MESSENGER RNA THERAPEUTICS AND COMPOSITIONS
20220370599 · 2022-11-24
Inventors
- James Robbins Abshire (Cambridge, MA)
- Christopher J.H. DAVITT (Jamaica Plain, MA, US)
- Ian HILL (Malden, MA, US)
- Lorenzo AULISA (Chesterfield, MO, US)
- Marcelo SAMSA (Hanover, MD, US)
- Nabanita DE (Lexington, MA, US)
- Michael HUDSON (Medford, MA, US)
- Rachit JAIN (Medford, MA, US)
- Himanshu DHAMANKAR (Arlington, MA, US)
- William FARMER (Concord, MA, US)
- Christopher GREGG (Melrose, MA, US)
Cpc classification
A61K39/215
HUMAN NECESSITIES
C12N2770/20034
CHEMISTRY; METALLURGY
C12N2760/16134
CHEMISTRY; METALLURGY
C12N2770/20022
CHEMISTRY; METALLURGY
International classification
Abstract
In the various aspects and embodiments, this disclosure provides messenger RNA (mRNA) constructs for therapeutic delivery, as well as methods for making such mRNA constructs and pharmaceutical compositions comprising the same (including mRNA vaccine compositions). In still other aspects, the invention provides methods for treating patients by expression of therapeutic proteins, including for preventing or reducing probability of infection by, or illness involving, a virus. Exemplary viruses include coronaviruses (such as SARS-CoV-2 and variants therefore) and influenza viruses, among others.
Claims
1. An mRNA encoding a SARS-CoV-2 spike protein, the mRNA comprising a 5′ UTR comprising an Initial Transcribed Sequence (ITS) of SEQ ID NO: 8 or SEQ ID NO: 9, optionally comprising one or more modified nucleobases.
2. The mRNA of claim 1, wherein the ITS comprises SEQ ID NO: 10 or SEQ ID NO: 11 or at least 8, or at least 10, or at least 12 consecutive nucleotides of SEQ ID NO: 10 or SEQ ID NO: 11, optionally comprising one or more modified bases.
3. The mRNA of claim 1, wherein the ITS does not contain any modified bases.
4. The mRNA of claim 1, wherein the ITS comprises modified uridine, which is optionally pseudouridine or Nl-methyl-pseudouridine.
5. The mRNA of claim 1, further comprising a 5′ cap.
6-10. (canceled)
11. The mRNA of claim 1, wherein the 5′ UTR further comprises a Kozak sequence, and wherein the mRNA further comprises a 3′ UTR and optionally a PolyA tract.
12. The mRNA of claim 11, wherein the 5′ UTR further comprises the nucleotide sequence substantially of SEQ ID NO: 12 or a derivative thereof.
13. The mRNA of claim 12, wherein the 5′ UTR comprises the nucleotide sequence of SEQ ID NO: 12, with uridine substituted with modified uridine, where the modified uridine is optionally pseudouridine or N1-methyl-pseudouridine.
14. (canceled)
15. The mRNA of claim 11, wherein the 3′ UTR substantially comprises the nucleotide sequence of SEQ ID NO: 14 or a derivative thereof; optionally with uridine substituted with modified uridine, where the modified uridine is optionally pseudouridine or Nl-methyl-pseudouridine.
16. The mRNA of claim 15, wherein the 3′ UTR substantially comprises the nucleotide sequence of SEQ ID NO: 15.
17. The mRNA of claim 11, comprising a poly(A) tract of about 100 nucleotides.
18. The mRNA of claim 1, wherein the spike protein has the amino acid sequence of SEQ ID NO: 5, optionally having from one to twenty-five amino acid substitutions.
19. The mRNA of claim 18, wherein the spike protein comprises one or more amino acid substitutions selected from L5F, P9L, S13I, L18F, T19R, T20N, P26S, A67V, HV69-70del, G75V, T76I, D80A, T95I, C136F, D138Y, G142D, Y144del, Y144S, Y145N, W152C, EF156-157del, R158G, R190S, E154K, R190S, D215G, LA242-243del, LAL242-244del, R246I, RSYLTPG246-252del, D253N, D253G, R346K, K417N, K417T, Y449H, L452R, L452Q, T478K, E484K, E484Q, F490S, N501Y, A570D, D614G, H655Y, Q677H, N679K, P681H, P681R, A701V, T716I, T859N, F888L, D950N, S982A, K986P, V987P, Q1071H, T1027I, D1118H, and V1176F.
20. (canceled)
21. The mRNA of claim 18, wherein the spike protein open reading frame has a nucleotide sequence substantially corresponding to SEQ ID NO: 2 or 4.
22. A method for synthesizing the mRNA of claim 1, comprising, contacting a linear DNA template encoding the mRNA under control of a promoter, with a RNA polymerase that recognizes said promoter, nucleotide triphosphate (NTP) reagents, and optionally a 5′ capping reagent.
23-32. (canceled)
33. An mRNA vaccine composition comprising the mRNA of claim 1, encapsulated in a lipid nanoparticle.
34. A method for preventing or reducing the probability of SARS-CoV-2 infection in a patient, comprising administering the mRNA vaccine of claim 33.
35-37. (canceled)
38. An mRNA encoding an antigen or therapeutic protein, the mRNA comprising a 5′ UTR, comprising an Initial Transcribed Sequence (ITS) of SEQ ID NO: 8 or SEQ ID NO: 9 or SEQ ID NO: 10 or SEQ ID NO: 11, the mRNA further comprising an open reading frame encoding the antigen or therapeutic protein, optionally comprising one or more modified nucleobases.
39. The mRNA of claim 38, wherein the ITS comprises SEQ ID NO: 10 or SEQ ID NO: 11 or at least 8, or at least 10, or at least 12 consecutive nucleotides of SEQ ID NO: 10 or SEQ ID NO: 11, optionally comprising one or more modified bases.
40. The mRNA of claim 38, wherein the ITS does not contain any modified bases.
41. The mRNA of claim 38, wherein the ITS comprises modified uridine, which is optionally pseudouridine or N1-methyl pseudouridine.
42. The mRNA of claim 38, further comprising a 5′ cap.
43-47. (canceled)
48. The mRNA of claim 38, wherein the 5′ Untranslated Region (UTR) comprises a Kozak sequence, and wherein the mRNA further comprises a 3′ UTR and optionally a PolyA tract.
49. The mRNA of claim 48, wherein the 5′ UTR further comprises the nucleotide sequence of SEQ ID NO: 12 or a derivative thereof.
50. The mRNA of claim 48, with uridine substituted with modified uridine, where the modified uridine is optionally pseudouridine or N1-methyl-pseudouridine.
51. The mRNA of claim 48, wherein the Kozak sequence has the sequence of SEQ ID NO: 13, optionally with one or more modified bases.
52. The mRNA of claim 48, wherein the 3′ UTR substantially comprises the nucleotide sequence of SEQ ID NO: 14.
53. The mRNA of claim 48, wherein the 3′ UTR comprises the nucleotide sequence of SEQ ID NO: 14, with uridine substituted with modified uridine, where the modified uridine is optionally pseudouridine or N1-methyl pseudouridine.
54. The mRNA of claim 48, comprising a poly(A) tract of about 100 nucleotides.
55. (canceled)
56. (canceled)
57. (canceled)
58. A method for synthesizing the mRNA of claim 38, comprising, contacting a linear DNA template encoding the mRNA under control of a promoter, with a RNA polymerase that recognizes said promoter and nucleotide triphosphate (NTP) reagents.
59. The method of claim 58, wherein the DNA template, the RNA polymerase, and NTP reagents are contacted in vitro.
60. The method of claim 58, wherein the DNA template, the RNA polymerase, and NTP reagents are contacted in a cell free system synthesizing the NTP reagents from precursors.
61. The method of claim 60, wherein the precursors comprise nucleotide monophosphate (NMP) reagents which are optionally prepared by depolymerizing cellular RNA.
62. The method of claim 58, wherein the RNA polymerase is T7 RNA polymerase.
63-68. (Canceled)
69. An mRNA composition comprising the mRNA of claim 38, and a transfection reagent or delivery vehicle.
70. The mRNA composition of claim 69, wherein the composition comprises a lipid nanoparticle delivery vehicle.
71. A method for expressing a therapeutic protein in a patient, comprising administering the mRNA composition of claim 69 to said patient.
72. (canceled)
73. (canceled)
74. An RNA encoding a protein of interest, the RNA comprising an Initial Transcribed Sequence (ITS) of SEQ ID NO: 10 or SEQ ID NO: 11.
75. The RNA of claim 74 wherein the ITS is followed by SEQ ID NO: 12, followed by a Kozak sequence of SEQ ID NO: 13, followed by an open reading frame encoding said protein.
76. The RNA of claim 75, comprising SEQ ID NO: 17, followed by an open reading frame encoding said protein.
77. The RNA of claim 75, wherein said open reading frame is followed by a 3′ UTR sequence.
78. The RNA of claim 77, wherein said 3′ UTR comprises SEQ ID NO: 14, followed by a poly(A) sequence.
79. The RNA of claim 74 wherein the RNA is an mRNA.
80-82. (canceled)
83. The RNA of any of claim 74 wherein the open reading frame encodes a SARS-CoV-2 spike protein.
84. The RNA of claim 83 wherein the RNA comprises a sequence selected from the group consisting of SEQ ID NO: 6 and/or SEQ ID NO: 7.
85. The RNA of claim 74 wherein the open reading frame encodes one or more influenza proteins.
86. The RNA of claim 74 wherein the open reading frame encodes a varicella proteins.
Description
DESCRIPTION OF THE FIGURES
[0004]
[0005]
[0006]
[0007]
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
DETAILED DESCRIPTION
[0024] In the various aspects and embodiments, this disclosure provides messenger RNA (mRNA) constructs for therapeutic delivery, as well as methods for making such mRNA constructs and pharmaceutical compositions comprising the same (including mRNA vaccine compositions). In still other aspects, the present disclosure provides methods for treating patients by expression of therapeutic proteins, including for preventing or reducing probability of infection by, or illness involving, a virus. Exemplary viruses include coronaviruses (such as SARS-CoV-2 and variants therefore) influenza viruses, and herpes viruses, among others.
[0025] In some aspects and embodiments, the disclosure provides an mRNA encoding a SARS-CoV-2 wild-type spike protein. In some embodiments, the mRNA comprises an Initial Transcribed Sequence (ITS) of 6 to 20 nucleotides, and which may comprise the nucleotide sequence of SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, or SEQ ID NO: 11, or a derivative thereof as described herein, and which optionally comprises one or more modified bases. Alternatively or in addition, the mRNA encodes the SARS-CoV-2 spike protein in a prefusion stabilized state, as described herein.
[0026] Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is a novel (3-coronavirus first identified in 2019. SARS-CoV-2 is a single-stranded RNA-enveloped virus encoding structural and nonstructural proteins. The S, E, M, and N genes encode structural proteins, whereas nonstructural proteins include 3-chymotrypsin-like protease, papain-like protease, and RNA-dependent RNA polymerase.
[0027] The spike (S) protein of SARS-CoV-2 is involved in receptor recognition and cell membrane fusion. The S protein is 180-200 kDa in size and contains an extracellular N-terminus, a transmembrane (TM) domain anchored in the viral membrane, and a small intracellular C-terminal domain. See
[0028] In other embodiments, the mRNA may be a vaccine against other viruses, such as, for example, influenza viruses or herpes viruses. The composition may comprise a vaccine and the mRNA may encode a known antigen for any given virus. In some embodiments, the composition may comprise a shingles vaccine. In such embodiments, the mRNA may encode one or more known varicella antigens, such as glycoprotein E, glycoprotein B, glycoprotein H, glycoprotein L, and glycoprotein I. In other embodiments, the vaccine is an influenza vaccine with an mRNA encoding for one or more of hemagglutinin and/or neuraminidase.
[0029] The mRNA constructs in accordance with this disclosure can be designed to improve synthesis (e.g., improved yield using in vitro or cell-free RNA synthesis processes). In some embodiments, the mRNA is transcribed from a DNA template in vitro or in a cell-free system, e.g., using T7 RNA polymerase. In vitro transcription is well known in the art. In some embodiments, the mRNA is synthesized using a cell-free process as described in WO 2020/205793 or U.S. Pat. No. 10,858,385, which are hereby incorporated by reference in their entireties, or as described herein. For example, in vitro transcription or cell-free transcription processes will involve a DNA template having a promoter. The DNA template will comprise an open reading frame (“ORF”) encoding the protein of interest (e.g., S protein as described herein or an antigen for any given virus) and with untranslated regions. If positioned on the 5′ side of the ORF, the untranslated region is called a 5′ UTR. If positioned on the 3′ side of the ORF, the untranslated region is called a 3′ UTR.
[0030] A 5′ UTR provides sequences and secondary structures that regulate translation. A 5′ UTR advantageously comprises a sequence that is recognized by the ribosome that allows the ribosome to bind and initiate translation of the mRNA. Sequences and structures of 3′ UTRs can govern mRNA stability, for example. 3′ UTR regulatory elements are recognized by a wide variety of trans-acting factors that include microRNAs (miRNAs), their associated machinery, and RNA-binding proteins (RBPs). In turn, these factors instigate common mechanistic strategies to execute the regulatory programs that are encoded by 3′ UTRs. In some embodiments, the 5′ UTR and/or 3′ UTR can be substantially derived from the human α- and/or β-globin genes. Other suitable UTRs for therapeutic mRNAs are described herein and in Orlandini von Niessen, et al., Improving mRNA-Based Therapeutic Gene Delivery by Expression-Augmenting 3′ UTRs Identified by Cellular Library Screening, Molecular Therapy Vol. 27, No. 4 (2019); Trepotec Z., et al., Maximizing the Translational Yield of mRNA Therapeutics by Minimizing 5′-UTRs, Tissue Eng Part A (2019) January; 25(1-2):69-79.
[0031] In some embodiments the 5′ UTR comprises an initial transcribed sequence (ITS) positioned at the 5′ end of the 5′ UTR that improves the efficiency of transcription initiation to thereby maximize RNA product yield and minimize production of abortive transcription products from transcription reactions. An ITS is a short sequence of about 6 to 15 nucleotides that, when present, has a critical role in the early stages of transcription (initiation and the transition to elongation phase via promoter clearance), and influences the overall rate and yield of transcription from a given promoter. In some embodiments, the ITS is as described in WO 2020/205793 and/or WO 2021/113774, which disclosures are hereby incorporated by reference. For example, in some embodiments, an ITS is a naturally occurring ITS, or is a consensus ITS found downstream of a T7 class III promoter.
