THERAPEUTIC ANTIBODIES AND USES THEREOF
20190010247 ยท 2019-01-10
Inventors
- Bradley Walsh (Turramurra, NSW, AU)
- Douglas Campbell (North Sydney, NSW, AU)
- Sandra Wissmueller (Currans Hills, NSW, AU)
Cpc classification
A61K47/6889
HUMAN NECESSITIES
A61K47/6859
HUMAN NECESSITIES
A61K47/6869
HUMAN NECESSITIES
C07K2317/73
CHEMISTRY; METALLURGY
A61K51/1045
HUMAN NECESSITIES
A61K47/6849
HUMAN NECESSITIES
A61K51/1027
HUMAN NECESSITIES
A61K47/6861
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
C07K16/3069
CHEMISTRY; METALLURGY
A61K47/6851
HUMAN NECESSITIES
A61K51/1072
HUMAN NECESSITIES
A61K51/1096
HUMAN NECESSITIES
C07K2317/24
CHEMISTRY; METALLURGY
International classification
A61P35/00
HUMAN NECESSITIES
A61K51/10
HUMAN NECESSITIES
Abstract
The present invention relates to therapeutic antibodies for the treatment of cancer, and more specifically, for the treatment of prostate, bladder, and/or pancreatic cancer. An embodiment of the present invention is an anti-glypican-1 (GPC 1) antibody, which may be conjugated to at least one cytotoxic agent that is toxic to a prostate, bladder, and/or pancreatic cancer cell.
Claims
1. A method for treating prostate, bladder, and/or pancreatic, cancer in a subject, the method comprising administering to the subject a pharmaceutical preparation comprising an anti-glypican-1 (anti-GPC1) antibody and/or an antigen-binding fragment thereof, wherein the antibody and/or fragment is conjugated to at least one cytotoxic agent that is toxic to a prostate, bladder, and/or pancreatic cancer cell in the subject.
2. The method according to claim 1, wherein the pharmaceutical preparation does not comprise an antibody with a light chain variable region comprising: a complementarity determining region 1 (CDR1) comprising or consisting of an amino acid sequence defined by positions 48-58 of SEQ ID NO: 11; a complementarity determining region 2 (CDR2) comprising or consisting of an amino acid sequence defined by positions 74-80 of SEQ ID NO: 11; a complementarity determining region 3 (CDR3) comprising or consisting of an amino acid sequence defined by positions 113-121 of SEQ ID NO: 11.
3. The method according to claim 1, wherein the cytotoxic agent is a prodrug designed for activation upon uptake into an endosome or lysosome of said prostate, bladder, and/or pancreatic cancer cell.
4. The method according to claim 3, wherein the prodrug is conjugated to the antibody and/or an antigen-binding fragment thereof by: an acid sensitive-linker susceptible to cleavage at a pH that is less than: pH 7.2, pH 7.0, pH 6.5, pH 6.0, pH 5.5, pH 5.0, pH 4.5, or pH 4. an enzyme-cleavable linker, wherein the enzyme capable of cleaving the linker exists within the endosome or lysosome.
5. The method according to claim 1, wherein the antibody comprises: (a) a heavy chain variable region comprising: a complementarity determining region 1 (CDR1) comprising or consisting of an amino acid sequence defined by positions 50-54 of SEQ ID NO: 3; a complementarity determining region 2 (CDR2) comprising or consisting of an amino acid sequence defined by positions 69-85 of SEQ ID NO: 3; a complementarity determining region 3 (CDR3) comprising or consisting of an amino acid sequence defined by positions 118-126 of SEQ ID NO: 3; and (b) a light chain variable region comprising: a complementarity determining region 1 (CDR1) comprising or consisting of an amino acid sequence defined by positions 44-54 of SEQ ID NO: 4; a complementarity determining region 2 (CDR2) comprising or consisting of an amino acid sequence defined by positions 70-76 of SEQ ID NO: 4; a complementarity determining region 3 (CDR3) comprising or consisting of an amino acid sequence defined by positions 109-117 of SEQ ID NO: 4.
6. The method according to claim 5, wherein the antibody is produced by a hybridoma cell as deposited at Cellbank Australia under accession number CBA20140026, or progeny thereof.
7. The method according to claim 1, wherein the antibody is: (i) a humanised anti-GPC1 antibody, (ii) a chimeric anti-GPC1 antibody, (i) a human anti-GPC1 antibody, (ii) a monoclonal anti-GPC1 antibody, (iii) a multimeric anti-GPC1 antibody, or (iv) a synthetic anti-GPC1 antibody.
