METHODS OF MAKING CAPSINOIDS BY BIOSYNTHETIC PROCESSES

20190010522 ยท 2019-01-10

Assignee

Inventors

Cpc classification

International classification

Abstract

Provided herein are methods of making capsinoids including providing a capsiate synthase in a mixture or cellular system, feeding 8-methyl-6-nonenoyl-CoA, 6E-8-methylnonenoic acid or 8-methylnonanoic acid into the mixture or cellular system, feeding vanillyl alcohol into the mixture or cellular system, and collecting capsinoids from the mixture or cellular system.

Claims

1. A method of producing a capsinoid, the method comprising: (a) expressing a capsiate synthase (CS) in a cellular system; (b) adding 8-methyl-6-nonenoyl-CoA and vanillyl alcohol to the cellular system; and (c) incubating the cellular system for a sufficient time to produce the capsinoid.

2. A method of producing dihydrocapsiate, the method comprising: (a) expressing a capsiate synthase (CS) and an acyltransferase (ACS) in a cellular system; (b) adding 8-methylnonanoic acid and vanillyl alcohol to the cellular system; and (c) incubating the cellular system for a sufficient time to produce the dihydrocapsiate.

3. A method of producing capsiate, the method comprising: (a) expressing a capsiate synthase (CS) and an acyltransferase (ACS) in a cellular system; (b) adding 6E-8-methylnonanoic acid and vanillyl alcohol to the cellular system; and (c) incubating the cellular system for a sufficient time to produce the capsiate.

4. A method of producing a capsinoid, the method comprising: (a) expressing a capsiate synthase (CS) and an acyltransferase (ACS) in a cellular system; (b) adding a medium chain fatty acid and vanillyl alcohol to the cellular system; and (c) incubating the cellular system for a sufficient time to produce the capsinoid.

5. The method of any one of claims 1 to 4, wherein the CS amino acid sequence is derived from a plant of the Capsicum genus.

6. The method of claim 5, wherein the Capsicum genus plant is a ghost chili plant.

7. The method of any one of claims 1 to 6, wherein the CS comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 1.

8. The method of claim 7, wherein the CS comprises the amino acid sequence of SEQ ID NO: 1.

9. The method of any one of claims 2 to 8, wherein the ACS amino acid sequence is derived from a plant of the Capsicum genus.

10. The method of claim 9, wherein the Capsicum genus plant is a ghost chili plant.

11. The method of any one of claims 2 to 10, wherein the ACS comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 2.

12. The method of claim 11, wherein the ACS comprises the amino acid sequence of SEQ ID NO: 2.

13. The method of any one of claims 1 to 12, wherein the cellular system is selected from the group including yeast, non-capsinoid producing plants, algae and bacteria.

14. The method of claim 13, wherein the cellular system is bacteria.

15. The method of claim 14, wherein the cellular system is E. Coli.

16. The method of any one of claims 1 to 15, wherein the method further comprises collecting the produced capsinoid, capsiate or dihydrocapsiate.

17. The method of claim 16, wherein the method further comprises purifying the produced capsinoid, capsiate or dihydrocapsiate to a purity of greater than 70%.

18. The method of claim 17, wherein the purifying step comprises acid-base extraction.

19. The method of claim 17, wherein the purifying step comprises vacuum distillation.

20. The method of claim 17, wherein the purifying step comprises semi-preparative HPLC.

21. A method of producing a capsinoid, the method comprising: (a) providing a capsiate synthase (CS) in a reaction mixture; (b) adding 8-methyl-6-nonenoyl-CoA and vanillyl alcohol to the reaction mixture; and (c) incubating the reaction mixture for a sufficient time to produce the capsinoid.

22. A method of producing dihydrocapsiate, the method comprising: (a) providing a capsiate synthase (CS) and an acyltransferase (ACS) in a reaction mixture; (b) adding 8-methylnonanoic acid and vanillyl alcohol to the reaction mixture; and (c) incubating the reaction mixture for a sufficient time to produce the dihydrocapsiate.

23. A method of producing capsiate, the method comprising: (a) providing a capsiate synthase (CS) and an acyltransferase (ACS) in a reaction mixture; (b) adding 6E-8-methylnonenoic acid and vanillyl alcohol to the reaction mixture, and (c) incubating the reaction mixture for a sufficient time to produce the capsiate.

24. A method of producing a capsinoid, the method comprising: (a) providing a capsiate synthase (CS) and an acyltransferase (ACS) in a reaction mixture; (b) adding a medium chain fatty acid and vanillyl alcohol to the reaction mixture; and (c) incubating the reaction mixture for a sufficient time to produce the thereby producing the capsinoid.

25. The method of any one of claims 21 to 24, wherein the CS amino acid sequence is derived from a plant of the Capsicum genus.

26. The method of claim 25, wherein the Capsicum genus plant is a ghost chili plant.

27. The method of any one of claims 21 to 26, wherein the CS comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 1.

28. The method of claim 27, wherein the CS comprises the amino acid sequence of SEQ ID NO: 1.

29. The method of any one of claims 22 to 28, wherein the ACS amino acid sequence is derived from a plant of the Capsicum genus.

30. The method of claim 29, wherein the Capsicum genus plant is a ghost chili plant.

31. The method of any one of claims 22 to 30, wherein the ACS comprises an amino acid sequence having at least 90% identity to SEQ ID NO: 2.

32. The method of claim 31, wherein the ACS comprises the amino acid sequence of SEQ ID NO: 2.

33. The method of any one of claims 21 to 32, wherein the CS and/or ACS are produced in a cellular system selected from the group including yeast, non-capsinoid producing plants, algae and bacteria.

34. The method of claim 33, wherein the cellular system is bacteria.

35. The method of claim 34, wherein the cellular system is E. Coli.

36. The method of any one of claims 21 to 35, wherein the method further comprises collecting the produced capsinoid, capsiate or dihydrocapsiate from the reaction mixture.