[0032] In some embodiments, the ITS is 6 to about 20 nucleotides in length, or is 6 to about 15 nucleotides in length, and is otherwise heterologous to the 5′ UTR sequence. The ITS may comprise the 5′ sequence GGGAGA (SEQ ID NO: 8) or AGGAGA (SEQ ID NO: 9). In some embodiments, the ITS comprises at least 6, at least 8, at least 10, or at least 12 consecutive nucleotides from the 5′ end of the following sequence: GGGAGACCAGGAAUU (SEQ ID NO: 10) or AGGAGACCAGGAAUU (SEQ ID NO: 11). In some embodiments, the ITS is a modified version of SEQ ID NO: 10 or SEQ ID NO: 11, for example having one, two, three, four, or five nucleotide changes. In some embodiments, the ITS consists of the nucleotide sequence of SEQ ID NO: 10 or SEQ ID NO: 11 followed by further 5′ UTR sequences (e.g., sequences from a mammalian or human mRNA 5′ UTR, including a mammalian or human 5′ UTR disclosed herein).
[0033] For simplicity nucleotide sequences may be shown herein using DNA nucleotide sequences (i.e., including T nucleobases) or as RNA nucleotide sequences (i.e., including U nucleobases). It is understood from the context that when the sequence is intended to be RNA, T nucleotides are substituted as U (or modified U as described herein), and vice versa.
[0034] In some embodiments, the ITS comprises the nucleotide sequence of SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, or SEQ ID NO: 11 (or a portion thereof as described above) and optionally comprising one or more nucleotide substitutions. Where the in vitro transcription reaction includes modified bases (such as modified uridine for uridine), the ITS will contain such modified bases. Nucleotide substitutions can be selected from those that do not negatively impact or which improve transcription yield from a T7 class III promoter. In various embodiments, the ITS, such as the ITS of SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, or SEQ ID NO: 11 (or portions thereof) may have one or more modified bases. Modified bases include those described in U.S. Pat. No. 8,691,966, which is hereby incorporated by reference in its entirety. Synthetic RNA comprising only canonical nucleotides (i.e., G, C, A, and U) can bind to pattern recognition receptors and induce a cellular response. This response can result in translation block, the secretion of inflammatory cytokines, and cell death. RNA comprising certain non-canonical nucleotides can evade detection by this innate immune system and can be translated at high efficiency into protein. In addition, in accordance with the present disclosure, such modified bases do not impact efficiency of transcription, and thus do not negatively impact RNA yield.
[0035] In some embodiments, where modified uridine is used with the in vitro transcription reaction, the ITS will comprise modified uridine. For example, at least about 50% or all uridines can be modified uridines, such as pseudouridine, Nl-methyl-pseudouridine, and/or 5-methoxy-uridine. In some embodiments, uridines of the ITS sequence are replaced with pseudouridine or N1-methyl-pseudouridine. Other modified bases for use with the ITS include 5-methyl cytidine.
[0036] In various embodiments, the mRNA includes one or more modified nucleotides, such as one or more of: 2-thiouridine, 5-azauridine, pseudouridine, 4-thiouridine, 5-methyluridine, 5-methylpseudouridine, 5-aminouridine, 5-aminopseudouridine, 5-hydroxyuridine, 5-hydroxypseudouridine, 5-methoxyuridine, 5-methoxypseudouridine, 5-ethoxyuridine, 5-ethoxypseudouridine, 5-hydroxymethyluridine, 5-ydroxymethylpseudouridine, 5-carboxyuridine, 5-carboxypseudouridine, 5-formyluridine, 5-formylpseudouridine, 5-methyl-5-azauridine, 5-amino-5-azauridine, 5-hydroxy-5-azauridine, 5-methylpseudouridine, 5-aminopseudouridine, 5-hydroxypseudouridine, 4-thio-5-azauridine, 4-thiopseudouridine, 4-thio-5-methyluridine, 4-thio-5-aminouridine, 4-thio-5-hydroxyuridine, 4-thio-5-methyl-5-azauridine, 4-thio-5-amino-5-azauridine, 4-thio-5-hydroxy-5-azauridine, 4-thio-5-methylpseudouridine, 4-thio-5-aminopseudouridine, 4-thio-5-hydroxypseudouridine, 2-thiocytidine, 5-azacytidine,pseudoisocytidine, N4-methylcytidine, N4-aminocytidine, N4-hydroxycytidine, 5-methylcytidine, 5-aminocytidine, 5-hydroxycytidine, 5-methoxycytidine, 5-ethoxycytidine, 5-hydroxymethylcytidine, 5-carboxycytidine, 5-formylcytydine, 5-methyl-5-azacytidine, 5-amino-5-az acytidine, 5-hydroxy-5-azacytidine, 5-methylp s eudo iso cytidine, 5-aminopseudoisocytidine, 5-hydroxypseudoisocytidine, N4-methyl-5-azacytidine, N4-methylpseudoisocytidine, 2-thio-5-azacytidine, 2-thiopseudoisocytidine, 2-thio-N4-methylcytidine, 2-thio-N4-aminocytidine, 2-thio-N4-hydroxycytidine, 2-thio-5-methylcytidine, 2-thio-5-aminocytidine, 2-thio-5-hydroxycytidine, 2-thio-5-methyl-5-azacytidine, 2-thio-5-amino-5-azacytidine, 2-thio-5-hydroxy-5-azacytidine, 2-thio-5-methylpseudoisocytidine, 2-thio-5-aminopseudoisocytidine, 2-thio-5-hydroxypseudoisocytidine, 2-thio-N4-methyl-5-azacytidine, 2-thio-N4-methylpseudoisocytidine, N4-methyl-5-methylcytidine, N4-methyl-5-aminocytidine, N4-methyl-5-hydroxycytidine, N4-methyl-5-methyl-5-azacytidine, N4-methyl-5-amino-5-azacytidine, N4-methyl-5-hydroxy-5-azacytidine, N4-methyl-5-methylpseudoisocytidine, N4-methyl-5-aminopseudoisocytidine, N4-methyl-5-hydroxypseudoisocytidine, N4-amino-5-azacytidine, N4-aminopseudoisocytidine, N4-amino-5-methylcytidine, N4-amino-5-aminocytidine, N4-amino-5-hydroxycytidine, N4-amino-5-methyl-5-azacytidine, N4-amino-5-amino-5-azacytidine, N4-amino-5-hydroxy-5-azacytidine, N4-amino-5-methylpseudoisocytidine, N4-amino-5-aminopseudoisocytidine, N4-amino-5-hydroxypseudoisocytidine, N4-hydroxy-5-azacytidine,N4-hydroxypseudoisocytidine, N4-hydroxy-5-methylcytidine, N4-hydroxy-5-amino cytidine,N4-hydroxy-5-hydroxycytidine, N4-hydroxy-5-methyl-5-azacytidine, N4-hydroxy-5-amino-5-azacytidine, N4-hydroxy-5-hydroxy-5-az acytidine, N4-hydroxy-5-methylp seudo is o cytidine, N4-hydroxy-5-aminopseudoisocytidine, N4-hydroxy-5-hydroxypseudoisocytidine, 2-thio-N4-methyl-5-methylcytidine, 2-thio-N4-methyl-5-aminocytidine, 2-thio-N4-methyl-5-hydroxycytidine, 2-thio-N4-methyl-5-methyl-5-azacytidine, 2-thio-N4-methyl-5-amino-5-azacytidine, 2-thio-N4-methyl-5-hydroxy-5-azacytidine, 2-thio-N4-methyl-5-methylpseudoisocytidine, 2-thio-N4-methyl-5-aminop seudo is o cytidine, 2-thio-N4-methyl-5-hydroxypseudoisocytidine, 2-thio-N4-amino-5-azacytidine, 2-thio-N4-aminopseudoisocytidine, 2-thio-N4-amino-5-methylcytidine, 2-thio-N4-amino-5-aminocytidine, 2-thio-N4-amino-5-hydroxycytidine, 2-thio-N4-amino-5-methyl-5-azacytidine, 2-thio-N4-amino-5-amino-5-azacytidine, 2-thio-N4-amino-5-hydroxy-5-azacytidine, 2-thio-N4-amino-5-methylpseudoisocytidine, 2-thio-N4-amino-5-aminopseudoisocytidine, 2-thio-N4-amino-5-hydroxypseudoisocytidine, 2-thio-N4-hydroxy-5-azacytidine, 2-thio-N4-hydroxypseudoisocytidine, 2-thio-N4-hydroxy-5-methylcytidine, N4-hydroxy-5-aminocytidine, 2-thio-N4-hydroxy-5-hydroxycytidine, 2-thio-N4-hydroxy-5-methyl-5-azacytidine, 2-thio-N4-hydroxy-5-amino -5-azacytidine, 2-thio-N4-hydroxy-5-hydroxy-5-azacytidine, 2-thio-N4-hydroxy-5-methylpseudoisocytidine, 2-thio-N4-hydroxy-5-aminopseudoisocytidine, 2-thio-N4-hydroxy-5-hydroxypseudoisocytidine, N6-methyladenosine, N6-aminoadenosine, N6-hydroxyadenosine, 7-deazaadenosine, 8-azaadenosine, N6-methyl-7-deazaadenosine, N6-methyl-8-azaadenosine, 7-deaza-8-azaadenosine, N6-methyl-7-deaza-8-azaadenosine, N6-amino-7-deazaadenosine, N6-amino-8-azaadenosine, N6-amino-7-deaza-8-azaadenosine, N6-hydroxyadenosine, N6-hydroxy-7-deazaadenosine, N6-hydroxy-8-azaadenosine, N6-hydroxy-7-deaza-8-azaadenosine, 6-thioguanosine, 7-deazaguanosine, 8-azaguanosine, 6-thio-7-deazaguanosine, 6-thio-8-azaguanosine, 7-deaza-8-azaguanosine, 6-thio-7-deaza-8-azaguanosin, and N1-methylpseudouridine.
[0037] In some embodiments, the ITS of the mRNA does not contain any modified bases, that is, all bases are canonical nucleotides. As used herein, the term “canonical” nucleotides in the context of mRNA includes adenine, guanine, cytosine, and uracil bases.
[0038] In various embodiments, the mRNA comprises a 5′ cap. An mRNA cap serves a variety of functions, including, but not limited to, recruiting ribosomal subunits, promoting ribosome assembly and translation, and protecting the mRNA from exonuclease activity. Capping can be achieved using a variety of methods. In some embodiments, capping is achieved using one or more enzymes. The process of capping can involve a variety of enzymatic activities, such as RNA 5-triphosphatase activity, guanylyltransferase activity, guanylyl methyltransferase activity, and 2′-O-Methyltransferase activity. In some embodiments, one protein or complex accomplishes all four functions. In some embodiments, the four activities are accomplished by two, three, or four enzymes.
[0039] Capping can be performed at a variety of different steps of the mRNA synthesis process. Capping can occur co-transcriptionally or post-transcriptionally. For example, the cap can be added after RNA synthesis, and before or after an enzymatic polyadenylation step, if enzymatic polyadenylation is performed. In some embodiments, the RNA is capped in the reaction mix before purification. In other embodiments, the RNA is capped after it is purified.
[0040] In some embodiments, mRNA is capped using a cap analog. Cap analogs can include dinucleotide cap analogs (e.g., standard cap analog or anti-reverse cap analog) or 3+ nucleotide cap analogs (e.g., CleanCap™ from TriLink BioTechnologies, Inc., San Diego, Calif.). In some embodiments, the 5′ cap is m7G (cap 0). The m7G cap structure is a 7-methylguansine triphosphate linked to the 5′ end of the mRNA via a 5′.fwdarw.5′ triphosphate linkage. In some embodiments, the cap structure can be further modified by adding a methyl group to the 2′O position of the initiating nucleotide of the mRNA (cap 1). In some embodiments, the cap structure can be further modified by adding methyl group(s) to the 2′O position of subsequent nucleotides of the mRNA (hypermethylated caps such as cap 2, 3, 4, etc.).
[0041] In some embodiments, capping enzymes are added to the mRNA synthesis reaction (described below), along with a methyl donor (e.g., S-adenosylmethionine), and either GTP or GMP with polyphosphate. In some embodiments, GMP is converted to GTP by kinases present in the cell-free reaction. A non-comprehensive list of enzymes for potential use in capping messenger RNAs are described in WO 2020/205793, which is hereby incorporated by reference. In some embodiments, capping can be performed after the RNA polymerization step.
[0042] In various embodiments, the mRNA, in addition to an ORF encoding the protein of interest, further comprises a 5′ UTR (e.g., including an ITS and Kozak sequence), a 3′ UTR, and a PolyA tract. In some embodiments, the 5′ UTR comprises the nucleotide sequence substantially of SEQ ID NO: 12 or a derivative thereof. Derivatives of the sequence of SEQ ID NO: 12 can have up to about 20%, up to about 15%, up to about 10%, or up to about 5% of nucleotides substituted. Such substitutions include those that do not negatively impact, and/or those that enhance, transcription of the mRNA in the in vitro or cell-free system, and/or do not negatively impact translation and/or stability in host cells, which can be evaluated using in vitro cell lines that are representative of the target cell or tissue. The 5′ UTR comprises a Kozak sequence, which optionally has the sequence of SEQ ID NO: 13 (optionally with modified bases as described herein). In some embodiments, the 3′ UTR comprises the nucleotide sequence of SEQ ID NO: 14 or a derivative thereof. Derivatives of the sequence of SEQ ID NO: 14 can have up to about 20%, up to about 15%, up to about 10%, or up to about 5% of nucleotides substituted. Such substitutions include those that do not negatively impact, and/or can include those that enhance, transcription of the mRNA in the in vitro or cell-free system, and/or do not negatively impact translation and/or stability in host cells, which can be evaluated using in vitro cell lines that are representative of the target cell or tissue.