8. The method according to claim 7, wherein the antibody is a chimeric antibody comprising: (a) a heavy chain constant region comprising or consisting of an amino acid sequence as defined in residues 138-467 of SEQ ID NO: 7; and (b) a light chain constant region comprising or consisting of an amino acid sequence as defined in residues of 128-234 SEQ ID NO: 8.
9. The method according to claim 1, wherein the antigen-binding fragment thereof is: a single chain variable fragment (scFv), a single chain variable fragment (scFv) comprising a sequence as defined in SEQ ID NO: 9, a variable domain (Fv) fragment, a fragment antigen binding (Fab) fragment, a F(ab)2 fragment, a peptide, or a proteolytic fragment containing an epitope binding region.
10. (canceled)
11. The method according to claim 1, wherein the cytotoxic agent is selected from the group consisting of: (a) an adrenocortical suppressant, an alkylating agent, an alkyl sulfonate, an anthracycline, an anti-angiogenic agent, an antibiotic, an antimetabolite, an antimitotic, an auristatin, a calicheamycin, a camptothecin, a COX-2 inhibitor, an enzyme inhibitor, an epipodophyllotoxin, an ethylenimine derivative, a folic acid analog, an HDAC inhibitor, a heat shock protein (HSP90) inhibitor, a hormone antagonist, a maytansinoid, a methyl hydrazine derivative, an mTOR inhibitor, a nitrogen mustard, a nitrosourea, a platinum coordination complex, a pro-apoptotic agent, a proteosome inhibitor, a purine analog, a pyrimidine analog, a radioisotope, a substituted urea, a taxane, triazene, a tubulin inhibitor, a tyrosine kinase inhibitor, and a vinca alkaloid; (b) afatinib, aplidin, anastrozole, anthracyclines, AVL-101, AVL-291, axitinib, azaribine, bendamustine, bleomycin, bortezomib, bosutinib, bryostatin-1, busulfan, camptothecans, carboplatin, calicheamycin, camptothecin, carboplatin, carmustine, celecoxib, chlorambucil, cisplatinum, cladribine, COX-2 inhibitors, crizotinib, cyano-morpholino doxorubicin, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, dasatinib, daunorubicin, dinaciclib, 3,5-0-dioleoyl-FudR (FUdR-d0), DM1, DM3, DM4, docetaxel, doxorubicin, doxorubicin glucuronide, duocarmycin, endostatin, entinostat, epidophyllotoxin, epirubicin glucuronide, erlotinib, estramustine, estrogen receptor binding agents, etoposide glucuronide, etoposide phosphate, etoposide (VP16), exemestane, farnesyl-protein transferase inhibitors, fingolimod, flavopiridol, floxuridine (FUdR), fludarabine, 5-fluorouracil, flutamide, fostamatinib, ganetespib, GDC-0834, gefitinib, gemcitabine, GS-1101, 10-hydroxycamptothecin, hydroxyurea, ibrutinib, idarubicin, idelalisib, ifosfamide, imatinib, irinotecan (CPT-11), lapatinib, lenolidamide, leucovorin, LFM-A13, lomustine, mechlorethamine, melphalan, mercaptopurine, 6-mercaptopurine, methotrexate, mithramycin, mitomycin, mitotane, mitoxantrone, monomethylauristatin D (MMAD), monomethylauristatin E (MMAE), monomethylauristatin F (MMAF), navelbine, neratinib, nilotinib, nitrosurea, olaparib, paclitaxel, PCI-32765, pentostatin, plicomycin, a 2-PDox pro-drug (pro-2-PDox), procarbazine, PSI-341, 2-pyrrolinodoxorubicine (2-PDox), raloxifene, semustine, SN-38, sorafenib, streptozocin, SU1 1248, sunitinib, tamoxifen, temazolomide, teniposide, thalidomide, thioguanine, thiotepa, topotecan, transplatinum, uracil mustard, vatalanib, vinblastine, vinca alkaloids, vincristine, vinorelbine, and ZD 1839.
12. (canceled)
13. The method according to claim 1, wherein the cytotoxic agent is: (a) a radioisotope; (b) a radioisotope selected from the group, consisting of: .sup.90Y, .sup.188Re, .sup.166Ho, .sup.165Dy, .sup.109Pd, .sup.111Ag, .sup.186Re, .sup.198Au, .sup.153Sm, .sup.64Cu, .sup.177Lu, .sup.131I, .sup.125I, .sup.67Cu, .sup.175Yb, .sup.166Dy, .sup.169Er, .sup.212Bi, .sup.213Bi, .sup.225Ac, .sup.212Pb, .sup.66Ga, .sup.67Ga, .sup.68Ga, .sup.64Cu, .sup.86Y, .sup.94mTc, and .sup.89Zr.
