino acid residues. For nucleic acids, the all possible ions may comprise all ion fragments starting from the 3 end and starting from the 5 end. For nucleic acids, the mass differences between different ions comprised in the all possible ions are preferably equal to the mass of an integer number of nucleic acid residues.
[0083] The methods provided herein thus involve the analysis of a mass spectrum obtained from a sample. Methods of mass spectrometry (MS) and tools for performing them are known in the art and include collision-induced dissociation (CID), also known as collisionally activated dissociation (CAD). The method induces fragments of molecular ions in the gas phase. The molecular ions are accelerated and allowed to collide with neutral molecules (such as helium, nitrogen or argon). In the collision some of the kinetic energy is converted into internal energy which results in bond breakage and the fragmentation of the molecular ion into smaller fragments. These fragment ions can then be analyzed by a tandem mass spectrometry. Examples of mass spectrometers include Triple quadrupole mass spectrometers, Fourier transform ion cyclotron resonance, Sustained off-resonance irradiation collision-induced dissociation (SORI-CID) spectrometers and higher-energy collisional dissociation (HCD) or orbitrap mass spectrometers. The methods provided herein may include the step of submitting the sample to mass spectrometry but typically start out from the resulting spectrum which is obtained. This is referred to herein as the query spectrum S or S. In particular embodiments the method is a computer-implemented method.
[0084] The sample on which the mass spectrometry analysis is performed is not critical to the methods provided herein. The sample submitted for MS analysis may be solid, liquid, or gas. In light of the analysis method however, the biomacromolecule in the sample can typically be attributed to an organism (also referred to as the target organism herein). When the biomacromolecule is a protein, this allows for the comparison with the proteome of said organism in the methods provided herein.
[0085] The methods provided herein may involve a pre-processing step wherein theoretical fragment ion spectra are obtained by assuming at least 25% of all possible ions, more preferably at least 75% of all possible ions, most preferably by assuming all possible ions in the genome, proteome, or glycome of the target organism, depending on whether proteins, nucleic acids, or polysaccharides are investigated.
[0086] In particular for proteins, the methods provided herein may involve a pre-processing step wherein the complete a-, b, or c- and respectively x- y- or z-series for every protein in the proteome of the organism of interest is calculated. This step will be required only once for a given organism and can in most cases be ensured based on information retrieved from Genbank (http://www.ncbi.nlm.nih.gov/genbank/) or other publicly accessible sequence databases. The data obtained can then be distributed across the nodes of a multiprocessor or across the cores of a multi-core chipset for a trivial speedup (so called embarrassingly simple parallelization).
[0087] Indeed, for proteins and in order to allow comparison with a query spectrum, the proteome may be converted into a synthetic spectrum by assuming all possible a-, b, or c- and respectively x- y- or z-ions that can be generated from these proteins. Each of the protein sequences in the proteome are converted into a list of pseudo-masses. In this regard, a particular pseudo mass need not correspond to a specific observed ion-value, but its value relative to the other pseudo-masses implies its unique position in the protein sequence. In doing so, a theoretic spectrum is produced in silico. This is illustrated in
[0088] More particularly for proteins, the theoretical fragment ion spectra may be obtained by assuming all possible a-, b-, or c-, and/or x-, y-, or z-generated from the protein sequences in said proteome. The use of all possible a-, b-, or c-, and/or x-, y-, or z-independent of certain assumptions of digestion of the protein in the sample allows for a more accurate analysis which can take into account possible (unknown) modifications of the protein.
[0089] Accordingly, in the theoretical fragment ion spectra each of the proteins of the proteome is associated with M theoretical a-, b, or c- and/or x- y- or z-. Potentially, the observed fragment ion masses can be produced by any sub-pattern in the protein sequence. Therefore, M possible starting locations in the protein sequence may be considered to search for a co-occurring pattern that explains the fragment ions in the observed peptide spectrum. When the origin of the observed fragment ion masses are unknown, every fragment ion in the spectrum may be considered as a potential product of the protein at a particular starting location.