[0043] In some embodiments that employ modified bases during the in vitro transcription reaction, the 5′ UTR and 3′ UTR will have modified bases (e.g., such as modified bases include those described in U.S. Pat. No. 8,691,966, which are hereby incorporated by reference in its entirety). In some embodiments, the 5′ UTR and 3′ UTR comprise modified uridine. For example, at least about 50% or all uridines can be modified uridines, such as pseudouridine, N1-methyl-pseudouridine, and/or 5-methoxy-uridine. In some embodiments, substantially all uridines of the 5′ UTR and the 3′ UTR are replaced with pseudouridine or N1-methyl-pseudouridine. Other modified bases for use with the mRNA include 5-methyl cytidine and N6-methyl adenosine.
[0044] In some embodiments, the mRNA comprises a poly(A) tract. A poly(A) tract is a 3′ sequence that includes at least 20 nucleotides that are predominately A nucleotides. In exemplary embodiments, the polyA tract is at least about 20 nucleotides, at least about 50 nucleotides, or at least about 75 nucleotides, or at least about 100 nucleotides. In some embodiments, the polyA tract is about 100 nucleotides in length. In some embodiments the polyA tract may include non-A nucleotides or sequences of non-A nucleotides.
[0045] In various embodiments, the encoded spike protein has the amino acid sequence of SEQ ID NO: 5, optionally having one or more modifications. In embodiments, the modifications may be engineered or may be the same modifications found in naturally occurring mutant variants. In various embodiments, the spike protein is a wild type spike protein, that is, comprising the amino acid sequence of SEQ ID NO: 5 or a natural variant thereof. In some embodiments, the spike protein comprises from one to twenty, or from one to fifteen, or from one to ten, or from one to five amino acid substitutions. Exemplary amino acid substitutions can be selected from L5F, P9L, S13I, L18F, T19R, T20N, P26S, A67V, HV69-70del, G75V, T76I, D80A, T95I, C136F, D138Y, G142D, Y144del, Y144S, Y145N, W152C, EF156-157del, R158G, R190S, E154K, R190S, D215G, LA242-243del, LAL242-244del, R246I, RSYLTPG246-252del, D253N, D253G, R346K, K417N, K417T, Y449H, L452R, L452Q, T478K, E484K, E484Q, F490S, N501Y, A570D, D614G, H655Y, Q677H, N679K, P681H, P681R, A701V, T716I, T859N, F888L, D950N, S982A, K986P, V987P, Q1071H, T1027I, D1118H, and V1176F, Combinations include, for example, substitutions found in the spike protein of the “UK” or “alpha” variant of the SARS-COV-2 virus (HV69-70del, Y144del, N501Y, A570D, D614G, P681H, T716I, S982A, and D118H); substitutions found in the spike protein of the “South Africa” or “beta” variant of the SARS-COV-2 virus (D80A, LAL242-244del, R246I, K417N, E48K, N501Y, D614G, and A701V); substitutions found in the spike protein of the “Brazil” variant of the SARS-COV-2 virus (L18F, T20N, P26S, D138Y, R190S, K417T, E484K, N501Y, D614G, H655Y, T10271, and V1176F); and/or the substitutions of variants found in
[0046] In various embodiments, the encoded spike protein comprises a set of mutations listed in
[0047] An exemplary mRNA encoding the SARS-CoV-2 spike protein is shown herein as SEQ ID NO: 2 or 4, which optionally contains one or more modified nucleotides as described herein. In some embodiments, the mRNA contains no modified nucleotides, or has all U nucleotides substituted with ψ or N1-methyl-pseudouridine.
[0048] In other aspects and embodiments, the mRNA encodes a therapeutic protein. In some embodiments, mRNA is targeted for expression in tissue or organs selected from liver (e.g., hepatocytes), skin (e.g., keratinocytes), skeletal muscle, endothelial cells, epithelial cells of various organs including the lungs, or hematopoietic or immune cells (e.g., T cells, B cells, or macrophages), for example. For example, the mRNA constructs may be designed to encode polypeptides of interest selected from vaccine targets, enzymes (including metabolic enzymes), antibodies or antigen-binding fragments thereof or antibody mimetics (including nanobodies or single chain antibodies), secreted proteins or peptides (including cytokines, growth factors, or soluble receptors for the same), plasma membrane proteins, cytoplasmic or cytoskeletal proteins, intracellular membrane bound proteins, nuclear proteins, proteins associated with human disease (including proteins having loss-of-function or gain-of-function mutations associated with human disease). In some embodiments, the therapeutic protein includes one or more cancer-associated epitopes (e.g., one or more mutations associated with cancer, including neoantigens), which may find use in a cancer vaccine. An exemplary embodiment in which the mRNA encodes for an antibody, open reading frames encoding heavy and light chains can be expressed from different mRNA molecules.
[0049] In some embodiments, the mRNA encodes one or more proteins of a virus or one or more polypeptides derived from virus proteins, for example, a DNA or RNA virus. Examples include those of the family Paramyxoviridae and/or genus Pneumovirinae or Morbillivirus. Example viruses include human metapneumovirus (hMPV), parainfluenza virus (hPIV), (types 1, 2, and 3), respiratory syncytial virus (RSV), and Measles virus (MeV). In some embodiments, the RNA virus is a coronavirus (CoV) (subfamily Coronavirinae, of the family Coronaviridae). In some embodiments, the coronavirus is a betacoronavirus, such as SARS-CoV or MERS-CoV. In some embodiments, the RNA virus is SARS-CoV-2, or a natural variant thereof. In other embodiments, the virus is a herpes virus, such as a herpes simplex virus or varicella zoster virus. In other embodiments, the virus is RSV, a hepatitis virus, or an adenovirus. In still other embodiments, the virus is an Ebola virus. In some embodiments the virus is an influenza virus. In other embodiments the virus is a Zika virus.
[0050] In some embodiments, the mRNA encodes one or more viral structural proteins or one or more polypeptides derived from virus proteins, such as a protein comprised in the viral envelop, such as a spike protein (S) for coronaviruses. Alternatively or in addition, the mRNA encodes other CoV structural proteins such as M (membrane) glycoprotein, E (envelope) protein, and/or N (nucleocapsid) protein. Alternatively, an mRNA encoding the spike protein or other structural protein can be encapsulated in particles that comprise or are decorated with one or more CoV structural proteins or portions thereof.
[0051] In some embodiments, the mRNA encodes one or more influenza virus proteins, such as neuraminidase (NA), hemagglutinin (HA), matrix protein 2 (M2), and/or nucleoprotein (NP).
[0052] In certain aspects, the disclosure provides a method for synthesizing the mRNA described herein. The method comprises contacting a linear DNA template encoding the mRNA under control of a promoter, with an RNA polymerase (e.g., T7 RNA polymerase) that recognizes said promoter and nucleotide triphosphate (NTP) reagents. In some embodiments, the process is performed according to an in vitro transcription process, as is known in the art. In still other embodiments, the process takes place as a cell-free process as described in WO 2020/205793, which is hereby incorporated by reference in its entirety.
[0053] In some embodiments, the DNA template, the RNA polymerase, and NTP reagents are contacted in a cell-free system synthesizing the NTP reagents from precursors. In some embodiments, the precursors comprise nucleosides, nucleotide monophosphate (NMP) reagents (e.g., which can be prepared by depolymerization of cellular RNA). For example, a cell-free method for synthesizing the mRNA may employ cellular RNA as a source of NTP substrates. The method may comprise incubating in a reaction mixture cellular RNA and one or more enzymes that depolymerize RNA under conditions wherein the cellular RNA is substantially depolymerized to produce 5′ nucleoside monophosphates. These RNA depolymerizing enzymes are eliminated or inactivated, and the nucleoside monophosphates are incubated with a second reaction mixture, which may comprise at least one polyphosphate (PPK) kinase and a phosphate donor. In some embodiments, the second reaction mixture comprises at least one cytidine monophosphate (CMP) kinase, at least one uridine monophosphate (UMP) kinase, at least one guanosine monophosphate (GMP) kinase, and at least one nucleoside-diphosphate (NDP) kinase, under conditions where nucleotide triphosphates (NTPs) are produced. The NTPs are contacted with at least one RNA polymerase (e.g., T7 RNA polymerase) and the DNA template encoding the mRNA. In some embodiments, the reaction may further comprise reagents for capping the mRNA produced (i.e., by co-transcriptional capping), or optionally, this step is performed subsequently (i.e., by enzymatic means). Further, in some embodiments, the polyA tail is not encoded in the DNA template, and is added post-transcriptionally (e.g., in a separate reaction) by a polyA polymerase in the presence of ATP. In some embodiments, the polyA tract is encoded by the DNA template.
[0054] Other cell-free processes for mRNA synthesis are described in U.S. Pat. No. 10,858,385 and WO 2020/205793, which are hereby incorporated by reference in their entireties.
[0055] In some embodiments, the present disclosure provides an mRNA composition comprising the mRNA as described herein, or synthesized according to the method described herein, and combined with a transfection agent or encapsulated within a delivery vehicle.
[0056] Any of the known transfection agents and delivery vehicles may be used, including those that sequestrate the mRNA into vesicles. An exemplary transfection agent is lipofectamine. Alternatively, the delivery vehicle comprises a lipid nanoparticle (LNP), having the mRNA encapsulated therein. In various embodiments, the LNPs comprise a cationic or ionizable lipid, a neutral lipid or phospholipid, a structural lipid such as a cholesterol or cholesterol moiety, and a PEGylated lipid. Lipid particle formulations that find use with embodiments of the present disclosure include those described in U.S. Pat. Nos. 9,738,593; 10,221,127; and 10,166,298, which are hereby incorporated by reference in their entirety. See also, Schoenmaker, L., Witzigmann, D., Kulkarni, J. A., Verbeke, R., Kersten, G., Jiskoot, W., & Crommelin, D. J. (2021), mRNA-lipid nanoparticle COVID-19 vaccines: Structure and stability. Int. J. Pharm., 601, 120586.
[0057] In some embodiments, the lipid nanoparticle (or LNP) comprises a structural lipid. Exemplary structural lipids can be selected from one or more of cholesterol, fecosterol, sitosterol, ergosterol, campesterol, stigmasterol, brassicasterol, tomatidine, ursolic acid, and tocopherols (e.g., alpha tocopherol). In some embodiments, the structural lipid is cholesterol.
[0058] In some embodiments, the LNP comprises one or more phospholipids. Exemplary phospholipids are selected from the group consisting of cardiolipins, sterol modified lipids (modified with a cholesterol moiety attached at the sn-2 carbon of the glycerol backbone), mixed-acyl glycerophospholipids, and symmetrical acyl glycerophospholipids. Head groups for acyl glycerophospholipids include, for example, phosphatidic acid, lysophosphatidic acid, phosphatidylcholine, phosphatidylethanolamine, phosphatidylglycerol, phosphoinositides, and phosphatidylserine. Exemplary phospholipids are selected from 1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC), 1,2-dimyristoyl-sn-glycero-phosphocholine (DMPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC), 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC), 1,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC), 1-oleoyl-2-cholesterylhemisuccinoyl-sn-glycero-3-pho spho cho line (OChemsPC), 1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC), 1,2-dilinolenoyl-sn-glycero-3-phosphocholine, 1,2-diarachidonoyl-sn-glycero-3-phosphocholine, 1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine, 1,2-dioleoyl-sn-glycero-3-phosphoethanol amine (DOPE), 1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16.0 PE), 1,2-distearoyl-sn-glycero-3-phosphoethanolamine, 1,2-dilinoleoyl-sn-glycero-3-phosphoethano lamine, 1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine, 1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine, 1,2-didocosahexaenoyl-sn-glycero-3-phosphoethano lamine, 1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt (DOPG), and sphingomyelin.
[0059] In some embodiments, the lipid nanoparticle composition further comprises one or more PEG lipids. A PEG lipid is a lipid modified with polyethylene glycol. Exemplary PEG lipids are selected from one or more of a PEG-modified phosphatidylethanolamine, a PEG-modified phosphatidic acid, a PEG-modified ceramide, a PEG-modified dialkylamine, a PEG-modified diacylglycerol, and a PEG-modified dialkylglycerol. A PEG lipid may be selected from PEG-c-DOMG, PEG-DMG, PEG-DLPE, PEG-DMPE, PEG-DPPC, PEG-Cholesterol, PEG tocopherol, or a PEG-DSPE lipid.
[0060] In some embodiments, the lipid nanoparticle composition comprises 1,2-dimyristoyl-rac-glycero-3-methoxypolyethylene glycol-2000 (DMG-PEG).
[0061] In some embodiments, the lipid nanoparticle composition comprises a structural lipid, a PEG lipid, and a phospholipid, each optionally according to the preceding paragraphs. In exemplary embodiments, the LNP comprises 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), cholesterol, and 1,2-dimyristoyl-rac-glycero-3-methoxypolyethylene glycol-2000 (DMG-PEG).
[0062] In some embodiments, the formulated mRNA is delivered in vivo (e.g., by injection or orally). In still other embodiments, the mRNA described herein is introduced into a cell ex vivo, and the cell may be administered to a patient. Exemplary cells include non-adherent cells such as white blood cells (T cells including CAR-T cells, B cells, dendritic cells, or macrophages), stem cells, or fibroblasts.
[0063] In some aspects, the disclosure provides a method for preventing or reducing the probability of SARS-CoV-2 infection in a patient. In these embodiments, the method comprises administering the mRNA vaccine expressing SARS-CoV-2 spike protein and/or other SARS-CoV-2 structural protein as described herein. In some embodiments, the mRNA vaccine is administered as a single dose. In some embodiments, the mRNA vaccine is administered as multiple (e.g., two) doses, with a booster one, two, or three weeks after the initial dose.
[0064] In some aspects, the disclosure provides a method for expressing a therapeutic protein in a patient, comprising administering the mRNA composition described herein. For example, diseases, disorders, and/or conditions for treatment or prevention, include: autoimmune disorders (e.g., diabetes, lupus, multiple sclerosis, psoriasis, rheumatoid arthritis); inflammatory disorders (e.g., arthritis, pelvic inflammatory disease); infectious diseases (e.g., viral infections, bacterial infections, fungal infections, and sepsis); neurological disorders (e.g., Alzheimer's disease, Huntington's disease; autism; Duchenne muscular dystrophy); cardiovascular disorders (e.g., atherosclerosis, hypercholesterolemia, thrombosis, clotting disorders, angiogenic disorders such as macular degeneration); metabolic disorders and liver disorders (e.g., ornithine transcarbamylase deficiency); proliferative disorders (e.g., cancer, benign neoplasms); respiratory disorders (e.g., chronic obstructive pulmonary disease or idiopathic pulmonary fibrosis); digestive disorders (e.g., inflammatory bowel disease, ulcers); musculoskeletal disorders (e.g., fibromyalgia, arthritis); endocrine, metabolic, and nutritional disorders (e.g., diabetes, osteoporosis); urological disorders (e.g., renal disease); psychological disorders (e.g., depression, schizophrenia); skin disorders (e.g., wounds, eczema); and blood and lymphatic disorders (e.g., anemia, hemophilia).