37. The method of claim 36, wherein the method further comprises purifying the produced capsinoid, capsiate or dihydrocapsiate to a purity of greater than 70%.

38. The method of claim 37, wherein the purifying step comprises acid-base extraction.

39. The method of claim 37, wherein the purifying step comprises vacuum distillation.

40. The method of claim 37, wherein the purifying step comprises semi-preparative HPLC.

Description

BRIEF DESCRIPTION OF THE DRAWINGS

[0023] FIG. 1 shows the molecular structures for capsiate, dihydrocapsiate, and nordihydrocapsiate.

[0024] FIG. 2 shows a diagram Capsiate synthase (CS)-catalyzed capsiate biosynthesis.

[0025] FIG. 3 shows the HPLC profiles of putative capsiate (CQ) and dihydrocapsiate (DHCQ) production from 6E-8-methylnonenoic acid (6E) and 8-methylnonanoic acid (8M), respectively. The VA (vanillyl alcohol), 6E and 8M concentrations are 500 mg/L. As shown in FIG. 3, different products were formed from 6E and 8M, respectively.

[0026] FIG. 4 shows CQ and DHCQ production from VA+6E (VE) and VA+8M (VM), respectively. The experiment was performed in triplicates.

[0027] FIG. 5 shows the GC/MS analysis was performed to confirm the identity of CQ and DHCQ in the cultures.

[0028] FIG. 6 shows comparisons of DHCP (dihydrocapsaicin) spectra in the GC/MS library with CQ and DHCQ spectra obtained from the induction samples, since there is no CQ and DHCQ spectra in the GC/MS library and the closest match is that of DHCP (dihydrocapsaicin).

DETAILED DESCRIPTION

Definitions

[0029] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the disclosure belongs. Although any methods and materials similar to or equivalent to those described herein may be used in the practice or testing of the present disclosure, the preferred materials and methods are described below.

[0030] Percent (%) amino acid sequence identity with respect to the variant polypeptide sequences of the subject technology refers to the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues of a reference polypeptide after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity.

[0031] Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. For example, the % amino acid sequence identity may be determined using the sequence comparison program NCBI-BLAST2. The NCBI-BLAST2 sequence comparison program may be downloaded from ncbi.nlm.nih.gov. NCBI BLAST2 uses several search parameters, wherein all of those search parameters are set to default values including, for example, unmask yes, strand=all, expected occurrences 10, minimum low complexity length=15/5, multi-pass e-value=0.01, constant for multi-pass=25, dropoff for final gapped alignment=25 and scoring matrix=BLOSUM62. In situations where NCBI-BLAST2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows: 100 times the fraction X/Y where X is the number of amino acid residues scored as identical matches by the sequence alignment program NCBI-BLAST2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A.

[0032] In this sense, techniques for determining amino acid sequence similarity are well known in the art. In general, similarity refers to the exact amino acid to amino acid comparison of two or more polypeptides at the appropriate place, where amino acids are identical or possess similar chemical and/or physical properties such as charge or hydrophobicity. A so-termed percent similarity may then be determined between the compared polypeptide sequences. Techniques for determining nucleic acid and amino acid sequence identity also are well known in the art and include determining the nucleotide sequence of the mRNA for that gene (usually via a cDNA intermediate) and determining the amino acid sequence encoded therein, and comparing this to a second amino acid sequence. In general, identity refers to an exact nucleotide to nucleotide or amino acid to amino acid correspondence of two polynucleotides or polypeptide sequences, respectively. Two or more polynucleotide sequences can be compared by determining their percent identity, as can two or more amino acid sequences. The programs available in the Wisconsin Sequence Analysis Package, Version 8 (available from Genetics Computer Group, Madison, Wis.), for example, the GAP program, are capable of calculating both the identity between two polynucleotides and the identity and similarity between two polypeptide sequences, respectively. Other programs for calculating identity or similarity between sequences are known by those skilled in the art.

[0033] Unless specified otherwise, the percent identity of two polypeptide or polynucleotide sequences refers to the percentage of identical amino acid residues or nucleotides across the entire length of the shorter of the two sequences.

[0034] Transformation is used according to its ordinary and customary meaning as understood by a person of ordinary skill in the art, and is used without limitation to refer to the transfer of a polynucleotide into a target cell. The transferred polynucleotide can be incorporated into the genome or chromosomal DNA of a target cell, resulting in genetically stable inheritance, or it can replicate independent of the host chromosomal. Host organisms containing the transformed nucleic acid fragments are referred to as transgenic or recombinant or transformed organisms.

[0035] The terms transformed, transgenic, and recombinant, when used herein in connection with host cells, are used according to their ordinary and customary meanings as understood by a person of ordinary skill in the art, and are used without limitation to refer to a cell of a host organism, such as a plant or microbial cell, into which a heterologous nucleic acid molecule has been introduced. The nucleic acid molecule can be stably integrated into the genome of the host cell, or the nucleic acid molecule can be present as an extrachromosomal molecule.

[0036] The terms recombinant, heterologous, and exogenous, when used herein in connection with polynucleotides, are used according to their ordinary and customary meanings as understood by a person of ordinary skill in the art, and are used without limitation to refer to a polynucleotide (e.g., a DNA sequence or a gene) that originates from a source foreign to the particular host cell or, if from the same source, is modified from its original form. Thus, a heterologous gene in a host cell includes a gene that is endogenous to the particular host cell but has been modified through, for example, the use of site-directed mutagenesis or other recombinant techniques. The terms also include non-naturally occurring multiple copies of a naturally occurring DNA sequence. Thus, the terms refer to a DNA segment that is foreign or heterologous to the cell, or homologous to the cell but in a position or form within the host cell in which the element is not ordinarily found.