14. (canceled)
15. (canceled)
16. The method according to claim 1, wherein the subject is a mammalian subject or a human subject.
17. An isolated antibody population comprising: first antibodies and/or antigen binding fragments thereof, that are conjugated to at least one cytotoxic agent which is toxic to a prostate, bladder, and/or pancreatic cancer cell, wherein the first antibodies comprise: (a) a heavy chain variable region comprising: a complementarity determining region 1 (CDR1) comprising or consisting of an amino acid sequence defined by positions 50-54 of SEQ ID NO: 3; a complementarity determining region 2 (CDR2) comprising or consisting of an amino acid sequence defined by positions 69-85 of SEQ ID NO: 3; a complementarity determining region 3 (CDR3) comprising or consisting of an amino acid sequence defined by positions 118-126 of SEQ ID NO: 3; and (b) a light chain variable region comprising: a complementarity determining region 1 (CDR1) comprising or consisting of an amino acid sequence defined by positions 44-54 of SEQ ID NO: 4; a complementarity determining region 2 (CDR2) comprising or consisting of an amino acid sequence defined by positions 70-76 of SEQ ID NO: 4; a complementarity determining region 3 (CDR3) comprising or consisting of an amino acid sequence defined by positions 109-117 of SEQ ID NO: 4; and wherein the antibody population does not contain second antibodies comprising a light chain variable region comprising: a complementarity determining region 1 (CDR1) comprising or consisting of an amino acid sequence defined by positions 48-58 of SEQ ID NO: 11; a complementarity determining region 2 (CDR2) comprising or consisting of an amino acid sequence defined by positions 74-80 of SEQ ID NO: 11; a complementarity determining region 3 (CDR3) comprising or consisting of an amino acid sequence defined by positions 113-121 of SEQ ID NO: 11.
18. The antibody population according to claim 17, wherein the first antibodies and/or antigen binding fragments thereof are any one or more of monoclonal antibodies, humanised antibodies, chimeric antibodies, multimeric antibodies, and/or synthetic antibodies.
19. The antibody population according to claim 17, wherein the antigen binding fragments are any one or more of single chain variable fragments (scFv), single chain variable fragments (scFv) comprising a sequence as defined in SEQ ID NO: 9, variable domain (Fv) fragments, fragment antigen binding (Fab) fragments, F(ab)2 fragments, peptides, or proteolytic fragments containing an epitope binding region.
20. The antibody population according to claim 17, wherein the first antibodies comprise or consist of a heavy chain sequence as defined by positions 20-461 of SEQ ID NO: 3 and a light chain sequence as defined by positions 21-234 of SEQ ID NO: 4.
21. (canceled)
22. The antibody population according to claim 18, wherein the first antibodies and/or antigen binding fragments thereof are chimeric antibodies comprising: (a) a heavy chain constant region comprising or consisting of an amino acid sequence as defined in residues 138-467 of SEQ ID NO: 7; and (b) a light chain constant region comprising or consisting of an amino acid sequence as defined in residues of 128-234 SEQ ID NO: 8.