[0065] Exemplary diseases characterized by dysfunctional or aberrant protein activity include cystic fibrosis, sickle cell anemia, epidermolysis bullosa, amyotrophic lateral sclerosis, and glucose-6-phosphate dehydrogenase deficiency. In various embodiments, the present disclosure provides a method for treating such conditions or diseases in a patient by introducing an mRNA encoding for a protein that overcomes the aberrant protein activity present in the cell of the patient. Specific examples of a dysfunctional protein are the missense mutation variants of the cystic fibrosis transmembrane conductance regulator (CFTR) gene, which produce a dysfunctional protein variant of CFTR protein, which causes cystic fibrosis.
[0066] Other diseases characterized by missing or substantially diminished protein activity (such that proper, normal or physiological protein function does not occur) include cystic fibrosis, Niemann-Pick type C, β thalassemia major, Duchenne muscular dystrophy, Hurler
[0067] Syndrome, Hunter Syndrome, and Hemophilia A. Such proteins may not be present or are essentially non-functional. The present disclosure provides a method for treating such conditions or diseases in a patient by introducing mRNA provided herein, wherein the mRNA encodes for a protein that replaces the protein activity missing from the target cells of the patient.
[0068] As used herein, the term “about” means ±10% of an associated numerical value.
[0069] As used herein, the word “include,” and its variants, is intended to be non-limiting, such that recitation of items in a list is not to the exclusion of other like items that may also be useful in the compositions and methods of this technology.
[0070] Although the open-ended term “comprising,” as a synonym of terms such as including, containing, or having, is used herein to describe and claim the invention, the present invention, or embodiments thereof, may alternatively be described using alternative terms such as “consisting of” or “consisting essentially of.”
[0071] Other aspects and embodiments of the invention will be apparent from the following Examples.
EXAMPLES
[0072] The SARS-CoV-2 coronavirus was first described in Wuhan, China in December 2019, and has resulted in over 100 million cases of associated disease (COVID-19) and over two million deaths globally. In the US, and as of February 2021, over 25 million COVID-19 cases have been identified and over 450,000 deaths have occurred due to this pandemic. Development of preventive vaccines is critical for the control of SARS-CoV-2 infection in the population.
Example 1
Design of Synthetic mRNA Encoding SARS-CoV-2 Spike Glycoprotein
[0073] This example describes design of synthetic messenger RNA (mRNA) molecules encoding the full-length spike (S) glycoprotein of the coronavirus SARS-CoV-2, which may be encapsulated in lipid nanoparticles (LNPs) for use as vaccines against SARS-CoV-2. The mRNA molecules have the following characteristics:
[0074] (1) Encode a full-length wild-type spike protein, i.e., without prefusion stabilization or other changes that alter the protein's conformation as an antigen;
[0075] (2) 5′ and 3′ untranslated regions (UTRs) derived from those of the human beta-globin (HBG) gene;
[0076] (3) The initial transcribed sequence (ITS) present at the 5′ end of the 5′ UTR (SEQ ID NO: 7) is an artificial sequence that improves titer and quality in RNA synthesis reactions; and
[0077] (4) A unique codon-optimized open reading frame.
[0078] According to the following example, two mRNA vaccines against COVID-19 were produced. These vaccines involve one mRNA product encapsulated in a solid lipid nanoparticle for delivery. With the exception of the 5′ cap, a first design consists of unmodified A, C, G, and U nucleotides (referred to herein as GLB-COV-2-042). In a second design, the uridine nucleotides are replaced by pseudouridine nucleotides (referred to herein as GLB-COV-2-043).
[0079] While 042 and 043 both code for the wildtype Wuhan spike protein, in other embodiments, mRNA vaccines against COVID-19 may exchange this portion of the sequence for a sequence that codes for any variant version of the spike protein, including those set forth in
[0080] Molecule Design
[0081]
[0082] The mRNA molecules have the nucleotide sequence of SEQ ID NO: 6 and 7, which includes the following elements (shown emphasized in SEQ ID NO: 6 and 7): A 5′ cap 1 structure .sup.m7G(5′)ppp(5′)(.sup.2′OMeA), as well as an initial transcribed sequence (ITS) of 15 nucleotides (SEQ ID NO: 11). The ITS improves production titers, reduces sequence-to-sequence variability in titer and improves quality by reducing abortive transcription products. The first nucleotide of the ITS is A, which also allows for efficient co-transcriptional capping using CleanCap ™ AG. Following the ITS, the 5′ untranslated region (UTR) further comprises a sequence derived from the human (3-globin gene (NG 059281.1) (SEQ ID NO: 12). The 5′ UTR further includes a strong Kozak sequence before the initiation codon (SEQ ID NO: 13). The open reading frame (ORF) encoding the amino acid sequence of the wild-type spike (S) glycoprotein from SARS-CoV-2 (QHD43416.1) is represented by SEQ ID NO: 5. The nucleotide sequence of the ORF is codon-optimized to maximize GC-content and minimize U-content to reduce off-target immunogenicity, and to ablate Esp3I (SEQ ID NO: 1) or BspQI (SEQ ID NO: 3) and BsmB1 (SEQ ID NO: 1 and SEQ ID NO: 3) recognition sites in the open reading frame. The 3′ untranslated region from the human β-globin gene follows the stop codon and is represented by SEQ ID NO: 14. The mRNA has a 3′ poly(A) sequence of 100 nucleotides (SEQ ID NO: 15). The same construct may be used for a different vaccine or for a therapeutic product by replacing the ORF encoding the amino acid sequence of the SARS-CoV-2 spike protein, with an ORF encoding the amino acid sequence of any known antigen or therapeutic protein.
[0083] Molecule Production and Biochemical Characterization
[0084] mRNAs were produced using the cell-free production platform as described in WO 2020/205793, which is hereby incorporated by reference in its entirety. Briefly, nucleoside 5′-monophosphates and cap analog (C1eanCap™ AG reagent, TriLink BioTechnologies, Inc.) were incubated in the presence of NMP kinases, NDP kinase, polyphosphate kinase, RNA polymerase, and a linearized DNA template to produce the mRNA molecules. Linearized DNA templates were derived from a minimal pUC19-derived plasmid, which encoded the amino acid sequence of SEQ ID NO: 5, with a 3′ Esp3I site for linearization.
[0085] Plasmids were propagated in E. coli strain DH10b (Thermo Fisher), purified via Plasmid Giga Kit (Qiagen), linearized by treatment with restriction enzyme (e.g., Esp3I, New England BioLabs), and the linearized plasmid was purified by phenol-chloroform extraction. After RNA synthesis, the plasmid template was removed by treatment with TURBO DNase (Thermo Fisher), and the RNA was recovered by lithium chloride precipitation. mRNAs were further purified by reverse phase-ion pair HPLC, concentrated to 1 mg/mL, then frozen.
[0086] RNAs were characterized for purity and quality in biochemical assays. Capillary electrophoresis (
[0087] In Vitro Characterization
[0088] Spike protein expression was analyzed by western blot using HEK293T cells (ATCC) as shown in
[0089] Spike protein expression was further analyzed by enzyme-linked immunosorbent assay (ELISA) as shown in
[0090] As shown in
[0091] mRNA was encapsulated for animal studies using an LNP substantially as described in Schoenmaker, L., Witzigmann, D., Kulkarni, J. A., Verbeke, R., Kersten, G., Jiskoot, W., & Crommelin, D. J. (2021), mRNA-lipid nanoparticle COVID-19 vaccines: Structure and stability. Int. J. Pharm., 601, 120586.
Example 2
Constructs with ITS Comprising A-Start Produce Capped RNA at High Titer and Purity Using Co-Transcriptional Capping Reagents
[0092] A pair of mRNA molecules were designed and produced in cell-free reactions. Both molecules consisted of a similar sequence architecture, incorporating a 5′ ITS GGGAGACCAGGAATT (SEQ ID NO: 10) or AGGAGACCAGGAATT (SEQ ID NO: 11). mRNA sequences, were encoded on a pUC-19 derived plasmid template along with a T7 promoter at the 5′ end and a restriction endonuclease recognition site. Plasmids were propagated in E. coli strain DH10b, purified by Plasmid Giga Kits (Qiagen), linearized by digestion with Esp3I restriction endonucleases (New England BioLabs), and further purified by phenol-chloroform extraction. RNA synthesis reactions were performed using a cell-free production platform as described in WO 2020/205793, which is hereby incorporated by reference in its entirety. Reactions producing capped RNAs also included C1eanCap™ AG reagent (TriLink BioTechnologies). Template DNA was removed by treatment with DNase I, then RNA was recovered by lithium chloride precipitation.
[0093] Recovered RNA was quantified by UV absorbance at 260 nm and analyzed for size and quality using a 2100 Bioanalyzer instrument (Agilent Technologies).
[0094] As shown in
[0095] ITS in mRNAs encoding different proteins resulted in consistent production titers and molecule quality. As shown in
[0096] A family of mRNA molecules were designed and produced in cell-free reactions. Sequences incorporated the 5′ ITS AGGAGACCAGGAAUU (SEQ ID NO: 11), a 5′ UTR sequence from the human beta-globin (HBG) gene (SEQ ID NO: 12), an open reading frame, a 3′ HBG UTR (SEQ ID NO: 14), and a 100-nucleotide polyA tail (SEQ ID NO: 15). RNA synthesis reactions were performed using a cell-free production platform as described in WO 2020/205793, which is hereby incorporated by reference in its entirety. Reactions producing capped RNAs also included CleanCap™ AG reagent (TriLink BioTechnologies). Plasmids were propagated in E. coli strain DH10b, purified by Plasmid Giga Kits (Qiagen), linearized by digestion with Esp3I or BspQI restriction endonucleases (New England BioLabs), and further purified by phenol-chloroform extraction. Template DNA was removed by treatment with DNase I, then RNA was recovered by lithium chloride precipitation. Recovered RNA was quantified by UV absorbance at 260 nm and analyzed for size and quality using a Fragment Analyzer instrument (Agilent Technologies).
Example 3
Neutralizing Serum Antibody Titers
[0097] Immunogenicity and protection from SARS-CoV-2 for GLB-COV2-042 and -043 were evaluated in a golden Syrian hamster model. The hamsters were vaccinated with 100 μg, 30 μg, or 5 μg of GLB-COV2-042 or GLB-COV2-043 at the outset of the study and again on day 21. Serum Nab titers against the WA-1 strain of SARS-CoV-2 were quantified by FRNT. Results on days 21 and 39 are shown in
[0098] Immunization at all doses for each variant, measured at day 21 and day 39, significantly (p<0.001) increased the serum neutralization geometric mean titer compared to mock-vaccinated or control animals receiving LNP or saline alone. These data demonstrated that both GLB-COV2 mRNA vaccines induced high titers of neutralizing anti-SARS-CoV-2 antibodies.
Example 4
Morbidity in Vaccinated Hamsters Following SARS-CoV-2 Challenge
[0099] To evaluate morbidity, hamsters challenged by SARS-CoV-2 were vaccinated with 100, 30, or 5 μg of GLB-COV2-042 or GLB-COV2-043 on days 0 and 21 and intranasally challenged on day 42 with the Wuhan strain of SARS-CoV-2. Percent body weight change of each vaccination group was measured over 14 days post-infection. Results are shown in
Example 5
Infectious Virus Titers and Viral RNA Levels in Lungs and Nasopharynx
[0100] In order to evaluate the effects of vaccination on virus titers and viral RNA levels in the lungs and nasopharynx, eight hamsters were vaccinated with 5, 30, or 100 μg of GLB-COV2-042 or GLB-COV2-043 on days 0 and 21 and challenged on day 42 with the Wuhan strain of SARS-CoV-2. At days 2 and 4 post challenge, virus titers and RNA levels were evaluated in lung and nasopharynx tissue. To quantify viral RNA levels, RT-qPCR was used to detect the number of nucleocapsid (N) gene copies per gram of tissue. Infectious virus titers were determined by TCID.sub.50 assay and reported as TCID.sub.50/gram of tissue.
[0101] Results for lung tissue are shown in
[0102]
[0103]
[0104] Nasopharynx results from the same assays are shown in
Example 6
Mice Neutralizing Antibodies Titers to SARS-CoV-2 and Variants
[0105] To measure the neutralizing antibody levels in sera samples isolated from mice immunized with GLB mRNA vaccine candidates, a pseudovirus neutralization assay was used to measure functional neutralizing antibody responses against the Wuhan (wildtype) SARS-CoV-2 and variants of concern (VoC) Beta and Delta. The Pseudovirus is a nonreplicating and viral particle that uses the murine leukemic virus (MLV) backbone and expresses the spike protein from SARS-CoV-2. The virus has a luciferase reporter plasmid. Wild type C57BL/6 mice were immunized with the vaccine candidates. The mice sera were incubated with pseudotyped virus for 1 hour and added to a HEKACE2 (cell expressing the human ACE2 receptor) cell line to measure the relative light units (RLU) given by the luciferase luminescence when the pseudoviral particles enter the cells. If the serum is highly neutralizing, the luciferase expression will be lower as the pseudovirus will be blocked from infecting the HEKACE2 cells. The final 50% neutralizing titers (NT50) are calculated based on a non-linear regression curve fit using GraphPad Prism 9 software.
[0106] Mice were immunized with the vaccine candidates GLB-COV-2-043 (Wuhan), GLB-COV-2-047 (Beta), and GLB-COV-2-048 (Beta S-2P) on a regimen of prime and boost 21 days apart (prime day 0 and boost day 21). The mice were euthanized on day 42, and blood (serum) and lymphoid tissue (spleen) were collected to analyze humoral and cellular immune responses.