[0037] Similarly, the terms recombinant, heterologous, and exogenous, when used herein in connection with a polypeptide or amino acid sequence, means a polypeptide or amino acid sequence that originates from a source foreign to the particular host cell or, if from the same source, is modified from its original form. Thus, recombinant DNA segments can be expressed in a host cell to produce a recombinant polypeptide.

[0038] The term cellular system as used herein refers to any cells that provide for the expression of ectopic proteins. It includes bacteria, yeast, plant cells and animal cells. It includes prokaryotic and eukaryotic cells. It also includes in vitro expression of proteins utilizing cellular components, such as ribosomes.

[0039] The term growing the cellular system as used herein includes providing medium that would allow cells to multiply and divide. It also includes providing resources so that cells or cellular components can translate and make recombinant proteins.

[0040] The term protein expression as used herein refers to protein production as part of gene expression. It consists of the stages after DNA has been transcribed to messenger RNA (mRNA). The mRNA is then translated into polypeptide chains, which are ultimately folded into proteins. DNA is present in the cells through transfection, a process of deliberately introducing nucleic acids into cells. The term is often used for non-viral methods in eukaryotic cells. It may also refer to other methods and cell types, although other terms are preferred: transformation is more often used to describe non-viral DNA transfer in bacteria, non-animal eukaryotic cells, including plant cells.

[0041] Transduction is often used to describe virus-mediated DNA transfer. Transformation, transduction, and viral infection are included under the definition of transfection for this application. In addition, protein expression includes in vitro translation, wherein proteins are expressed utilizing cellular organelles that are outside the cells.

[0042] The term bioconversion, also known as biotransformation, as used herein refers to the use of live organisms often microorganisms (e.g., bacteria and yeast) to carry out a chemical reaction that may be more costly or not feasible nonbiologically. These organisms convert a substance to a chemically modified form.

[0043] The term reaction mixture and mixture, as used herein, refers to the physical combination of two or more substances which may be mixed in the form of solutions, suspensions, or colloids with many variations known in the art. A reaction mixture may comprise a mixture of recombinant proteins (e.g., an ACS and a CS as described herein) and one or more in vitro reaction system components such as substrates (e.g., vanillyl alcohol (VA), 6E-8-methylnonenoic acid (6E), and/or 8-methylnonanoic acid (8M) as described herein), buffers (e.g., potassium phosphate buffer), and salts (e.g., MgCl.sub.2). For example, Applicants used an HPLC-based method to measure the activity of pepper ACSI (Chen et al., 2011). In such system the reaction mixture (400 E) contained 0.1 M Tris-HCl, pH 7.5, 2 mM DTT, 5 mM ATP, 10 mM MgCl.sub.2, 0.5 mM CoA, 0.1% Triton and 200 M carboxylic acids. The reaction was initiated by adding 20 m of purified enzyme and stopped after 30 minutes by addition of 20 micromolar acetic acid. HPLC was performed with Dionex-UltiMate 3000 LC Systems (Thermo Scientific) using an Acclaim 120 CI 8 reversed-phase column (Thermo Scientific; 3, 120 A, 1503 mm). The mobile phase consisted of solvent A (0.1% trifluoroacetic acid) and solvent B (acetonitrile). The gradient elution procedure was as follows: 0 to 5 min, 5% of B; 5 to 9 min, a linear gradient from 5 to 80% of B; 9 to 11 min, 80% of B; 11 to 12 min, 5% of B. The flow rate was 0.6 ml/min. The diode array detector collected data in the 200- to 400-nm range. For detection and quantification of substrate and products, peak areas were measured at 257 nm.

[0044] The use of the words a or an when used in conjunction with the term comprising herein may mean one, but it is also consistent with the meaning of one or more, at least one, and one or more than one.

[0045] As described above, capsinoids, like capsiate and capsinoids present in CH-19 Sweet Pepper Extract, are widely used for many purposes but are currently incredibly expensive to produce. Capsiate is believed to be naturally synthesized in peppers by capsiate synthase (CS, also referred to as capsaicin synthase), an acyltransferase that transfers the 8-methyl-6-nonenoyl moiety from 8-methyl-6-nonenoyl-CoA to vanillyl alcohol to form an ester conjugate (FIG. 2) and genetically, its biosynthesis is controlled by the Pun1 locus in pepper (Han et al., 2013).

[0046] As described herein, it has been found that expression systems that utilize an acyl-CoA synthetase (ACS), such as ghost pepper ACS1, and a capsiate/capsaicin synthase (CS), such as ghost pepper AT3/PUN1, can be used to produce capsinoids when fed appropriate starting materials, such as vanillyl alcohol (VA) and either 6E-8-methylnonenoic acid (6E) or 8-methylnonanoic acid (8M).

Cellular Systems

[0047] In some aspects, the present disclosure is directed to the production of capsinoids in cellular systems, such as in bacterial or fungal cells. In some embodiments, the cellular system is E. coli cultures overexpressing ghost pepper ACS1 and AT3/PUN1 genes. Use of ghost pepper ACS1 and AT3/PUN1 has been described previously for the production of capsaicinoids (see, e.g., PCT/US2015/011729, published as PCT Application Publication No. WO2015109168, which is herein incorporated by reference in its entirety). Capsaicinoids, as described above, are structurally and functionally distinguishable from capsinoids. As shown in FIG. 3, different capsinoid products were formed from the introduction of 6E-8-methylnonenoic acid (6E) with vanillyl alcohol (VA) or 8M with VA. More quantitative data showed that this ACS1-PUN1 system prefers 8M as a substrate (FIG. 3).