23. (canceled)
24. The antibody population according to claim 17, wherein the cytotoxic agent is selected from the group consisting of: (a) an adrenocortical suppressant, an alkylating agent, an alkyl sulfonate, an anthracycline, an anti-angiogenic agent, an antibiotic, an antimetabolite, an antimitotic, an auristatin, a calicheamycin, a camptothecin, a COX-2 inhibitor, an enzyme inhibitor, an epipodophyllotoxin, an ethylenimine derivative, a folic acid analog, an HDAC inhibitor, a heat shock protein (HSP90) inhibitor, a hormone antagonist, a maytansinoid, a methyl hydrazine derivative, an mTOR inhibitor, a nitrogen mustard, a nitrosourea, a platinum coordination complex, a pro-apoptotic agent, a proteosome inhibitor, a purine analog, a pyrimidine analog, a radioisotope, a substituted urea, a taxane, triazene, a tubulin inhibitor, a tyrosine kinase inhibitor, and a vinca alkaloid; (b) afatinib, aplidin, anastrozole, anthracyclines, AVL-101, AVL-291, axitinib, azaribine, bendamustine, bleomycin, bortezomib, bosutinib, bryostatin-1, busulfan, camptothecans, carboplatin, calicheamycin, camptothecin, carboplatin, carmustine, celecoxib, chlorambucil, cisplatinum, cladribine, COX-2 inhibitors, crizotinib, cyano-morpholino doxorubicin, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, dasatinib, daunorubicin, dinaciclib, 3,5-0-dioleoyl-FudR (FUdR-d0), DM1, DM3, DM4, docetaxel, doxorubicin, doxorubicin glucuronide, duocarmycin, endostatin, entinostat, epidophyllotoxin, epirubicin glucuronide, erlotinib, estramustine, estrogen receptor binding agents, etoposide glucuronide, etoposide phosphate, etoposide (VP16), exemestane, farnesyl-protein transferase inhibitors, fingolimod, flavopiridol, floxuridine (FUdR), fludarabine, 5-fluorouracil, flutamide, fostamatinib, ganetespib, GDC-0834, gefitinib, gemcitabine, GS-1101, 10-hydroxycamptothecin, hydroxyurea, ibrutinib, idarubicin, idelalisib, ifosfamide, imatinib, irinotecan (CPT-11), lapatinib, lenolidamide, leucovorin, LFM-A13, lomustine, mechlorethamine, melphalan, mercaptopurine, 6-mercaptopurine, methotrexate, mithramycin, mitomycin, mitotane, mitoxantrone, monomethylauristatin D (MMAD), monomethylauristatin E (MMAE), monomethylauristatin F (MMAF), navelbine, neratinib, nilotinib, nitrosurea, olaparib, paclitaxel, PCI-32765, pentostatin, plicomycin, a 2-PDox pro-drug (pro-2-PDox), procarbazine, PSI-341, 2-pyrrolinodoxorubicine (2-PDox), raloxifene, semustine, SN-38, sorafenib, streptozocin, SU1 1248, sunitinib, tamoxifen, temazolomide, teniposide, thalidomide, thioguanine, thiotepa, topotecan, transplatinum, uracil mustard, vatalanib, vinblastine, vinca alkaloids, vincristine, vinorelbine, and ZD 1839.
25. (canceled)
26. The method according to claim 17, wherein the cytotoxic agent is: (a) a radioisotope; (b) a radioisotope selected from the group consisting of: .sup.90Y, .sup.188Re, .sup.166Ho, .sup.165Dy, .sup.109Pd, .sup.111Ag, .sup.186Re, .sup.198Au, .sup.153Sm, .sup.64Cu, .sup.177Lu, .sup.131I, .sup.125I, .sup.67Cu, .sup.175Yb, .sup.166Dy, .sup.169Er, .sup.212Bi, .sup.213Bi, .sup.225Ac, .sup.212Pb, .sup.66Ga, .sup.67Ga, .sup.68Ga, .sup.64Cu, .sup.86Y, .sup.94mTc, and .sup.89Zr.
27-28. (canceled)
29. The antibody population according to claim 17, wherein the cytotoxic agent is a prodrug designed for activation upon uptake into an endosome or lysosome of said prostate, bladder, and/or pancreatic cancer cell.
30. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0100] Preferred embodiments of the present invention will now be described, by way of example only, with reference to the accompanying figures wherein:
[0101]
[0102]
[0103]
[0104]
[0105]
[0106]
[0107]
[0108]
[0109]
[0110]
[0111]
[0112]
[0113]
[0114]
[0115]
[0116]
[0117]
[0118]
[0119]
[0120]
DEFINITIONS
[0121] As used in this application, the singular form a, an and the include plural references unless the context clearly dictates otherwise. For example, the phrase an antibody also includes multiple antibodies.
[0122] As used herein, the term comprising means including. Variations of the word comprising, such as comprise and comprises, have correspondingly varied meanings. Thus, for example, a sample comprising antibody A may consist exclusively of antibody A or may include one or more additional components (e.g. antibody B).
[0123] As used herein the term multiple means more than one. In certain specific aspects or embodiments, multiple may mean 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, or more, and any integer derivable therein, and any range derivable therein.