[0107]
Example 7
Cellular Responses to GLB Vaccine Candidates in Mice by T Cell Assay
[0108] Mice were immunized with the vaccine candidates GLB-COV-2-043 (Wuhan), GLB-COV-2-047 (Beta), and GLB-COV-2-048 (Beta, prefusion stabilized) on a regimen of prime and boost 21 days apart (prime day 0 and boost day 21). The mice were euthanized on day 42. The lymphoid tissues (spleen) were collected and analyzed for T CD4+and T CD8+immune responses.
[0109] From the harvested spleens, splenocytes were isolated from the mice immunized with 10 μg or 1 μg of GLB-COV2-043,-047, and -048's vaccine candidates and in vitro stimulated with Wuhan, β, and κ SARS-CoV-2 spike protein-peptide pools, overnight. The next day, the cells were analyzed by multicolor flow cytometry for intracellular cytokine production.
[0110] Individual data for stimulation with peptide pools WT, β, and κ are shown in
Example 8
Studies with Vaccine Booster Shot
[0111] To measure the effect of a vaccine booster shot (third shot of an mRNA SARS-CoV-2 candidate) and the longitudinal neutralizing antibody levels in sera, blood samples isolated from wild type C57BL/6 mice, at several time points, immunized with the GLB mRNA vaccine candidate GLB-COV-2-043. Pseudovirus neutralization assay was used to access homologous and heterologous neutralizing antibodies to SARS-CoV-2 native and variant of concerns pseudotyped viruses to evaluate the Nab levels longitudinally.
[0112] The sera of mice vaccinated with 10 μg of GLB-COV-2-043 day 0 (prime), day 21 (boost), and a second boost on day 132 (four months from the first boosting injection) were tested at several time points (days 21, 42, 98, 132, 154, and 168) and compared to the saline group.
[0113] The experiments were carried out used a nonreplicating pseudovirus in the murine leukemic virus (MLV) backbone that expressed spike proteins from SARS-CoV-2 Wuhan, Omicron, Alpha, Beta, Delta, or Gamma variants. The pseudovirus virus has a luciferase reporter plasmid, which can be measured by luciferase emission when the particle enters a cell. The mice sera were incubated with pseudotyped virus for 1 hour and added to a HEKACE2 (cell expressing the human ACE2 receptor) cell line to measure the relative light units (RLU) given by the luciferase luminescence when the pseudoviral particles enter the cells. If the serum is highly neutralizing, the luciferase expression will be lower as the Pseudovirus will be blocked from infecting the HEKACE2 cells. The final 50% neutralizing titers (NT50) are calculated based on a non-linear regression curve fit using GraphPad Prism 9 software.
[0114] Neutralizing antibodies in serum samples isolated from mice were tested in the pseudovirus neutralization assay to measure functional neutralizing antibody responses against Omicron, Alpha, Gamma, Delta, Beta VOC, and Wuhan (wildtype).
[0115] As shown in
Example 9
ITS-HBG-Kozak 5′ UTR Supports High mRNA Titers Using In Vitro Transcription Reactions
[0116] A combinatorial library of 25 mRNA constructs encoding EGFP were designed and synthesized. The library consisted of all combinations of 5 sequences of 5′ UTR and 5 sequences of 3′ UTR, each flanking an open reading frame encoding EGFP, with a 3′ 100-nucleotide polyA tail encoded in the template followed by a unique BspQI site for linearization. All 5′ UTR sequences contained “AGG” initiator nucleotides for co-transcriptional capping with CleanCap AG reagent (TriLink BioTechnologies, Inc.). A summary of sequence designs is provided in Table 1.
[0117] Plasmid DNA templates encoding the mRNA library were propagated in E. coli strain DH10b, and plasmids recovered by Plasmid Midi Kit (Qiagen). Templates were linearized by BspQI digestion and recovered by phenol-chloroform extraction. RNAs were synthesized in 250 μL reactions using HiScribe™ T7 High Yield RNA Synthesis Kit (New England BioLabs) following manufacturer protocols and including 4 mM CleanCap AG reagent as well as 5 mM N1-methylpseudouridine triphosphate (m1ψTP) in place of UTP. Synthesis reactions were treated with DNase I (Aldevron), recovered by lithium chloride precipitation, resuspended in 250 μL nuclease-free water, and quantified by UV absorbance at 260 nm. Reactions were grouped by 5′ UTR sequence and analyzed via one-way ANOVA.
TABLE-US-00001 TABLE 1 Summary of sequence designs. UTR Sequence ITS (SEQ ID aggagaccaggaauuacauuugcuucug NO: 11)-HBG acacaacuguguucacuagcaaccucaa 5′-(SEQ ID NO: acagagccgcc 12)-Kozak (SEQ (SEQ ID NO: 17) ID NO: 13) 5′ AGG-HBA- agggcgaacuaguacucuucuggucccca Kozak cagacucagagagaacgccacc (SEQ ID NO: 18) 5′ AGG-HSD- agggucccgcagucggcguccagcggcuc Kozak uucugcuuguucgugugugugucguugca ggccuuagccgcc (SEQ ID NO: 19) 5′ AGG-MOD- agggaaauaagagagaaaagaagaguaaga Kozak agaaauauaagagccacc (SEQ ID NO: 20) 5′ AGG-NCA- aggcaaaaaucaaaaucaaucaucaucaca 7d-Kozak acaucaacaaucaaucaucaacacaucauc aagacaccacc (SEQ ID NO: 21) 3′ 2X HBG agcucgcuuucuugcuguccaauuucuauu aaagguuccuuuguucccuaaguccaacua cuaaacugggggauauuaugaagggccuug agcaucuggauucugccuaauaagaaacau uuauugucauugcagcucgcuuucuugcug uccaauuucuauuaaagguuccuuuguucc cuaaguccaacuacuaaacugggggauauu augaagggccuugagcaucuggauucugcc uaauaagaaacauuuauugucauug (SEQ ID NO: 22) 3′ AES-mtRNR1 cugguacugcaugcacgcaaugcuagcugc cccuuucccguccuggguaccccgagucuc ccccgaccucgggucccagguaugcuccca ccuccaccugccccacucaccaccucugcu aguuccagacaccucccaagcacgcagcaa ugcagcucaaaacgcuuagccuagccacac ccccacgggaaacagcagugauuaaccuuu agcaauaaacgaaaguuuaacuaagcuaua cuaaccccaggguugguc aauuucgugccagccacacc (SEQ ID NO: 23) 3′ ALB caucacauuuaaaagcaucucagccuacca ugagaauaagagaaagaaaaugaagaucaa uagcuuauucaucucuuuuucuuuuucguu gguguaaagccaacacccugucuaaaaaac auaaauuucuuuaaucauuuugccucuugu cucugugcuccacucaccaaaaaauggaaa gaaccu (SEQ ID NO: 24) 3′ HBA ugauaauaggcuggagccucgguggccaug cuucuugccccuugggccuccccccagccc cuccuccccuuccugcacccguacccccgu ggucuuugaauaaagucuga (SEQ ID NO: 25) 3′ S27a + R3U uuguguaugcguuaauaaaaagaaggaacu cguaaaaacucaauguauuucugaggaagc guggugcauaaugccacgcagcgucugcau aacuuuuauuauuucuuuuauuaaucaaca aa (SEQ ID NO: 26) HBG = Human β-globin HBA = Human α-globin HSD = Hydroxy steroid dehydrogenase NCA-7d = Synthetic AES-mtRNR1 = Synthetic ALB = Human albumin MOD = Synthetic S27a + R3U = Synthetic
[0118] As shown in
Example 10
ITS Increases In Vitro Transcription Yields in Multiple 5′ UTR and Open Reading Frame Sequence Contexts
[0119] The effect of the ITS on mRNA synthesis by in vitro transcription was assessed. Two 5′ UTR sequences (ITS-HBG-Kozak and AGG-NCA-7d-Kozak, representing high-yielding and low-yielding sequences) were selected based on the results from Example 9. A series of mRNAs were designed to assess the impact of the ITS on synthesis yields in the context of HBG and NCA-7d 5′ UTRs. A summary of the mRNA designs tested is shown in Table 2. Each of the mRNAs contained the same 3′ human beta-globin UTR, as well as a template-encoded polyAioo tail. To assess dependence on the coding sequence, the same series of mRNAs were designed encoding EGFP and the S protein from the Wuhan strain of SARS-CoV-2 coronavirus.
TABLE-US-00002 TABLE 2 Summary of the mRNA designs tested. GFP SARS-CoV-2 Template Template ITS 5′ UTR 5′ Sequence (ITS in Caps) pGLA1959 pGLA1968 SEQ ID 5′ ITS- AGGAGACCAGGAAUUacauuugcuucugac NO: 9 HBG- acaacuguguucacuagcaaccucaaacagagccgcc Kozak (SEQ ID NO: 17) pGLA1960 pGLA1969 SEQ ID 5′ ITS- GGGAGACCAGGAAUUacauuugcuucugac NO: 10 HBG- acaacuguguucacuagcaaccucaaacagagccgcc Kozak (SEQ ID NO: 28) pGLA1961 pGLA1970 — 5′ AGG- AGGacauuugcuucugacacaacuguguucacuagca HBG- accucaaacagagccgcc (SEQ ID NO: 29) Kozak pGLA1962 pGLA1971 — 5′ G- Gacauuugcuucugacacaacuguguucacuagcaacc HBG- ucaaacagagccgcc (SEQ ID NO: 30) Kozak pGLA1966 pGLA1975 SEQ ID 5′ ITS- AGGAGACCAGGAAUUggcaaaaaucaaaauc NO: 9 NCA-7d- aaucaucaucacaacaucaacaaucaaucaucaacacauc Kozak aucaagacaccacc (SEQ ID NO: 31) pGLA1967 pGLA1976 SEQ ID 5′ ITS- GGGAGACCAGGAAUUggcaaaaaucaaaauc NO: 10 NCA-7d- aaucaucaucacaacaucaacaaucaaucaucaacacauc Kozak aucaagacaccacc (SEQ ID NO: 32) PGLA1963 PGLA1972 — AGG-5′ AGGcaaaaaucaaaaucaaucaucaucacaacaucaac NCA-7d- aaucaaucaucaacacaucaucaagacaccacc (SEQ Kozak ID NO: 33) PGLA1964 pGLA1973 — 5′ GG- GGcaaaaaucaaaaucaaucaucaucacaacaucaacaa NCA-7d- ucaaucaucaacacaucaucaagacaccacc (SEQ ID Kozak NO: 34) PGLA1965 pGLA1974 — 5′ GG- Gcaaaaaucaaaaucaaucaucaucacaacaucaacaau NCA-7d- caaucaucaacacaucaucaagacaccacc (SEQ ID Kozak NO: 35)
[0120] Template plasmids encoding the mRNAs described were constructed using Golden Gate assembly based on a high-copy E. coli plasmid backbone. As in Example 9, plasmid templates encoded a 3′ 100-nucleotide polyA tail followed by a unique BspQI site for linearization. Templates were propagated, recovered, and linearized as described in Example 9. mRNAs were synthesized in 100 μL in vitro transcription reactions by incubating T7 RNA polymerase, nucleoside triphosphates (ATP, GTP, CTP, and m1ψTP), and linearized template in a reaction buffer consisting of Tris-HCl and MgSO.sub.4. Reactions synthesizing mRNAs with AGG initiating sequences also included 4 mM CleanCap AG reagent (TriLink BioTechnologies, Inc.). Reactions were incubated for 1 hour, then treated with DNase I prior to recovery by lithium chloride precipitation. Samples were resuspended in 100 μL nuclease-free water and quantified by UV absorbance at 260 nm. Reactions were grouped by 5′ UTR sequence and analyzed via one-way ANOVA.
[0121] As shown in
Example 11
ITS Increases Transcription Yields in Cell-Free RNA Synthesis Reactions in Multiple 5′ UTR and Open Reading Frame Sequence Contexts
[0122] The effect of the ITS on yields in cell-free mRNA synthesis reactions was assessed. A series of mRNAs were synthesized in cell-free reactions using the linearized templates described in Example 10. Cell-free synthesis reactions similar to those described in WO 2020/205793 were used. For mRNAs with AGG initiating sequences, 5 mM CleanCap AG (TriLink BioTechnologies, Inc.) was also included in the reaction. DNase treatment, RNA recovery, and RNA quantification were performed as described for in vitro transcription reactions.