[0048] In some embodiments, a method of producing a capsinoid is provided, the method comprising expressing a capsiate synthase (CS) in a cellular system; adding 8-methyl-6-nonenoyl-CoA and vanillyl alcohol (together or separately) to the cellular system; and incubating the cellular system for a sufficient time to produce the capsinoid. In some embodiments, a method of producing dihydrocapsiate is provided, the method comprising expressing a capsiate synthase (CS) and an acyltransferase (ACS) in a cellular system; adding 8-methylnonanoic acid and vanillyl alcohol (together or separately) to the cellular system; and incubating the cellular system for a sufficient time to produce the dihydrocapsiate. In some embodiments, a method of producing capsiate is provided, the method comprising expressing a capsiate synthase (CS) and an acyltransferase (ACS) in a cellular system; adding 6E-8-methylnonenoic acid and vanillyl alcohol (together or separately) to the cellular system; and incubating the cellular system for a sufficient time to produce the capsiate. In some embodiments, a method of producing a capsinoid is provided, the method comprising expressing a capsiate synthase (CS) and an acyltransferase (ACS) in a cellular system; adding a medium chain fatty acid and vanillyl alcohol (together or separately) to the cellular system; and incubating the cellular system for a sufficient time to produce the capsinoid.

[0049] Exemplary cellular systems include yeast cells (Pichia Pastoris or Saccharomyces cerevisiae), plants or plant cells (e.g., non-capsinoid producing plants or plant cells such as Arabidopsis thaliana, Oryza Sativa or Zea mays), algal cells, and bacterial cells (e.g., Escherichia coli).

[0050] The amount of time sufficient to produce a capsinoid of interest will vary depending on the capsinoid being produced, the type of cellular system used, and the conditions under which the cellular system is maintained. Exemplary conditions for producing capsinoids in bacteria are provided in the Examples. Similar conditions may be adapted for yeast, such as Saccharomyces cerevisiae, which have been shown to be capable of producing many molecules biosynthetically (see, e.g., PCT Application Publication No. WO2014086842). Conditions described herein may also be adapted for use with plant cells, which have also been shown to be capable of producing many molecules biosynthetically (see, e.g., PCT Application Publication No. WO2010124324).

[0051] Another embodiment of the present disclosure is a bioconversion method of making capsinoid comprising expressing a CS gene in a cellular system, expressing an ACS1 gene in the cellular system, feeding a medium chain fatty acid to the cellular system, feeding vanillyl alcohol to the cellular system, and collecting capsinoid.

[0052] In some embodiments of any of the cellular systems provided herein, a capsiate synthase (CS) may be used. In some embodiments, the CS nucleic acid and/or amino acid sequence are derived from a plant of the Capsicum genus (e.g., a ghost chili plant or CH19 Sweet plant). In some embodiments, the CS comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to SEQ ID NO: 1. In some embodiments, the CS consists of the amino acid sequence of SEQ ID NO: 1. In some embodiments, the CS is encoded by a nucleic acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to SEQ ID NO: 3.

TABLE-US-00001 Exemplaryaminoacidsequenceofghostchili Pun1/AT3 (SEQIDNO:1) MAFALPSSLVSVCDKSFIKPSSLTPSKLRFHKLSFIDQSLSNMYIPCAFF YPKVQQRLEDSKNSDELSHIANLLQTSLSQTLVSYYPYAGKLKDNATVDC NDMGAEFLSVRIKCSMSEILDHPHASLAESIVLPKDLPWANNCEGGNLLV VQVSKFDCGGIAISVCFSHKIGDGCSLLNFLNDWSSVTRDHTTTALVPSP RFVGDSVFSTKKYGSLITPQILSDLNECVQKRLIFPTDKLDALRAKVAEE SGVKNPTRAEVVSALLFKCATKASSSMLPSKLVHFLNIRTMIKPRLPRNA IGNLSSIFSIEATNMQDMELPTLVRNLRKEVEVAYKKDQVEQNELILEVV ESMREGKLPFENMDGYENVYTCSNLCKYPYYTVDFGWGRPERVCLGNGPS KNAFFLKDYKAGQGVEARVMLHKQQMSEFERNEELLEFIA

[0053] In some embodiments of any of the cellular systems provided herein, an acyltransferase (ACS) may be used. In some embodiments, the ACS nucleic acid and/or amino acid sequence are derived from a plant of the Capsicum genus (e.g., a ghost chili plant or CH19 Sweet plant). In some embodiments, the ACS comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to SEQ ID NO: 2. In some embodiments, the ACS consists of the amino acid sequence of SEQ ID NO: 2. In some embodiments, the ACS is encoded by a nucleic acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to SEQ ID NO: 4.

TABLE-US-00002 ExemplaryaminoacidsequenceofghostchiliACS (SEQIDNO:2) MATDKFIIEVESAKPAKDGRPSMGPVYRSIFAKHGFPPPIPGLDSCWDIF RMSVEKYPNNRMLGRREIVDGKPGKYVWMSYKEVYDIVIKVGNSIRSIGV DVGDKCGIYGANCPEWIISMEACNAHGLYCVPLYDTLGAGAVEFIISHAE VTIAFVEEKKLPELLKTFPNASKYLKTIVSFGKVTPEQKKELEEFGVVLY SWDEFLQLGSGKQFDLPVKKKEDICTIMYTSGTTGDPKGVLISNTSIVTL IAGVRRFLGSVDESLNVDDVYLSYLPLAHIFDRVIEECFIHHGASIGFWR GDVKLLTEDIGELKPTVFCAVPRVLDRIYSGLQQKIAAGGFLKSTLFNLA YAYKHHNLKKGRKHFEASPLSDKVVFSKVKEGLGGRVRLILSGAAPLAAH VEAFLRVVACCHVLQGYGLTETCAGTFVSLPNRYDMLGTVGPPVPNVDVC LESVPEMSYDALSSTPRGEVCVRGDVLFSGYYKREDLTKEVMIDGWFHTG DVGEWQPNGSLKIIDRKKNIFKLSQGEYVAVENLENIYGNNPIIDSIWIY GNSFESFLVAVINPNQRAVEQWAEVNGLSGDFASLCEKPEVKEYILRELT KTGKEKKLKGFEFLKAVHLDPVPFDMERDLLTPTFKKKRPQLLKYYKDVI DSMYKGTK

Reaction Mixtures

[0054] The present disclosure is also directed, in part, to the production of capsinoids using reaction mixtures (e.g., in vitro reaction mixtures) comprising the an ACS, such as ghost pepper ACS1, and/or a CS, such as ghost pepper AT3/PUN1, to which appropriate starting materials (e.g., VA and 6E or VA and 8M) are added.