[0090] Methods according to the present disclosure should be contrasted with prior art methods such as the methods by Wilhelm et al (as referenced in the Background section). Wilhelm et al. tries to explain modifications in observed fragment spectra. Doing so they first apply a biclustering approach to group spectra that share a subset of fragments. Second, they will look at particular mass differences between two bicluster groups to screen for a potential shift of the fragment peaks. So Wilhelm et al looks for structure in the data, but does not identify the spectra. Conversely, the present methods involve comparing an observed mass spectrum of a sample with a theoretical fragment ion spectrum. Thus the present methods may entail searching for patterns, or equivalently subsets, or equivalently mass differences, or equivalently item sets, etc., between an observed mass spectrum of a protein fragment in a sample and a theoretical fragment ion spectrum, or in other words a virtual protein fragment spectrum. Both methods have in common that they may be said to look at patterns that are shared between peak lists, i.e., spectral alignment, but the implementation and application is different. For example, to map peptides on proteins, the present methods can be said to involve disconnecting the b- and y-ion series. Such thing is not possible in the application of Wilhelm et al. as they stick with observed fragment data.
[0091] In particular embodiments, the methods comprise generating theoretical ion masses for the target proteome at the a-, b, or c-ion bond and the x- y- or z-ion bond respectively, and computing error intervals for every fragment ion mass based on the error tolerance of the mass spectrometry instrumentation. Indeed, in order to ensure that the theoretical masses can be adequately compared to the peaks in the spectra obtained, the potential error margin of the mass spectrometer used can be taken into consideration.
[0092] In a next step, the peaks of the query spectrum S may be compared with the theoretical a-, b, or c- and/or respectively x- y- or z-series values. This is preferably done by spectral convolution. Preferably, the user can specify the mass precision to be considered for this mathematical operation. For every query spectrum S and every protein a/x, b/y, or c/z-series, the m/z value of every query peak from every predicted a/x, b/y, or c/z value is substracted. This step can be done separately, or by matching pooled a/x, b/y, or c/z series. This step is also trivially parallelizable. The data can remain in its original floating point representation or it can be rounded. However, care must be take to round well beyond the accuracy of the instrument. In particular embodiments, rounding is pursued only in cases where the resulting speed gains justify the move away from full floating point representation.
[0093] The resulting differences may then be sorted by DBSCAN-like Clustering, as described by Martin Ester, Hans-peter Kriegel, Jorg Sander, and Xiaowei Xu, A density-based algorithm for discovering clusters in large spatial databases with noise, 7.sup.th International converence on Data Warehousing and Knowledge Discovery, 1996, pp. 226-231. The sorted deltas are then traversed with every delta assumed to be the initiator of a cluster. If the succeeding delta is within 2 of the previous delta (where is the error tolerance of the instrument in ppm) the succeeding delta is added to the cluster and the delta value of the cluster is updated by a central value of the delta's composing the cluster (mean, median, mode, max, etc.). It is noted that this step is also parallelizable though not trivially. Accordingly, in particular embodiments, the methods comprise generating theoretical ion masses, preferably for a target proteome or genome, and computing error intervals for every fragment ion mass based on the error tolerance of the mass spectrometry instrumentation. This allows grouping theoretical ion masses which are separated by less than the error tolerance.
[0094] In a next step, the methods may encompass a significance analysis and biomacromolecule assignment. The convolution step described above produces a clusters that contain a varying number of delta values that correspond to putative peaks shifted relative to the predicted total protein spectrum. The significance of the correspondence can be determined using a formal p-value based on an assumed (modified) Poisson distribution that is suited to deal with the count statistics produced by the DBSCAN algorithm. The modification of the distribution is trivial, in that a normal Poisson distribution entails zero counts as a possibility, while in the present methods there are no zero counts as a peak is always matched between the virtual protein and observed peptide peptides. For this reason, the one counts are inflated.
[0095] The peaks participating in delta clusters considered significant are then assigned to the relevant biomacromolecule entry.
[0096] Where the spectrum is from a mixed sample (unintentionally, e.g., chimeric spectra or by design, e.g., in the data-independent acquisition (DIA) experimental paradigm), different subsets of the peaks in the spectrum will be assigned to different biomacromolecules.
[0097] An example of a practical implementation of how these steps of spectral convolution, clustering and assignment may be carried out is detailed below for proteins and DNA.
[0098] First, a theoretical fragment ion spectrum i is selected corresponding to a given protein or chromosome and it is compared to an observed fragment ion spectrum j.
[0099] In particular embodiments, the theoretical fragment ion masses are adjusted by assuming a charge state i.e. the theoretical fragment ion masses are updated to (theoretical fragment masses)/z. However, this latter step is optional.