[0123] As shown in
Example 12
ITS Preserves Translational Potency in Multiple 5′ UTR and Coding Sequence Contexts
[0124] The molecules produced in Example 9 were analyzed for potency in cell-based assays by transfecting the mRNA into HEK293FT cells. For GFP potency assays, cells were transfected using Lipofectamine MessengerMAX™ (Thermo Fisher). Potency was assessed as median fluorescence intensity (MFI) of GFP-positive cells compared to a reference GFP mRNA. For spike potency assays, mRNA was transfected using Lipofectamine MessengerMAX (Thermo Fisher) and protein expression was quantified by ELISA. Analysis was performed using one-way ANOVA. As shown in
TABLE-US-00003 SEQUENCES Full length ORF (DNA template) encoding SARS-CoV2 spike protein (Esp3I linearized template) SEQ ID NO: 1 atgttcgtgttcctggtgctgctgccgctggtgagcagccagtgcgtgaacctgacgacgcggacgcagctgc cgccggcgtacacgaacagcttcacgcggggggtgtactacccggacaaggtgttccggagcagcgtgctgca cagcacgcaggacctgttcctgccgttcttcagcaacgtgacgtggttccacgcgatccacgtgagcgggacg aacgggacgaagcggttcgacaacccggtgctgccgttcaacgacggggtgtacttcgcgagcacggagaaga gcaacatcatccgggggtggatcttcgggacgacgctggacagcaagacgcagagcctgctgatcgtgaacaa cgcgacgaacgtggtgatcaaggtgtgcgagttccagttctgcaacgacccgttcctgggggtgtactaccac aagaacaacaagagctggatggagagcgagttccgggtgtacagcagcgcgaacaactgcacgttcgagtacg tgagccagccgttcctgatggacctggaggggaagcaggggaacttcaagaacctgcgggagttcgtgttcaa gaacatcgacgggtacttcaagatctacagcaagcacacgccgatcaacctggtgcgggacctgccgcagggg ttcagcgcgctggagccgctggtggacctgccgatcgggatcaacatcacgcggttccagacgctgctggcgc tgcaccggagctacctgacgccgggggacagcagcagcgggtggacggcgggggcggcggcgtactacgtggg gtacctgcagccgcggacgttcctgctgaagtacaacgagaacgggacgatcacggacgcggtggactgcgcg ctggacccgctgagcgagaccaagtgcacgctgaagagcttcacggtggagaaggggatctaccagacgagca acttccgggtgcagccgacggagagcatcgtgcggttcccgaacatcacgaacctgtgcccgttcggggaggt gttcaacgcgacgcggttcgcgagcgtgtacgcgtggaaccggaagcggatcagcaactgcgtggcggactac agcgtgctgtacaacagcgcgagcttcagcacgttcaagtgctacggggtgagcccgacgaagctgaacgacc tgtgcttcacgaacgtgtacgcggacagcttcgtgatccggggggacgaggtgcggcagatcgcgccggggca gacggggaagatcgcggactacaactacaagctgccggacgacttcacggggtgcgtgatcgcgtggaacagc aacaacctggacagcaaggtgggggggaactacaactacctgtaccggctgttccggaagagcaacctgaagc cgttcgagcgggacatcagcacggagatctaccaggcggggagcacgccgtgcaacggggtggaggggttcaa ctgctacttcccgctgcagagctacgggttccagccgacgaacggggtggggtaccagccgtaccgggtggtg gtgctgagcttcgagctgctgcacgcgccggcgacggtgtgcgggccgaagaagagcacgaacctggtgaaga acaagtgcgtgaacttcaacttcaacgggctgacggggacgggggtgctgacggagagcaacaagaagttcct gccgttccagcagttcgggcgggacatcgcggacacgacggacgcggtgcgggacccgcagacgctggagatc ctggacatcacgccgtgcagcttcgggggggtgagcgtgatcacgccggggacgaacacgagcaaccaggtgg cggtgctgtaccaggacgtgaactgcacggaggtgccggtggcgatccacgcggaccagctgacgccgacgtg gcgggtgtacagcacggggagcaacgtgttccagacgcgggcggggtgcctgatcggggcggagcacgtgaac aacagctacgagtgcgacatcccgatcggggcggggatctgcgcgagctaccagacgcagacgaacagcccgc ggcgggcgcggagcgtggcgagccagagcatcatcgcgtacacgatgagcctgggggcggagaacagcgtggc gtacagcaacaacagcatcgcgatcccgacgaacttcacgatcagcgtgacgacggagatcctgccggtgagc atgacgaagacgagcgtggactgcacgatgtacatctgcggggacagcacggagtgcagcaacctgctgctgc agtacgggagcttctgcacgcagctgaaccgggcgctgacggggatcgcggtggagcaggacaagaacacgca ggaggtgttcgcgcaggtgaagcagatctacaagacgccgccgatcaaggacttcggggggttcaacttcagc cagatcctgccggacccgagcaagccgagcaagcggagcttcatcgaggacctgctgttcaacaaggtgacgc tggcggacgcggggttcatcaagcagtacggggactgcctgggggacatcgcggcgcgggacctgatctgcgc gcagaagttcaacgggctgacggtgctgccgccgctgctgacggacgagatgatcgcgcagtacacgagcgcg ctgctggcggggacgatcacgagcgggtggacgttcggggcgggggcggcgctgcagatcccgttcgcgatgc agatggcgtaccggttcaacgggatcggggtgacgcagaacgtgctgtacgagaaccagaagctgatcgcgaa ccagttcaacagcgcgatcgggaagatccaggacagcctgagcagcacggcgagcgcgctggggaagctgcag gacgtggtgaaccagaacgcgcaggcgctgaacacgctggtgaagcagctgagcagcaacttcggggcgatca gcagcgtgctgaacgacatcctgagccggctggacaaggtggaggcggaggtgcagatcgaccggctgatcac ggggcggctgcagagcctgcagacgtacgtgacgcagcagctgatccgggcggcggagatccgggcgagcgcg aacctggcggcgacgaagatgagcgagtgcgtgctggggcagagcaagcgggtggacttctgcgggaaggggt accacctgatgagcttcccgcagagcgcgccgcacggggtggtgttcctgcacgtgacgtacgtgccggcgca ggagaagaacttcacgacggcgccggcgatctgccacgacgggaaggcgcacttcccgcgggagggggtgttc gtgagcaacgggacgcactggttcgtgacgcagcggaacttctacgagccgcagatcatcacgacggacaaca cgttcgtgagcgggaactgcgacgtggtgatcgggatcgtgaacaacacggtgtacgacccgctgcagccgga gctggacagcttcaaggaggagctggacaagtacttcaagaaccacacgagcccggacgtggacctgggggac atcagcgggatcaacgcgagcgtggtgaacatccagaaggagatcgaccggctgaacgaggtggcgaagaacc tgaacgagagcctgatcgacctgcaggagctggggaagtacgagcagtacatcaagtggccgtggtacatctg gctggggttcatcgcggggctgatcgcgatcgtgatggtgacgatcatgctgtgctgcatgacgagctgctgc agctgcctgaaggggtgctgcagctgcgggagctgctgcaagttcgacgaggacgacagcgagccggtgctga agggggtgaagctgcactacacgtga Full length ORF (RNA) encoding SARS-CoV2 spike protein (from Esp3I linearized template) SEQ ID NO: 2 auguucguguuccuggugcugcugccgcuggugagcagccagugcgugaaccugacgacgcggacgcagcugc cgccggcguacacgaacagcuucacgcgggggguguacuacccggacaagguguuccggagcagcgugcugca cagcacgcaggaccuguuccugccguucuucagcaacgugacgugguuccacgcgauccacgugagcgggacg aacgggacgaagcgguucgacaacccggugcugccguucaacgacgggguguacuucgcgagcacggagaaga gcaacaucauccggggguggaucuucgggacgacgcuggacagcaagacgcagagccugcugaucgugaacaa cgcgacgaacguggugaucaaggugugcgaguuccaguucugcaacgacccguuccuggggguguacuaccac aagaacaacaagagcuggauggagagcgaguuccggguguacagcagcgcgaacaacugcacguucgaguacg ugagccagccguuccugauggaccuggaggggaagcaggggaacuucaagaaccugcgggaguucguguucaa gaacaucgacggguacuucaagaucuacagcaagcacacgccgaucaaccuggugcgggaccugccgcagggg uucagcgcgcuggagccgcugguggaccugccgaucgggaucaacaucacgcgguuccagacgcugcuggcgc ugcaccggagcuaccugacgccgggggacagcagcagcggguggacggcgggggcggcggcguacuacguggg guaccugcagccgcggacguuccugcugaaguacaacgagaacgggacgaucacggacgcgguggacugcgcg cuggacccgcugagcgagaccaagugcacgcugaagagcuucacgguggagaaggggaucuaccagacgagca acuuccgggugcagccgacggagagcaucgugcgguucccgaacaucacgaaccugugcccguucggggaggu guucaacgcgacgcgguucgcgagcguguacgcguggaaccggaagcggaucagcaacugcguggcggacuac agcgugcuguacaacagcgcgagcuucagcacguucaagugcuacggggugagcccgacgaagcugaacgacc ugugcuucacgaacguguacgcggacagcuucgugauccggggggacgaggugcggcagaucgcgccggggca gacggggaagaucgcggacuacaacuacaagcugccggacgacuucacggggugcgugaucgcguggaacagc aacaaccuggacagcaaggugggggggaacuacaacuaccuguaccggcuguuccggaagagcaaccugaagc cguucgagcgggacaucagcacggagaucuaccaggcggggagcacgccgugcaacgggguggagggguucaa cugcuacuucccgcugcagagcuacggguuccagccgacgaacggggugggguaccagccguaccggguggug gugcugagcuucgagcugcugcacgcgccggcgacggugugcgggccgaagaagagcacgaaccuggugaaga acaagugcgugaacuucaacuucaacgggcugacggggacgggggugcugacggagagcaacaagaaguuccu gccguuccagcaguucgggcgggacaucgcggacacgacggacgcggugcgggacccgcagacgcuggagauc cuggacaucacgccgugcagcuucgggggggugagcgugaucacgccggggacgaacacgagcaaccaggugg cggugcuguaccaggacgugaacugcacggaggugccgguggcgauccacgcggaccagcugacgccgacgug gcggguguacagcacggggagcaacguguuccagacgcgggcggggugccugaucggggcggagcacgugaac aacagcuacgagugcgacaucccgaucggggcggggaucugcgcgagcuaccagacgcagacgaacagcccgc ggcgggcgcggagcguggcgagccagagcaucaucgcguacacgaugagccugggggcggagaacagcguggc guacagcaacaacagcaucgcgaucccgacgaacuucacgaucagcgugacgacggagauccugccggugagc augacgaagacgagcguggacugcacgauguacaucugcggggacagcacggagugcagcaaccugcugcugc aguacgggagcuucugcacgcagcugaaccgggcgcugacggggaucgcgguggagcaggacaagaacacgca ggagguguucgcgcaggugaagcagaucuacaagacgccgccgaucaaggacuucgggggguucaacuucagc cagauccugccggacccgagcaagccgagcaagcggagcuucaucgaggaccugcuguucaacaaggugacgc uggcggacgcgggguucaucaagcaguacggggacugccugggggacaucgcggcgcgggaccugaucugcgc gcagaaguucaacgggcugacggugcugccgccgcugcugacggacgagaugaucgcgcaguacacgagcgcg cugcuggcggggacgaucacgagcggguggacguucggggcgggggcggcgcugcagaucccguucgcgaugc agauggcguaccgguucaacgggaucggggugacgcagaacgugcuguacgagaaccagaagcugaucgcgaa ccaguucaacagcgcgaucgggaagauccaggacagccugagcagcacggcgagcgcgcuggggaagcugcag gacguggugaaccagaacgcgcaggcgcugaacacgcuggugaagcagcugagcagcaacuucggggcgauca gcagcgugcugaacgacauccugagccggcuggacaagguggaggcggaggugcagaucgaccggcugaucac ggggcggcugcagagccugcagacguacgugacgcagcagcugauccgggcggcggagauccgggcgagcgcg aaccuggcggcgacgaagaugagcgagugcgugcuggggcagagcaagcggguggacuucugcgggaaggggu accaccugaugagcuucccgcagagcgcgccgcacggggugguguuccugcacgugacguacgugccggcgca ggagaagaacuucacgacggcgccggcgaucugccacgacgggaaggcgcacuucccgcgggaggggguguuc gugagcaacgggacgcacugguucgugacgcagcggaacuucuacgagccgcagaucaucacgacggacaaca cguucgugagcgggaacugcgacguggugaucgggaucgugaacaacacgguguacgacccgcugcagccgga gcuggacagcuucaaggaggagcuggacaaguacuucaagaaccacacgagcccggacguggaccugggggac aucagcgggaucaacgcgagcguggugaacauccagaaggagaucgaccggcugaacgagguggcgaagaacc ugaacgagagccugaucgaccugcaggagcuggggaaguacgagcaguacaucaaguggccgugguacaucug gcugggguucaucgcggggcugaucgcgaucgugauggugacgaucaugcugugcugcaugacgagcugcugc agcugccugaaggggugcugcagcugcgggagcugcugcaaguucgacgaggacgacagcgagccggugcuga agggggugaagcugcacuacacguga Full length ORF (DNA template) encoding SARS-CoV2 spike protein (BspQI linearized template) SEQ ID NO: 3 atgttcgtgttcctggtgctgctgccgctggtgagcagccagtgcgtgaacctgacgacgcggacgcagctgc cgccggcgtacacgaacagcttcacgcggggggtgtactacccggacaaggtgttccggagcagcgtgctgca cagcacgcaggacctgttcctgccgttcttcagcaacgtgacgtggttccacgcgatccacgtgagcgggacg aacgggacgaagcggttcgacaacccggtgctgccgttcaacgacggggtgtacttcgcgagcacggagaaga gtaacatcatccgggggtggatcttcgggacgacgctggacagcaagacgcagagcctgctgatcgtgaacaa cgcgacgaacgtggtgatcaaggtgtgcgagttccagttctgcaacgacccgttcctgggggtgtactaccac aagaacaacaagagctggatggagagcgagttccgggtgtacagcagcgcgaacaactgcacgttcgagtacg tgagccagccgttcctgatggacctggaggggaagcaggggaacttcaagaacctgcgggagttcgtgttcaa gaacatcgacgggtacttcaagatctacagcaagcacacgccgatcaacctggtgcgggacctgccgcagggg ttcagcgcgctggagccgctggtggacctgccgatcgggatcaacatcacgcggttccagacgctgctggcgc tgcaccggagctacctgacgccgggggacagcagcagcgggtggacggcgggggcggcggcgtactacgtggg gtacctgcagccgcggacgttcctgctgaagtacaacgagaacgggacgatcacggacgcggtggactgcgcg ctggacccgctgagcgagaccaagtgcacgctgaagagtttcacggtggagaaggggatctaccagacgagca acttccgggtgcagccgacggagagcatcgtgcggttcccgaacatcacgaacctgtgcccgttcggggaggt