[0055] In some embodiments, a method of producing a capsinoid is provided, the method comprising providing a capsiate synthase (CS) in a reaction mixture; adding 8-methyl-6-nonenoyl-CoA and vanillyl alcohol (together or separately) to the reaction mixture; and incubating the reaction mixture for a sufficient time to produce the capsinoid. In some embodiments, a method of producing dihydrocapsiate is provided, the method comprising providing a capsiate synthase (CS) and an acyltransferase (ACS) in a reaction mixture; adding 8-methylnonanoic acid and vanillyl alcohol (together or separately) to the reaction mixture; and incubating the reaction mixture for a sufficient time to produce the dihydrocapsiate. In some embodiments, a method of producing capsiate is provided, the method comprising providing a capsiate synthase (CS) and an acyltransferase (ACS) in a reaction mixture; adding 6E-8-methylnonenoic acid and vanillyl alcohol (together or separately) to the reaction mixture, and incubating the reaction mixture for a sufficient time to produce the capsiate. In some embodiments, a method of producing a capsinoid, the method comprising providing a capsiate synthase (CS) and an acyltransferase (ACS) in a reaction mixture; adding a medium chain fatty acid and vanillyl alcohol (together or separately) to the reaction mixture; and incubating the reaction mixture for a sufficient time to produce the thereby producing the capsinoid. It is to be understood that components of the reaction mixture may be added in any order, together or separately, as long as the resulting reaction mixture is capable of producing the desired capsinoid once incubated.

[0056] The enzymes for use in the reaction mixture can be produced from any source, preferably recombinantly, e.g., in E. coli or another suitable host cell capable of producing the enzymes, or synthetically. The reaction mixture may be a buffered solution containing the enzymes and other components, such as starting materials (e.g., VA and 6E or VA and 8M) and salts, which may be appropriate for producing a desired capsinoid. The reaction mixture may also contain or be made up of a cell lysate (e.g., an E. coli or yeast cell lysate) to which additional components such as starting materials (e.g., VA and 6E or VA and 8M) may be added.

[0057] In some embodiments of any of the reaction mixtures provided herein, a capsiate synthase (CS) may be used. In some embodiments, the CS nucleic acid and/or amino acid sequence are derived from a plant of the Capsicum genus (e.g., a ghost chili plant or CH19 Sweet plant). In some embodiments, the CS comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to SEQ ID NO: 1. In some embodiments, the CS consists of the amino acid sequence of SEQ ID NO: 1.

[0058] In some embodiments of any of the reaction mixtures provided herein, an acyltransferase (ACS) may be used. In some embodiments, the ACS nucleic acid and/or amino acid sequence are derived from a plant of the Capsicum genus (e.g., a ghost chili plant or CH19 Sweet plant). In some embodiments, the ACS comprises an amino acid sequence having at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identity to SEQ ID NO: 2. In some embodiments, the ACS consists of the amino acid sequence of SEQ ID NO: 2.

[0059] The amount of time sufficient to produce a capsinoid of interest will vary depending on the capsinoid being produced, the type of reaction mixture used, and the conditions under which the reaction mixture is incubated. Exemplary conditions for the biosynthetic production molecules using reaction mixtures are known in the art (see, e.g., PCT Application Publication No. WO2016/054534, which is herein incorporated by reference in its entirety).

[0060] An embodiment of the present disclosure is a bioconversion method of making capsinoid comprising providing a capsiate synthase (CS) in a mixture, feeding 8-methyl-6-nonenoyl-CoA in the mixture, feeding vanillyl alcohol to the mixture; and collecting capsinoid.

[0061] Another embodiment of the present disclosure is a bioconversion method of making capsiate comprising providing a capsiate synthase (CS) in a mixture, providing an acyltransferase in the mixture, feeding 6E-8-methylnonenoic acid, feeding vanillyl alcohol to the mixture, and collecting capsiate.

[0062] Another embodiment of the present disclosure is a bioconversion method of making dihydrocapsiate comprising providing a capsiate synthase (CS) in a mixture, providing an acyltransferase in the mixture, feeding 8-methylnonanoic acid, feeding vanillyl alcohol to the mixture, and collecting capsiate.

Purification

[0063] In some embodiments of any of the methods provided herein, the method may further comprise purifying a capsinoid (e.g., a capsiate or dihydrocapsiate). In some embodiments, the capsinoid is purified to a purity of between 50% and 100% by weight. In some embodiments, the capsinoid is purified to a purity of greater than 60%, greater than 70%, greater than 80%, greater than 90%, greater than 95%, greater than 96%, greater than 97%, greater than 98% or greater than 99% pure by weight. A capsinoid of interest may be purified by any method known in the art or described herein. Exemplary methods include acid-base extraction, vacuum distillation and semi-preparative HPLC (see, e.g., Li H. X. et al., Food Science Technology, 57: 446 (2014); and, Andrade-Eiroa A., et al., An alternative to trial and error methodology in solid phase extraction: an original automated solid phase extraction procedure for analysing PAHs and PAH-derivatives in soot, RSC Advances 4: pp. 33636-44 (2014).