[0124] As used herein, the terms antibody and antibodies include IgG (including IgG1, IgG2, IgG3, and IgG4), IgA (including IgA and IgA2), IgD, IgE, IgM, and IgY, whole antibodies, including single-chain whole antibodies, and antigen-binding fragments thereof. Antigen-binding antibody fragments include, but are not limited to, Fv, Fab, Fab and F(ab)2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv) and fragments comprising either a VL or VH domain. The antibodies may be from any animal origin or appropriate production host. Antigen-binding antibody fragments, including single-chain antibodies, may comprise the variable region/s alone or in combination with the entire or partial of the following: hinge region, CH1, CH2, and CH3 domains. Also included are any combinations of variable region/s and hinge region, CH1, CH2, and CH3 domains. Antibodies may be monoclonal, polyclonal, chimeric, multispecific, humanised, and human monoclonal and polyclonal antibodies which specifically bind the biological molecule. The antibody may be a bi-specific antibody, avibody, diabody, tribody, tetrabody, nanobody, single domain antibody, VHH domain, human antibody, fully humanized antibody, partially humanized antibody, anticalin, adncctin, or affibody.
[0125] As used herein the term monoclonal antibody refers to an antibody that recognises a single antigenic epitope, and that is obtained from a population of substantially homogeneous antibodies which bind specifically to the same antigenic epitope, and are identical with the potential exception of naturally occurring mutation/s that may be present in minor amounts.
[0126] As used herein, the term humanised antibody refers to forms of antibodies that contain sequences from human antibodies as well as non-human antibodies (e.g. murine antibodies). For example, a humanised antibody can comprise substantially all of at least one and typically two variable domains, in which all/substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin and all/substantially all of the FR regions are from the human immunoglobulin sequence. The humanised antibody may optionally also comprise at least a portion of an immunoglobulin constant region (Fc) which may typically be that of a human immunoglobulin.
[0127] As used herein, the term chimeric antibody refers to an antibody which exhibits a desired biological activity, and in which a portion of the light chain and/or heavy chain is identical to or homologous with corresponding sequences in antibodies derived from a given/specific species, while the remaining chain/s is/are identical to or homologous with corresponding sequences in antibodies derived from another different species. For example, a chimeric antibody may comprise variable regions that are derived from a first species and comprise constant regions that are derived from a second species. Chimeric antibodies can be constructed for example by genetic engineering from immunoglobulin gene segments belonging to different species.
[0128] As used herein, the term hybridoma refers to a cell produced by the fusion of an immortal cell (e.g. a multiple myeloma cell) and an antibody-producing cell (e.g. a B lymphocyte), which is capable of producing monoclonal antibodies of a single binding specificity.
[0129] As used herein, the terms binding specifically and specifically binding in reference to an antibody, antibody variant, antibody derivative, antigen binding fragment, and the like refers to its capacity to bind to a given target molecule preferentially over other non-target molecules. For example, if the antibody, antibody variant, antibody derivative, or antigen binding fragment (molecule A) is capable of binding specifically or specifically binding to a given target molecule (molecule B), molecule A has the capacity to discriminate between molecule B and any other number of potential alternative binding partners. Accordingly, when exposed to a plurality of different but equally accessible molecules as potential binding partners, molecule A will selectively bind to molecule B and other alternative potential binding partners will remain substantially unbound by molecule A. In general, molecule A will preferentially bind to molecule B at least 10-fold, preferably 50-fold, more preferably 100-fold, and most preferably greater than 100-fold more frequently than other potential binding partners. Molecule A may be capable of binding to molecules that are not molecule B at a weak, yet detectable level. This is commonly known as background binding and is readily discernible from molecule B-specific binding, for example, by use of an appropriate control.
[0130] As used herein, the term cytotoxic agent encompasses any compound that is toxic to a cell such as, for example by, inhibiting cell function, and including but not limited to, causing cell death directly and/or indirectly.
[0131] As used herein, the terms conjugate, conjugated and conjugation in the context of a cytotoxic agent as described herein and an antibody, antibody derivative, or antigen binding fragment of an antibody described herein will be understood to mean that the cytotoxic agent is linked to the antibody, antibody derivative, or antigen binding fragment. The link may occur directly between the cytotoxic agent and the antibody, or alternatively the link between the cytotoxic agent and the antibody may occur indirect via one or more intervening molecules (e.g. protein-G).
[0132] As used herein, the term subject includes any animal of economic, social or research importance including bovine, equine, ovine, primate, avian and rodent species. Hence, a subject may be a mammal such as, for example, a human or a non-human mammal.
[0133] Any description of prior art documents herein, or statements herein derived from or to based on those documents, is not an admission that the documents or derived statements are part of the common general knowledge of the relevant art. For the purposes of description all documents referred to herein are hereby incorporated by reference in their entirety unless otherwise stated.