gttcaacgcgacgcggttcgcgagcgtgtacgcgtggaaccggaagcggatcagcaactgcgtggcggactac agcgtgctgtacaacagcgcgagcttcagcacgttcaagtgctacggggtgagcccgacgaagctgaacgacc tgtgcttcacgaacgtgtacgcggacagcttcgtgatccggggggacgaggtgcggcagatcgcgccggggca gacggggaagatcgcggactacaactacaagctgccggacgacttcacggggtgcgtgatcgcgtggaacagc aacaacctggacagcaaggtgggggggaactacaactacctgtaccggctgttccggaagagtaacctgaagc cgttcgagcgggacatcagcacggagatctaccaggcggggagcacgccgtgcaacggggtggaggggttcaa ctgctacttcccgctgcagagctacgggttccagccgacgaacggggtggggtaccagccgtaccgggtggtg gtgctgagcttcgagctgctgcacgcgccggcgacggtgtgcgggccgaagaagagtacgaacctggtgaaga acaagtgcgtgaacttcaacttcaacgggctgacggggacgggggtgctgacggagagcaacaagaagttcct gccgttccagcagttcgggcgggacatcgcggacacgacggacgcggtgcgggacccgcagacgctggagatc ctggacatcacgccgtgcagcttcgggggggtgagcgtgatcacgccggggacgaacacgagcaaccaggtgg cggtgctgtaccaggacgtgaactgcacggaggtgccggtggcgatccacgcggaccagctgacgccgacgtg gcgggtgtacagcacggggagcaacgtgttccagacgcgggcggggtgcctgatcggggcggagcacgtgaac aacagctacgagtgcgacatcccgatcggggcggggatctgcgcgagctaccagacgcagacgaacagcccgc ggcgggcgcggagcgtggcgagccagagcatcatcgcgtacacgatgagcctgggggcggagaacagcgtggc gtacagcaacaacagcatcgcgatcccgacgaacttcacgatcagcgtgacgacggagatcctgccggtgagc atgacgaagacgagcgtggactgcacgatgtacatctgcggggacagcacggagtgcagcaacctgctgctgc agtacgggagcttctgcacgcagctgaaccgggcgctgacggggatcgcggtggagcaggacaagaacacgca ggaggtgttcgcgcaggtgaagcagatctacaagacgccgccgatcaaggacttcggggggttcaacttcagc cagatcctgccggacccgagcaagccgagcaagcggagcttcatcgaggacctgctgttcaacaaggtgacgc tggcggacgcggggttcatcaagcagtacggggactgcctgggggacatcgcggcgcgggacctgatctgcgc gcagaagttcaacgggctgacggtgctgccgccgctgctgacggacgagatgatcgcgcagtacacgagcgcg ctgctggcggggacgatcacgagcgggtggacgttcggggcgggggcggcgctgcagatcccgttcgcgatgc agatggcgtaccggttcaacgggatcggggtgacgcagaacgtgctgtacgagaaccagaagctgatcgcgaa ccagttcaacagcgcgatcgggaagatccaggacagcctgagcagcacggcgagcgcgctggggaagctgcag gacgtggtgaaccagaacgcgcaggcgctgaacacgctggtgaagcagctgagcagcaacttcggggcgatca gcagcgtgctgaacgacatcctgagccggctggacaaggtggaggcggaggtgcagatcgaccggctgatcac ggggcggctgcagagcctgcagacgtacgtgacgcagcagctgatccgggcggcggagatccgggcgagcgcg aacctggcggcgacgaagatgagcgagtgcgtgctggggcagagcaagcgggtggacttctgcgggaaggggt accacctgatgagcttcccgcagagcgcgccgcacggggtggtgttcctgcacgtgacgtacgtgccggcgca ggagaagaacttcacgacggcgccggcgatctgccacgacgggaaggcgcacttcccgcgggagggggtgttc gtgagcaacgggacgcactggttcgtgacgcagcggaacttctacgagccgcagatcatcacgacggacaaca cgttcgtgagcgggaactgcgacgtggtgatcgggatcgtgaacaacacggtgtacgacccgctgcagccgga gctggacagcttcaaggaggagctggacaagtacttcaagaaccacacgagcccggacgtggacctgggggac atcagcgggatcaacgcgagcgtggtgaacatccagaaggagatcgaccggctgaacgaggtggcgaagaacc tgaacgagagcctgatcgacctgcaggagctggggaagtacgagcagtacatcaagtggccgtggtacatctg gctggggttcatcgcggggctgatcgcgatcgtgatggtgacgatcatgctgtgctgcatgacgagctgctgc agctgcctgaaggggtgctgcagctgcgggagctgctgcaagttcgacgaggacgacagcgagccggtgctga agggggtgaagctgcactacacgtga Full length ORF (RNA) encoding SARS-CoV2 spike protein (BspQI linearized template) SEQ ID NO: 4 auguucguguuccuggugcugcugccgcuggugagcagccagugcgugaaccugacgacgcggacgcagcugc cgccggcguacacgaacagcuucacgcgggggguguacuacccggacaagguguuccggagcagcgugcugca cagcacgcaggaccuguuccugccguucuucagcaacgugacgugguuccacgcgauccacgugagcgggacg aacgggacgaagcgguucgacaacccggugcugccguucaacgacgggguguacuucgcgagcacggagaaga guaacaucauccggggguggaucuucgggacgacgcuggacagcaagacgcagagccugcugaucgugaacaa cgcgacgaacguggugaucaaggugugcgaguuccaguucugcaacgacccguuccuggggguguacuaccac aagaacaacaagagcuggauggagagcgaguuccggguguacagcagcgcgaacaacugcacguucgaguacg ugagccagccguuccugauggaccuggaggggaagcaggggaacuucaagaaccugcgggaguucguguucaa gaacaucgacggguacuucaagaucuacagcaagcacacgccgaucaaccuggugcgggaccugccgcagggg uucagcgcgcuggagccgcugguggaccugccgaucgggaucaacaucacgcgguuccagacgcugcuggcgc ugcaccggagcuaccugacgccgggggacagcagcagcggguggacggcgggggcggcggcguacuacguggg guaccugcagccgcggacguuccugcugaaguacaacgagaacgggacgaucacggacgcgguggacugcgcg cuggacccgcugagcgagaccaagugcacgcugaagaguuucacgguggagaaggggaucuaccagacgagca acuuccgggugcagccgacggagagcaucgugcgguucccgaacaucacgaaccugugcccguucggggaggu guucaacgcgacgcgguucgcgagcguguacgcguggaaccggaagcggaucagcaacugcguggcggacuac agcgugcuguacaacagcgcgagcuucagcacguucaagugcuacggggugagcccgacgaagcugaacgacc ugugcuucacgaacguguacgcggacagcuucgugauccggggggacgaggugcggcagaucgcgccggggca gacggggaagaucgcggacuacaacuacaagcugccggacgacuucacggggugcgugaucgcguggaacagc aacaaccuggacagcaaggugggggggaacuacaacuaccuguaccggcuguuccggaagaguaaccugaagc cguucgagcgggacaucagcacggagaucuaccaggcggggagcacgccgugcaacgggguggagggguucaa cugcuacuucccgcugcagagcuacggguuccagccgacgaacggggugggguaccagccguaccggguggug gugcugagcuucgagcugcugcacgcgccggcgacggugugcgggccgaagaagaguacgaaccuggugaaga acaagugcgugaacuucaacuucaacgggcugacggggacgggggugcugacggagagcaacaagaaguuccu gccguuccagcaguucgggcgggacaucgcggacacgacggacgcggugcgggacccgcagacgcuggagauc cuggacaucacgccgugcagcuucgggggggugagcgugaucacgccggggacgaacacgagcaaccaggugg cggugcuguaccaggacgugaacugcacggaggugccgguggcgauccacgcggaccagcugacgccgacgug gcggguguacagcacggggagcaacguguuccagacgcgggcggggugccugaucggggcggagcacgugaac aacagcuacgagugcgacaucccgaucggggcggggaucugcgcgagcuaccagacgcagacgaacagcccgc ggcgggcgcggagcguggcgagccagagcaucaucgcguacacgaugagccugggggcggagaacagcguggc guacagcaacaacagcaucgcgaucccgacgaacuucacgaucagcgugacgacggagauccugccggugagc augacgaagacgagcguggacugcacgauguacaucugcggggacagcacggagugcagcaaccugcugcugc aguacgggagcuucugcacgcagcugaaccgggcgcugacggggaucgcgguggagcaggacaagaacacgca ggagguguucgcgcaggugaagcagaucuacaagacgccgccgaucaaggacuucgggggguucaacuucagc cagauccugccggacccgagcaagccgagcaagcggagcuucaucgaggaccugcuguucaacaaggugacgc uggcggacgcgggguucaucaagcaguacggggacugccugggggacaucgcggcgcgggaccugaucugcgc gcagaaguucaacgggcugacggugcugccgccgcugcugacggacgagaugaucgcgcaguacacgagcgcg cugcuggcggggacgaucacgagcggguggacguucggggcgggggcggcgcugcagaucccguucgcgaugc agauggcguaccgguucaacgggaucggggugacgcagaacgugcuguacgagaaccagaagcugaucgcgaa ccaguucaacagcgcgaucgggaagauccaggacagccugagcagcacggcgagcgcgcuggggaagcugcag gacguggugaaccagaacgcgcaggcgcugaacacgcuggugaagcagcugagcagcaacuucggggcgauca gcagcgugcugaacgacauccugagccggcuggacaagguggaggcggaggugcagaucgaccggcugaucac ggggcggcugcagagccugcagacguacgugacgcagcagcugauccgggcggcggagauccgggcgagcgcg aaccuggcggcgacgaagaugagcgagugcgugcuggggcagagcaagcggguggacuucugcgggaaggggu accaccugaugagcuucccgcagagcgcgccgcacggggugguguuccugcacgugacguacgugccggcgca ggagaagaacuucacgacggcgccggcgaucugccacgacgggaaggcgcacuucccgcgggaggggguguuc gugagcaacgggacgcacugguucgugacgcagcggaacuucuacgagccgcagaucaucacgacggacaaca cguucgugagcgggaacugcgacguggugaucgggaucgugaacaacacgguguacgacccgcugcagccgga gcuggacagcuucaaggaggagcuggacaaguacuucaagaaccacacgagcccggacguggaccugggggac aucagcgggaucaacgcgagcguggugaacauccagaaggagaucgaccggcugaacgagguggcgaagaacc ugaacgagagccugaucgaccugcaggagcuggggaaguacgagcaguacaucaaguggccgugguacaucug gcugggguucaucgcggggcugaucgcgaucgugauggugacgaucaugcugugcugcaugacgagcugcugc agcugccugaaggggugcugcagcugcgggagcugcugcaaguucgacgaggacgacagcgagccggugcuga agggggugaagcugcacuacacguga SARS-CoV2 spike protein amino acid sequence (GenBank: OHD43416.1) SEQ ID NO: 5 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGT NGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYH KNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQG FSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCA LDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADY SVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVV VLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEI LDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVN NSYECDIPIGAGICASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVS MTKTSVDCTMYICGDSTECSNLLLQYGSFCTQLNRALTGIAVEQDKNTQEVFAQVKQIYKTPPIKDFGGFNFS QILPDPSKPSKRSFIEDLLFNKVTLADAGFIKQYGDCLGDIAARDLICAQKFNGLTVLPPLLTDEMIAQYTSA LLAGTITSGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKLIANQFNSAIGKIQDSLSSTASALGKLQ DVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASA NLAATKMSECVLGQSKRVDFCGKGYHLMSFPQSAPHGVVFLHVTYVPAQEKNFTTAPAICHDGKAHFPREGVF VSNGTHWFVTQRNFYEPQIITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDKYFKNHTSPDVDLGD ISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCC SCLKGCCSCGSCCKFDEDDSEPVLKGVKLHYT mRNA sequence encoding SARS-CoV2 spike protein (Esp3I linearized template), and including non-coding regions (ITS, 5′ UTR,
, 3′ UTR) SEQ ID NO: 6 m7Gaggagaccaggaauuacauuugcuucugacacaacuguguucacuagcaaccucaaacaga
caug uucguguuccuggugcugcugccgcuggugagcagccagugcgugaaccugacgacgcggacgcagcugccgc cggcguacacgaacagcuucacgcgggggguguacuacccggacaagguguuccggagcagcgugcugcacag cacgcaggaccuguuccugccguucuucagcaacgugacgugguuccacgcgauccacgugagcgggacgaac gggacgaagcgguucgacaacccggugcugccguucaacgacgggguguacuucgcgagcacggagaagagca acaucauccggggguggaucuucgggacgacgcuggacagcaagacgcagagccugcugaucgugaacaacgc gacgaacguggugaucaaggugugcgaguuccaguucugcaacgacccguuccuggggguguacuaccacaag aacaacaagagcuggauggagagcgaguuccggguguacagcagcgcgaacaacugcacguucgaguacguga gccagccguuccugauggaccuggaggggaagcaggggaacuucaagaaccugcgggaguucguguucaagaa caucgacggguacuucaagaucuacagcaagcacacgccgaucaaccuggugcgggaccugccgcagggguuc agcgcgcuggagccgcugguggaccugccgaucgggaucaacaucacgcgguuccagacgcugcuggcgcugc accggagcuaccugacgccgggggacagcagcagcggguggacggcgggggcggcggcguacuacguggggua ccugcagccgcggacguuccugcugaaguacaacgagaacgggacgaucacggacgcgguggacugcgcgcug gacccgcugagcgagaccaagugcacgcugaagagcuucacgguggagaaggggaucuaccagacgagcaacu uccgggugcagccgacggagagcaucgugcgguucccgaacaucacgaaccugugcccguucggggagguguu caacgcgacgcgguucgcgagcguguacgcguggaaccggaagcggaucagcaacugcguggcggacuacagc gugcuguacaacagcgcgagcuucagcacguucaagugcuacggggugagcccgacgaagcugaacgaccugu gcuucacgaacguguacgcggacagcuucgugauccggggggacgaggugcggcagaucgcgccggggcagac ggggaagaucgcggacuacaacuacaagcugccggacgacuucacggggugcgugaucgcguggaacagcaac aaccuggacagcaaggugggggggaacuacaacuaccuguaccggcuguuccggaagagcaaccugaagccgu ucgagcgggacaucagcacggagaucuaccaggcggggagcacgccgugcaacgggguggagggguucaacug cuacuucccgcugcagagcuacggguuccagccgacgaacggggugggguaccagccguaccgggugguggug