Compositions

[0064] Any of the capsinoids produced by a method described herein may be included in a composition. In some embodiments, composition is an orally consumable product (such as a beverage, food product, dietary supplement, nutraceutical, pharmaceutical composition, dental hygienic composition or cosmetic product) which is contacted with the mouth of man or animal, including substances that are taken into and subsequently ejected from the mouth and substances which are drunk, eaten, swallowed, or otherwise ingested; and that are safe for human or animal consumption when used in a generally acceptable range of concentrations.

[0065] As used herein, dietary supplement(s) refers to compounds intended to supplement the diet and provide nutrients, such as vitamins, minerals, fiber, fatty acids, amino acids, etc. that may be missing or may not be consumed in sufficient quantities in a diet. Any suitable dietary supplement known in the art may be used. Examples of suitable dietary supplements can be, for example, nutrients, vitamins, minerals, fiber, fatty acids, herbs, botanicals, amino acids, and metabolites.

[0066] As used herein, nutraceutical(s) refers to compounds, which includes any food or part of a food that may provide medicinal or health benefits, including the prevention and/or treatment of disease or disorder (e.g., fatigue, insomnia, effects of aging, memory loss, mood disorders, cardiovascular disease and high levels of cholesterol in the blood, diabetes, osteoporosis, inflammation, autoimmune disorders, etc.). Any suitable nutraceutical known in the art may be used. In some embodiments, nutraceuticals can be used as supplements to food and beverages and as pharmaceutical formulations for enteral or parenteral applications which may be solid formulations, such as capsules or tablets, or liquid formulations, such as solutions or suspensions.

[0067] In some embodiments, dietary supplements and nutraceuticals can further contain protective hydrocolloids (such as gums, proteins, modified starches), binders, film-forming agents, encapsulating agents/materials, wall/shell materials, matrix compounds, coatings, emulsifiers, surface active agents, solubilizing agents (oils, fats, waxes, lecithins, etc.), adsorbents, carriers, fillers, co-compounds, dispersing agents, wetting agents, processing aids (solvents), flowing agents, taste-masking agents, weighting agents, jellyfying agents, gel-forming agents, antioxidants and antimicrobials.

[0068] Any suitable pharmaceutical composition known in the art may be used. In certain embodiments, a pharmaceutical composition of the present disclosure can contain a capsinoid and one or more pharmaceutically acceptable excipients. Such compositions can be prepared according to procedures well known in the art, for example, as described in Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., USA.

EXAMPLES

Production of Capsinoids in E. Coli

[0069] ACS1 and AT3/Pun1 genes from ghost chili pepper were co-overexpressed in E. coli BL21(DE3) cells as previously described (see, e.g., PCT Application Publication No. WO2015/066615, the contents of which are herein incorporated by reference in their entirety). Plasmid pCDFDuet-ACS1 was used to transform competent E. coli BL21 (DE3) cells. The transformed cells were selected on LB plates containing 100 mg/L of spectinomycin. The resulting BL21(DE3) cells harboring pCDFDuet-ACSI were used for a second transformation with pETite N-His SUMO-ghost Pun1 vector. The transformants were selected on LB plates containing 50 mg/L of kanamycin and 100 mg/L of spectinomycin. The ACS1 and AT3/Pun1 coding sequences used to co-overexpress ACS1 and Pun1 in the transformants are shown below:

TABLE-US-00003 SequenceofPun1/AT3codingsequence(fromghost chilipepper) (SEQIDNO:3) ATGGCTTTTGCATTACCATCATCACTTGTTTCAGTTTGTGACAAATCTTT TATCAAACCTTCCTCTCTCACCCCCTCTAAACTTAGATTTCACAAGCTAT CTTTCATCGATCAATCTTTAAGTAATATGTATATCCCTTGTGCATTTTTT TACCCTAAAGTACAACAAAGACTAGAAGACTCCAAAAATTCTGATGAGCT TTCCCATATAGCCCACTTGCTACAAACATCTCTATCACAAACTCTAGTCT CTTACTATCCTTATGCAGGAAAGTTGAAGGACAATGCTACTGTTGACTGT AACGATATGGGAGCTGAGTTCTTGAGTGTTCGAATAAAATGTTCCATGTC TGAAATTCTTGATCATCCTCATGCATCTCTTGCAGAGAGCATAGTTTTGC CCAAGGATTTGCCTTGGGCGAATAATTGTGAAGGTGGTAATTTGCTTGTA GTTCAAGTAAGTAAGTTTGATTGTGGGGGAATAGCCATCAGTGTATGCTT TTCGCACAAGATTGGTGATGGTTGCTCTCTGCTTAATTTCCTTAATGATT GGTCTAGCGTTACTCGTGATCATACGACAACAGCTTTAGTTCCATCTCCT AGATTTGTAGGAGATTCTGTCTTCTCTACAAAAAAATATGGTTCTCTTAT TACGCCACAAATTTTGTCCGATCTCAACGAGTGCGTACAGAAAAGACTCA TTTTTCCTACAGATAAGTTAGATGCACTTCGAGCTAAGGTGGCAGAAGAA TCAGGAGTAAAAAATCCAACAAGGGCAGAAGTTGTTAGCGCTCTTCTTTT CAAATGTGCAACAAAGGCATCATCATCAATGCTACCATCAAAGTTGGTTC ACTTCTTAAACATACGTACTATGATCAAACCTCGTCTACCACGAAATGCC ATTGGAAATCTCTCGTCTATTTTCTCCATAGAAGCAACTAACATGCAGGA CATGGAGTTGCCAACGTTGGTTCGTAATTTAAGGAAGGAAGTTGAGGTGG CATACAAGAAAGACCAAGTCGAACAAAATGAACTGATCCTAGAAGTAGTA GAATCAATGAGAGAAGGGAAACTGCCATTTGAAAATATGGATGGCTATGA GAATGTGTATACTTGCAGCAATCTTTGCAAATATCCGTACTACACTGTAG ATTTTGGATGGGGAAGACCTGAAAGAGTGTGTCTAGGAAATGGTCCCTCC AAGAATGCCTTCTTCTTGAAAGATTACAAAGCTGGGCAAGGCGTGGAGGC GCGGGTGATGTTGCACAAGCAACAAATGTCTGAATTTGAACGCAATGAGG AACTCCTTGAGTTCATTGCCTAA SequenceofACS1codingsequence(fromghost chilipepper) (SEQIDNO:4) ATGGCTACGGACAAATTTATTATTGAAGTTGAATCAGCAAAACCGGCAAA AGATGGTCGCCCGAGCATGGGCCCGGTCTATCGTTCGATCTTTGCGAAAC ATGGCTTTCCGCCGCCGATCCCGGGTCTGGATTCATGCTGGGACATTTTT CGTATGTCGGTGGAAAAATATCCGAACAATCGCATGCTGGGCCGTCGCGA AATTGTTGATGGCAAACCGGGTAAATACGTTTGGATGAGCTACAAAGAAG TCTACGACATCGTTATCAAAGTCGGTAACAGTATTCGTTCCATCGGCGTG GATGTTGGTGACAAATGCGGCATTTATGGTGCAAACTGTCCGGAATGGAT TATCAGCATGGAAGCATGCAATGCTCATGGCCTGTATTGTGTCCCGCTGT ACGATACCCTGGGCGCAGGTGCTGTGGAATTTATTATCTCTCACGCGGAA GTGACCATCGCCTTCGTTGAAGAGAAAAAACTGCCGGAACTGCTGAAAAC CTTTCCGAATGCGAGCAAATATCTGAAAACCATTGTCTCTTTCGGCAAAG TGACGCCGGAACAGAAGAAAGAACTGGAAGAATTTGGTGTGGTTCTGTAC AGTTGGGATGAATTTCTGCAGCTGGGCTCCGGTAAACAATTCGATCTGCC GGTGAAAAAGAAAGAAGATATTTGCACCATCATGTATACGAGCGGCACCA CGGGTGATCCGAAAGGTGTGCTGATTTCAAACACCTCGATTGTGACGCTG ATCGCCGGTGTTCGTCGCTTTCTGGGCTCAGTTGATGAATCGCTGAATGT GGATGACGTTTATCTGTCATACCTGCCGCTGGCACATATTTTTGACCGTG TGATCGAAGAATGCTTCATTCATCACGGCGCTTCGATCGGTTTTTGGCGC GGCGATGTGAAACTGCTGACCGAAGACATTGGCGAACTGAAACCGACGGT TTTCTGTGCGGTCCCGCGTGTGCTGGATCGCATCTATTCAGGTCTGCAGC AAAAAATTGCGGCCGGCGGTTTTCTGAAATCGACCCTGTTCAACCTGGCG TATGCCTACAAACATCACAATCTGAAGAAAGGCCGCAAACACTTTGAAGC CAGCCCGCTGTCTGATAAAGTCGTGTTCAGTAAAGTGAAAGAAGGCCTGG GCGGTCGTGTTCGCCTGATTCTGTCCGGTGCGGCTCCGCTGGCCGCACAT GTGGAAGCGTTTCTGCGTGTTGTCGCCTGCTGTCACGTTCTGCAGGGCTA TGGTCTGACCGAAACGTGCGCAGGCACCTTCGTGAGTCTGCCGAACCGCT ACGATATGCTGGGCACGGTTGGTCCGCCGGTCCCGAATGTCGATGTGTGC CTGGAAAGCGTGCCGGAAATGTCTTATGACGCTCTGAGCTCTACCCCGCG TGGTGAAGTTTGTGTCCGCGGCGATGTTCTGTTTTCCGGTTATTACAAAC GTGAAGACCTGACCAAAGAAGTTATGATTGATGGCTGGTTCCATACGGGC GACGTCGGTGAATGGCAGCCGAACGGTAGCCTGAAAATCATCGATCGTAA GAAAAACATCTTCAAACTGTCTCAAGGCGAATATGTGGCCGTTGAAAACC TGGAAAATATTTACGGCAACAATCCGATTATCGACAGCATTTGGATCTAT GGTAACAGTTTTGAATCCTTCCTGGTCGCGGTGATCAACCCGAATCAGCG TGCAGTCGAACAATGGGCTGAAGTGAATGGCCTGAGTGGTGATTTCGCCT CCCTGTGTGAAAAACCGGAAGTGAAAGAATACATTCTGCGCGAACTGACC AAAACGGGCAAAGAGAAAAAACTGAAAGGTTTCGAATTTCTGAAAGCAGT TCATCTGGACCCGGTGCCGTTTGATATGGAACGTGACCTGCTGACCCCGA CGTTCAAGAAAAAACGTCCGCAACTGCTGAAATACTATAAAGATGTGATC GACTCAATGTATAAAGGCACGAAATAA

[0070] Next, production of ACS1 and PUN1 was induced in the transformants. Briefly, an overnight culture of the transformants was grown in TB medium (2%) containing 50 mg/L of kanamycin and 100 mg/L of spectinomycin. The overnight culture was then diluted and grown at 37 C. to an OD600 of 0.6 and cooled down to 16 C. Then 1 mM IPTG was added to induce the expression of ACS1 and Pun1. After 1 hour of incubation at 16 C., the following substrates were added to the cultures: either (a) 500 mg/L of vanillyl alcohol (VA) and 500 mg/L of 6E-8-methylnonenoic acid (6E) or (b) 500 mg/L of VA and 500 mg/L of 8-methyl nonanoic acid (8M). The chemical structure of vanillyl alcohol is provided in FIG. 2. The chemical structures of 6E and 8M are provided below.