[0100] In particular embodiments, the method then comprises selecting a mass value py from observed fragment spectrum j, selecting a mass value mx from theoretical fragment spectrum i, aligning the observed spectrum to the theoretical spectrum by computing a mass shift xy=mxpy and adjusting the observed fragment ion masses by adding xy, such that the new mass of peak py now equals mx. This can be interpreted as searching for patterns between observed and theoretical data that can be aligned for the annotation of observed fragment ions. In this context, we note that Wilhelm et al (referred to in the background section) looks for mass differences to find patterns that explain modifications. Both the present methods and the disclosure of Wilhelm et al use the terminology of a mass shift, but the interpretation is different. The term mass shift is commodity in mass spectrometry.
[0101] In a next step the methods may comprise searching for a pattern and scoring it. In particular embodiments this involves: [0102] Computing the number of fragment ion masses that coincide with the adjusted masses of the observed fragment ion spectrum given precomputed error tolerance intervals (count.sub.xy); and [0103] Computing the sum of the intensities of the observed fragment ion masses coinciding with theoretical fragment ion masses (sum.sub.xy).
[0104] This is repeated for every possible theoretical position in every possible biomacromolecule of the set of reference biomacromolecules. For proteins, the set of reference biomacromolecules corresponds to the reference proteome (
[0105] The distribution of the number of coinciding fragment ions is then preferably modeled by a Poisson model whereby for each location a p-value is generated, the p-value representing the probability of a match between an observed fragment ion spectrum and a (part of) a theoretical ion spectrum. Optionally, the local score is correlated for additional confidence. In particular embodiments, positions with a p-value smaller than a pre-determined significance level (for example a significance level of 0.05) are regarded as statistically significant. Thereafter the observed fragment spectrum can be annotated to show which peaks are matched by the theoretical ion fragments (shown for proteins in
[0106] The above process can be repeated for every combination of observed ion spectra and theoretical fragment spectra. This makes it possible to identify the presence of a given biomacromolecule, for example a given protein, in the sample. In particular embodiments, the sample comprises more than one biomacromolecule from an organism. In particular embodiments, the one or more biomacromolecules are proteins or nucleic acids. In particular embodiments, the one or more biomacromolecules are proteins.
[0107] The application of the methods provided herein are numerous. Indeed, the specific advantages of the methods provided herein allow for analysis of sets of biomacromolecules, for example for analysis of the proteome, in conditions where prior art methods have failed, due to limitations on the nature of the sample and/or the need for prior knowledge of the starting material. The following are exemplary applications of the provided methods.
[0108] Post Translational Modifications/Mutations (PTM): while different approaches to the problem of proteins comprising PTM have been published, the present methods broaden the applicability of PTM/Mutation tolerant search by eliminating the requirement for an enzymatically-constrained peptide population. In addition, by avoiding the reliance on a complementary reference search, the present methods preserve the ability to provide straightforward p-values since they do not involve complex, difficult to analyze iterative searches such as employed by many tolerant search techniques (which are usually required to eschew probabilistic characterization of their results). Accordingly, in particular embodiments, the methods are performed to identify proteins which may be subject to PTM.
[0109] Endogenous Peptidomics: Since the methods provided herein do not require prior knowledge of the process which generated the peptide population being analyzed, they are ideal for endogenous peptidomics. Endogenous peptides are often modified in-vivo prior to full biological activation. Since the methods provided herein do not require prior knowledge of these modifications they have the unique advantage of their ability to detect this challenging peptide population. Accordingly, in particular embodiments, the methods are performed to identify endogenous peptides.
[0110] Searching Chimeric Spectra: Chimeric spectra represent another challenging case for typical search engines (which usually address them through an iterative scheme which, as previously mentioned, causes difficulty in the calculation of valid p-values). The present methods, by not requiring pure spectra, provide a natural match for such spectra. Accordingly, in particular embodiments, the methods are performed to identify biomacromolecules present in a sample generating an chimeric spectrum.
[0111] Data Independent Acquisition: A particularly competitive match for the methods and systems according to the present invention is the analysis of DIA-based spectra. These are well-known for their complexity since multiple precursors are fragmented concurrently. The present methods will do particularly well in this situation since it does not require knowledge of the precursors (i.e. there is no need for the low-energy scanin the case of Waters dataor the information about the SWATH window in the case of ABSciex data).
[0112] Label Free (fragment-based) Quantification: DIA-based quantitative proteomics has been an appealing prospect thanks to the freedom from the stochasticity of precursor selection. However, the difficulty in the identification of the resulting spectra has limited its spread. By potentially eliminating the need for precursor information while still maintaining excellent identifiability, the present methods enable fragment-based quantification on much cheaper instrumentation then is currently feasible. This allows quantitative proteomics to be performed on devices capable of accurate mass but limited to all-ion fragmentation (hence much cheaper than the typical instruments used for quantitative proteomics).