cugagcuucgagcugcugcacgcgccggcgacggugugcgggccgaagaagagcacgaaccuggugaagaaca agugcgugaacuucaacuucaacgggcugacggggacgggggugcugacggagagcaacaagaaguuccugcc guuccagcaguucgggcgggacaucgcggacacgacggacgcggugcgggacccgcagacgcuggagauccug gacaucacgccgugcagcuucgggggggugagcgugaucacgccggggacgaacacgagcaaccagguggcgg ugcuguaccaggacgugaacugcacggaggugccgguggcgauccacgcggaccagcugacgccgacguggcg gguguacagcacggggagcaacguguuccagacgcgggcggggugccugaucggggcggagcacgugaacaac agcuacgagugcgacaucccgaucggggcggggaucugcgcgagcuaccagacgcagacgaacagcccgcggc gggcgcggagcguggcgagccagagcaucaucgcguacacgaugagccugggggcggagaacagcguggcgua cagcaacaacagcaucgcgaucccgacgaacuucacgaucagcgugacgacggagauccugccggugagcaug acgaagacgagcguggacugcacgauguacaucugcggggacagcacggagugcagcaaccugcugcugcagu acgggagcuucugcacgcagcugaaccgggcgcugacggggaucgcgguggagcaggacaagaacacgcagga gguguucgcgcaggugaagcagaucuacaagacgccgccgaucaaggacuucgggggguucaacuucagccag auccugccggacccgagcaagccgagcaagcggagcuucaucgaggaccugcuguucaacaaggugacgcugg cggacgcgggguucaucaagcaguacggggacugccugggggacaucgcggcgcgggaccugaucugcgcgca gaaguucaacgggcugacggugcugccgccgcugcugacggacgagaugaucgcgcaguacacgagcgcgcug cuggcggggacgaucacgagcggguggacguucggggcgggggcggcgcugcagaucccguucgcgaugcaga uggcguaccgguucaacgggaucggggugacgcagaacgugcuguacgagaaccagaagcugaucgcgaacca guucaacagcgcgaucgggaagauccaggacagccugagcagcacggcgagcgcgcuggggaagcugcaggac guggugaaccagaacgcgcaggcgcugaacacgcuggugaagcagcugagcagcaacuucggggcgaucagca gcgugcugaacgacauccugagccggcuggacaagguggaggcggaggugcagaucgaccggcugaucacggg gcggcugcagagccugcagacguacgugacgcagcagcugauccgggcggcggagauccgggcgagcgcgaac cuggcggcgacgaagaugagcgagugcgugcuggggcagagcaagcggguggacuucugcgggaagggguacc accugaugagcuucccgcagagcgcgccgcacggggugguguuccugcacgugacguacgugccggcgcagga gaagaacuucacgacggcgccggcgaucugccacgacgggaaggcgcacuucccgcgggaggggguguucgug agcaacgggacgcacugguucgugacgcagcggaacuucuacgagccgcagaucaucacgacggacaacacgu ucgugagcgggaacugcgacguggugaucgggaucgugaacaacacgguguacgacccgcugcagccggagcu ggacagcuucaaggaggagcuggacaaguacuucaagaaccacacgagcccggacguggaccugggggacauc agcgggaucaacgcgagcguggugaacauccagaaggagaucgaccggcugaacgagguggcgaagaaccuga acgagagccugaucgaccugcaggagcuggggaaguacgagcaguacaucaaguggccgugguacaucuggcu gggguucaucgcggggcugaucgcgaucgugauggugacgaucaugcugugcugcaugacgagcugcugcagc ugccugaaggggugcugcagcugcgggagcugcugcaaguucgacgaggacgacagcgagccggugcugaagg gggugaagcugcacuacacgugaagcucgcuuucuugcuguccaauuucuauuaaagguuccuuuguucccua aguccaacuacuaaacugggggauauuaugaagggccuugagcaucuggauucugccuaauaagaaacauuua uugucauugcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa mRNA sequence encoding SARS-CoV2 spike protein (BspQI linearized template), and including non-coding regions (ITS, 5′ UTR,
, 3′ UTR) SEQ ID NO: 7 m7Gaggagaccaggaauuacauuugcuucugacacaacuguguucacuagcaaccucaaacaga
aug uucguguuccuggugcugcugccgcuggugagcagccagugcgugaaccugacgacgcggacgcagcugccgc cggcguacacgaacagcuucacgcgggggguguacuacccggacaagguguuccggagcagcgugcugcacag cacgcaggaccuguuccugccguucuucagcaacgugacgugguuccacgcgauccacgugagcgggacgaac gggacgaagcgguucgacaacccggugcugccguucaacgacgggguguacuucgcgagcacggagaagagua acaucauccggggguggaucuucgggacgacgcuggacagcaagacgcagagccugcugaucgugaacaacgc gacgaacguggugaucaaggugugcgaguuccaguucugcaacgacccguuccuggggguguacuaccacaag aacaacaagagcuggauggagagcgaguuccggguguacagcagcgcgaacaacugcacguucgaguacguga gccagccguuccugauggaccuggaggggaagcaggggaacuucaagaaccugcgggaguucguguucaagaa caucgacggguacuucaagaucuacagcaagcacacgccgaucaaccuggugcgggaccugccgcagggguuc agcgcgcuggagccgcugguggaccugccgaucgggaucaacaucacgcgguuccagacgcugcuggcgcugc accggagcuaccugacgccgggggacagcagcagcggguggacggcgggggcggcggcguacuacguggggua ccugcagccgcggacguuccugcugaaguacaacgagaacgggacgaucacggacgcgguggacugcgcgcug gacccgcugagcgagaccaagugcacgcugaagaguuucacgguggagaaggggaucuaccagacgagcaacu uccgggugcagccgacggagagcaucgugcgguucccgaacaucacgaaccugugcccguucggggagguguu caacgcgacgcgguucgcgagcguguacgcguggaaccggaagcggaucagcaacugcguggcggacuacagc gugcuguacaacagcgcgagcuucagcacguucaagugcuacggggugagcccgacgaagcugaacgaccugu gcuucacgaacguguacgcggacagcuucgugauccggggggacgaggugcggcagaucgcgccggggcagac ggggaagaucgcggacuacaacuacaagcugccggacgacuucacggggugcgugaucgcguggaacagcaac aaccuggacagcaaggugggggggaacuacaacuaccuguaccggcuguuccggaagaguaaccugaagccgu ucgagcgggacaucagcacggagaucuaccaggcggggagcacgccgugcaacgggguggagggguucaacug cuacuucccgcugcagagcuacggguuccagccgacgaacggggugggguaccagccguaccgggugguggug cugagcuucgagcugcugcacgcgccggcgacggugugcgggccgaagaagaguacgaaccuggugaagaaca agugcgugaacuucaacuucaacgggcugacggggacgggggugcugacggagagcaacaagaaguuccugcc guuccagcaguucgggcgggacaucgcggacacgacggacgcggugcgggacccgcagacgcuggagauccug gacaucacgccgugcagcuucgggggggugagcgugaucacgccggggacgaacacgagcaaccagguggcgg ugcuguaccaggacgugaacugcacggaggugccgguggcgauccacgcggaccagcugacgccgacguggcg gguguacagcacggggagcaacguguuccagacgcgggcggggugccugaucggggcggagcacgugaacaac agcuacgagugcgacaucccgaucggggcggggaucugcgcgagcuaccagacgcagacgaacagcccgcggc gggcgcggagcguggcgagccagagcaucaucgcguacacgaugagccugggggcggagaacagcguggcgua cagcaacaacagcaucgcgaucccgacgaacuucacgaucagcgugacgacggagauccugccggugagcaug acgaagacgagcguggacugcacgauguacaucugcggggacagcacggagugcagcaaccugcugcugcagu acgggagcuucugcacgcagcugaaccgggcgcugacggggaucgcgguggagcaggacaagaacacgcagga gguguucgcgcaggugaagcagaucuacaagacgccgccgaucaaggacuucgggggguucaacuucagccag auccugccggacccgagcaagccgagcaagcggagcuucaucgaggaccugcuguucaacaaggugacgcugg cggacgcgggguucaucaagcaguacggggacugccugggggacaucgcggcgcgggaccugaucugcgcgca gaaguucaacgggcugacggugcugccgccgcugcugacggacgagaugaucgcgcaguacacgagcgcgcug cuggcggggacgaucacgagcggguggacguucggggcgggggcggcgcugcagaucccguucgcgaugcaga uggcguaccgguucaacgggaucggggugacgcagaacgugcuguacgagaaccagaagcugaucgcgaacca guucaacagcgcgaucgggaagauccaggacagccugagcagcacggcgagcgcgcuggggaagcugcaggac guggugaaccagaacgcgcaggcgcugaacacgcuggugaagcagcugagcagcaacuucggggcgaucagca gcgugcugaacgacauccugagccggcuggacaagguggaggcggaggugcagaucgaccggcugaucacggg gcggcugcagagccugcagacguacgugacgcagcagcugauccgggcggcggagauccgggcgagcgcgaac cuggcggcgacgaagaugagcgagugcgugcuggggcagagcaagcggguggacuucugcgggaagggguacc accugaugagcuucccgcagagcgcgccgcacggggugguguuccugcacgugacguacgugccggcgcagga gaagaacuucacgacggcgccggcgaucugccacgacgggaaggcgcacuucccgcgggaggggguguucgug agcaacgggacgcacugguucgugacgcagcggaacuucuacgagccgcagaucaucacgacggacaacacgu ucgugagcgggaacugcgacguggugaucgggaucgugaacaacacgguguacgacccgcugcagccggagcu ggacagcuucaaggaggagcuggacaaguacuucaagaaccacacgagcccggacguggaccugggggacauc agcgggaucaacgcgagcguggugaacauccagaaggagaucgaccggcugaacgagguggcgaagaaccuga acgagagccugaucgaccugcaggagcuggggaaguacgagcaguacaucaaguggccgugguacaucuggcu gggguucaucgcggggcugaucgcgaucgugauggugacgaucaugcugugcugcaugacgagcugcugcagc ugccugaaggggugcugcagcugcgggagcugcugcaaguucgacgaggacgacagcgagccggugcugaagg gggugaagcugcacuacacgugaagcucgcuuucuugcuguccaauuucuauuaaagguuccuuuguucccua aguccaacuacuaaacugggggauauuaugaagggccuugagcaucuggauucugccuaauaagaaacauuua uugucauugcaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa Initial Transcribed Sequence (ITS) SEQ ID NO: 8 gggaga Initial Transcribed Sequence (ITS) SEQ ID NO: 9 aggaga Initial Transcribed Sequence (ITS) SEQ ID NO: 10 gggagaccaggaauu Initial Transcribed Sequence (ITS) SEQ ID NO: 11 aggagaccaggaauu 5′ untranslated region (UTR) SEQ ID NO: 12 acauuugcuucugacacaacuguguucacuagcaaccucaaacaga Kozak sequence SEQ ID NO: 13 gccgcc 3′ untranslated region SEQ ID NO: 14 agcucgcuuucuugcuguccaauuucuauuaaagguuccuuuguucccuaaguccaacuacuaaacuggggga uauuaugaagggccuugagcaucuggauucugccuaauaagaaacauuuauugucauugc 3′ poly(A) sequence SEQ ID NO: 15 aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa aaaaaaaaaaaaaaaaaaaaaaaaaaa ITS (SEQ ID: NO: 11) + HBG 5′ UTR (SEQ ID NO: 12) + Kozak sequence (SEQ ID NO: 13) SEQ ID NO: 17 aggagaccaggaauuacauuugcuucugacacaacuguguucacuagcaaccucaaacagagccgcc 5′HBA SEQ ID NO: 18 agggcgaacuaguacucuucugguccccacagacucagagagaacgccacc 5′HSD SEQ ID NO: 19 agggucccgcagucggcguccagcggcucugcuuguucgugugugugucguugcaggccuuauucgccgcc 5′ MRNA SEQ ID NO: 20 agggaaauaagagagaaaagaagaguaagaagaaauauaagagccacc 5′NCA-7d SEQ ID NO: 21 aggcaaaaaucaaaaucaaucaucaucacaacaucaacaaucaaucaucaacacaucaucaagacaccacc 3′ HBG SEQ ID NO: 22 Agcucgcuuucuugcuguccaauuucuauuaaagguuccuuuguucccuaaguccaacuacuaaacuggggga uauuaugaagggccuugagcaucuggauucugccuaauaagaaacauuuauugucauugc 3′ AES-mtRNRI SEQ ID NO: 23 cugguacugcaugcacgcaaugcuagcugccccuuucccguccuggguaccccgagucucccccgaccucggg ucccagguaugcucccaccuccaccugccccacucaccaccucugcuaguuccagacaccucccaagcacgca gcaaugcagcucaaaacgcuuagccuagccacacccccacgggaaacagcagugauuaaccuuuagcaauaaa cgaaaguuuaacuaagcuauacuaaccccaggguuggucaauuucgugccagccacacc 3′ ALB SEQ ID NO: 24 Caucacauuuaaaagcaucucagccuaccaugagaauaagagaaagaaaaugaagaucaauagcuuauucauc ucuuuuucuuuuucguugguguaaagccaacacccugucuaaaaaacauaaauuucuuuaaucauuuugccuc uugucucugugcuccacucaccaaaaaauggaaagaaccu 3′ HBA SEQ ID NO: 25 ugauaauaggcuggagccucgguggccaugcuucuugccccuugggccuccccccagccccuccuccccuucc ugcacccguacccccguggucuuugaauaaagucuga 3′ S27a + R3U SEQ ID NO: 26 uuguguaugcguuaauaaaaagaaggaacucguaaaaacucaauguauuucugaggaagcguggugcauaaug ccacgcagcgucugcauaacuuuuauuauuucuuuuauuaaucaacaaa 5′ HBG-ITS SEQ ID NO: 27 AGGAGACCAGGAAUUacauuugcuucugacacaacuguguucacuagcaaccucaaacagagccgcc 5′ HBG-ITS SEQ ID NO: 28 GGGAGACCAGGAAUUacauuugcuucugacacaacuguguucacuagcaaccucaaacagagccgcc 5′ HBG SEQ ID NO: 29 AGGacauuugcuucugacacaacuguguucacuagcaaccucaaacagagccgcc 5′ HBG SEQ ID NO: 30 Gacauuugcuucugacacaacuguguucacuagcaaccucaaacagagccgcc 5′ NCA-7d-ITS SEQ ID NO: 31 AGGAGACCAGGAAUUggcaaaaaucaaaaucaaucaucaucacaacaucaacaaucaaucaucaacacauc aucaagacaccacc 5′ NCA-7d-ITS SEQ ID NO: 32 GGGAGACCAGGAAUUggcaaaaaucaaaaucaaucaucaucacaacaucaacaaucaaucaucaacacauc aucaagacaccacc 5′ NCA-7d SEQ ID NO: 33 AGGcaaaaaucaaaaucaaucaucaucacaacaucaacaaucaaucaucaacacaucaucaagacaccacc 5′ NCA-7d SEQ ID NO: 34 GGcaaaaaucaaaaucaaucaucaucacaacaucaacaaucaaucaucaacacaucaucaagacaccac 5′ NCA-7d SEQ ID NO: 35 Gcaaaaaucaaaaucaaucaucaucacaacaucaacaaucaaucaucaacacaucaucaagacaccac