##STR00001##

[0071] Samples were taken at 16 hours after the feeding of substrates, putative capsiate (CQ) and dihydrocapsiate (DHCQ) were extracted by ethyl acetate, and putative CQ and DHCQ production was measured from the 6E or 8M cultures, respectively (FIG. 3). More quantitative data showed that this ACS1-Pun1 system preferred 8M as a substrate. Production of CQ and DHCQ after 16 hours of induction with 6E+VA or 8M+VA, respectively, was confirmed in triplicate experiments (FIG. 4).

[0072] Next, GC/MS analysis was performed to confirm the identity of CQ and DHCQ in the induced cultures. The GC/MS analysis was performed with a Shimadzu GC-2010 system coupled with a GC/MS-QP2010S detector. Column Rtx-5MS (thickness 0.25 u; length 30 m; diameter 0.25 mm) was used for separation. The injection temperature was 265 C., the injection mode was split, and the oven temperature was 140 C. The temperature gradient was as follows: 0-1 min, 140 C.; 1-11.25 min, 140 C. to 263 C., rate 12; 11.25-21.25 min, 263 C. The GC/MS spectra obtained for CQ and DHCQ from the induced cultures are shown in FIG. 5. These spectra were then compared to the standard spectrum for DHCP (dihydrocapsaicin) from the MS library in the GC/MS machine. DHCP was the closest match to CQ and DHCQ because the MS library did not contain a standard for CQ or DHCQ. Since DHCQ is one Dalton heavier than DHCP and CQ is one Dalton less than DHCP, the identity of CQ and DHCQ in the samples was firmly established by the GC/MS profiles (FIG. 6). These results show that the ACS1 and CS/AT3/Pun1 genes can be used to produce capsinoids by biosynthesis using VA and either 6E or 8M as starting materials.

REFERENCES

[0073] Hachiya S, Kawabata F, Ohnuki K, Inoue N, Yoneda H, Yazawa S and Fushiki T (2007). Effects of CH-19 Sweet, a Non-Pungent Cultivar of Red Pepper, on Sympathetic Nervous Activity, Body Temperature, Heart Rate, and Blood Pressure in Humans, Biosci. Biotechnol. Biochem, 71: 671-676, [0074] Han K, Jeong H J, Sung J, Keum Y S, Cho M C, Kim J H, Kwon J K, Kim B D, Kang B C (2013) Biosynthesis of capsinoid is controlled by the Pun1 locus in pepper. Molecular Breeding, 31: 537-548. [0075] Handler S, Rorvik D (2008): PDR for Nutritional Supplements Second Edition. Thomas Reuters. [0076] He G.-J. et al. (2009), European Journal of Medicinal Chemistry 44: 3345-3349. [0077] Inoue N. et al. (2007), Biosci Biotechnol Biochem 71: 380-389. [0078] Iwai K, Yazawa A, Watanabe T. (2003) Roles as metabolic regulators of the non-nutrients, capsaicin and capsiate, supplemented to diets. Proc Jpn Acad.; 79:207-212. [0079] Kawabata F. et al. (2006), BiosciBiotechnol Biochem 70:2824-2835. [0080] Kobata K, Todo T, Yazawa S, Iwai K, Watanabe T (1998) Novel capsaicinoid-like substances, capsiate and dihydrocapsiate, from the fruits of a nonpungent cultivar, CH-19 Sweet, of pepper (Capsicum annuum L.). Journal of Agricultural and Food Chemistry, 46: 1695-1697. [0081] Kobata K, Sutoh K, Todo T, Yazawa S, Iwai K, Watanabe T (1999) Nordihydrocapsiate, a new capsinoid from the fruits of a nonpungent pepper, Capsicum annuum. Journal of Natural Products, 62: 335-336. [0082] Macho A, Lucena C, Sancho R, Daddario N, Minassi A, Munoz E, Appendino G. (2003) Non-pungent Capsaicinoids from Sweet Pepper Synthesis and Evaluation of the Chemopreventive and Anticancer Potential. Eur. J. Nutr., 42: 2-9. [0083] Masuda Y, Haramizu S, Oki K, Ohnuki K, Watanabe T, Yazawa S, Kawada T, Hashizume S, Fushiki T (2003) Upregulation of uncoupling proteins by oral administration of capsiate, a nonpungent capsaicin analog. Journal of Applied Physiology, 95: 2408-2415. [0084] Ohnuki K, Niwa S, Maeda S, Inoue N, Yazawa S, Fushiki T. (2001) CH-19 sweet, a non-pungent cultivar of red pepper, increased body temperature and oxygen consumption in humans. Biosci Biotechnol Biochem., 65:2033-2036. [0085] Sancho R, Lucena C, Macho A, Caizado M, Bianco-Molina M, Minassi A, Appendino G and Munoz E. (2002) immunosuppressive Activity of Capsaicinoids: Capsiate Derived from Sweet Peppers inhibits NF-kappaB Activation and is a Potent Anti-inflammatory Compound in Vivo. Eur. J. Immunol. 32: 1753-1763. [0086] Snitker S, Fujishima Y, Shen H, Ott S, Pi-Sunyer X, Furuhata Y, Sato H, Takahashi M (2009) Effects of novel capsinoid treatment on fatness and energy metabolism in humans: possible pharmacogenetic implications. American Journal of Clinical Nutrition, 89: 45-50. [0087] Szallasi A, Blumberg P M, Annicelli L L, Krause J E, Cortright D N (1999) The cloned rat vanilloid receptor VR1 mediates both R-type binding and C-type calcium response in dorsal root ganglion neurons. Mol Pharmacol 56:581-587. [0088] Yazawa S, Suetome N, Okamoto K, Namiki T (1989) Content of capsaicinoids and capsaicinoid-like substances in fruit of pepper (Capsicum annuum L.) hybrids made with CH-19 Sweet as a Parent. Journal of the Japanese Society for Horticultural Science, 58: 601-607.