[0113] Spectral library matching: In spectral library matching an unknown observed peptide spectrum is queried against a library of high quality fragment spectra for which the peptide sequence assignment is known. In the approach according to the present invention, spectral library searching is tolerant against unspecified PTMs.
[0114] DNA modifications: The present invention can be used to search other biological sequences as well. Short DNA sequences can be fragmented using tandem mass spectrometry. The resulting fragment ions are organized in a similar way as peptides. The present invention can be used to map the fragment ions onto the genome sequence. Since, methods according to the present invention can handle unspecified modification this technique is suited to understand DNA methylation and other epigenetic signaling.
[0115] Invariant with respect to the fragmentation principle: Methods according to the present invention are invariant of the type of fragmentation and works equally well for collision-induced dissociation (CID), electron-capture dissociation (ECD), electron-transfer dissociation (ETD), negative electron-transfer dissociation (NETD), electron-detachment dissociation (EDD), photodissociation, particularly infrared multiphoton dissociation (IRMPD) and blackbody infrared radiative dissociation (BIRD), surface-induced dissociation (SID), Higher-energy C-trap dissociation (HCD), charge remote fragmentation. For these applications it is not required to define new fragment ion series, since the mass difference between consecutive fragment ions remains fixed for all ion fragment types.
[0116] In particular embodiments, the methods provided herein are computer-implemented methods.
[0117] Accordingly, in some embodiments, the application provides computer-implemented methods for determining a biomacromolecule of an organism in a sample, the method comprising the steps of: [0118] a. receiving a biomacromolecule database comprising the biomacromolecule sequences, for example of the genome or of the proteome, of said organism; [0119] b. determining theoretical fragment ion spectra for the protein sequences, the theoretical fragment ion spectra comprising M theoretical fragment ion masses, the theoretical fragment ion spectra corresponding to biomacromolecules i; [0120] c. receiving an observed sample spectrum corresponding, the observed spectrum comprising N observed fragment ion masses; [0121] d. matching the observed sample spectrum to the theoretical fragment ion spectrum or a part thereof by clustered spectral convolution; and [0122] e. identifying a protein present in said sample based thereon.
[0123] In particular embodiments, the methods are designed to take into consideration the error tolerance of the mass spectrometry method. Accordingly, in particular embodiments, the computer-implemented methods further comprise the step of receiving an error tolerance, which can then be taken into consideration in the methods as described herein.
[0124] Further provided herein is a computer readable medium having stored thereon instructions which when executed by a computing device or system cause the computing device or system to perform the steps of a method provided herein.
[0125] The application further provides data-processing systems comprising means configured for carrying out the methods provided herein.
[0126] The application further provides computer program products having instructions which when executed by a computing device or system cause the computing device or system to perform a method as described herein.
[0127] The application further provides data streams which are representative of a computer program having instructions which when executed by a computing device or system cause the computing device or system to perform the methods as described herein.
EXAMPLES
[0128] 1. Identification of a Protein in a CID Spectrum
[0129] The CID spectrum in
TABLE-US-00001 (SEQIDNO:1) IIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGL RRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKFELQHAL DEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKFEEFENTRKNH ARALESMQASLE
[0130] Applying the methods according to the present invention with an error tolerance of 0.05 Da yields b-ion (1+) and y-ion (1+) matching pseudo-ion counts as seen in
[0131] Result in terms of sequence:
[0132] 1. B-ion result: LQHALDEAEAALEAEE [p-val: 6.8e-13] (SEQ ID NO: 2)
[0133] 2. Y-ion result: LQHALDEAEAALEAEE [p-val: 3.3e-11] (SEQ ID NO: 3) are confirmed by the SEQUEST algorithm as: EELQHALDEAEAALEAEESK (SEQ ID NO:4)
[0134] 2. Exemplary Workflow
[0135] The methods provided herein are applied to protein characterization, as schematically illustrated in
[0136] While this invention has been described in conjunction with the specific embodiments outlined above, it is evident that many alternatives, modifications, and variations will be apparent to those skilled in the art. Accordingly, the preferred embodiments of the invention as set forth above are intended to be illustrative, not limiting. Various changes may be made without departing from the spirit and scope of the inventions as defined in the following claims.
[0137] It is noted that citation or identification of any document in this application is not an admission that such document is available as prior art to the present invention.