DETAILED DESCRIPTION
[0134] A need continues to exist for more effective methods and agents to treat prostate, bladder, and/or pancreatic cancer. Antibodies are useful diagnostic and therapeutic agents for cancer, having become a successful and important tool for diagnosing and treating patients with haematological malignancies and solid tumours. The identification of new relevant antibodies targeting tumour-specific antigens offers one potential means of improving diagnostic and/or therapeutic outcomes for cancer patients. Another means by which these outcomes can be enhanced is through the improvement of existing antibody-based diagnostics and/or therapies.
[0135] The present inventors have surprisingly identified that the BLCA-38 antibody referred to and used in the prior art is not a discrete monoclonal antibody as indicated, but rather a combination of two distinct monoclonal antibodies in a mixed population. The present inventors have determined that the hybridoma used to generate the BLCA-38 antibody, a representative sample of which was deposited at the American Tissue Type Culture Collection under accession number HB11785, is a mixed population of hybridoma cells, which produces at least two discrete antibody species. Only one of these antibody species can bind strongly to the relevant target antigen present on prostate, bladder, and/or pancreatic cancer cells, whilst the second species cannot.
[0136] The unexpected determination that BLCA-38 as referred to in the prior art represents a mixed hybridoma/antibody population has facilitated the generation of a monoclonal hybridoma capable of producing a single population of monoclonal antibodies with binding specificity for the target antigen on prostate, bladder, and/or pancreatic cancer cells. This circumvents the unnecessary production and application of an ineffectual therapeutic antibody. It is also well known that the cost of therapeutic antibody production is high, and in particular when post-production modifications are required such as ADC production or conjugation of chelating agents for radio-immunotherapy. It is clearly beneficial to avoid preparing ADC or chelated monoclonal antibodies from antibodies that do not bind the target prostate, bladder, and/or pancreatic cancer cell antigen. The actual target of the antibody species in the BLCA-38 mixed population that does not bind to the prostate, bladder, and/or to pancreatic cancer antigen is unknown raising the risk of unwanted side-effects from potential binding to non-target cells.
[0137] The present inventors have also unexpectedly discovered that contrary to prior art teachings that the BLCA-38 antibody population is not internalised on binding to cancer cells, the present inventors have demonstrated that antibodies of the monoclonal antibody species are in fact internalised upon binding to the relevant target antigen present on prostate, bladder, and/or pancreatic cancer cells.
[0138] Accordingly, certain embodiments of the present invention relate to the provision of a monoclonal antibody population derived from clonal hybridoma cells, each member of the antibody population being capable of binding specifically to an antigen present on prostate, bladder, and/or pancreatic cancer cells. The present invention also provides antigen binding fragments of these antibodies, as well as derivatives and variants of the antibodies that maintain the same binding specificity. The antibodies and fragments are each conjugated to at least one cytotoxic agent that is toxic to a prostate, bladder, and/or pancreatic cancer cell in the subject.
[0139] In view of providing antibody conjugates capable of specifically targeting prostate, bladder, and/or pancreatic cancer cells, other embodiments of the present invention relate to methods for treating prostate, bladder, and/or pancreatic cancer in subjects afflicted with the same, and methods for killing prostate, bladder, and/or pancreatic cells and tumours.
[0140] Further aspects of the present invention relate to medicaments and pharmaceutical preparations comprising the conjugated antibodies and/or fragments, and methods for their preparation.
Antibodies and Antigen-Binding Fragments
[0141] The present invention provides antibodies, derivatives of such antibodies, and antigen binding fragments thereof, each conjugated to at least one cytotoxic agent.
[0142] In alternative embodiments, the antibodies, derivatives of such antibodies, and antigen binding fragments thereof, are provided without being conjugated to at least one cytotoxic agent (i.e. naked).
[0143] The antibodies, variants, derivatives, and antigen binding fragments are capable of binding specifically to an antigenic epitope present in glypican-1 heparan sulfate proteoglycan (GPC-1). The GPC-1 protein may be a human glypican-1 protein (e.g. as to defined by a sequence set forth in any one of: NCBI reference sequence accession no. NP_002072.2, GenBank accession no. AAH51279.1, GenBank accession no. AAA98132.1, GenBank accession no. EAW71184.1, or UniProtKB/Swiss-Prot accession no. P35052.2). In some embodiments the GPC-1 protein may not include a signal peptide and/or a propeptide. Additionally or alternatively, the monoclonal antibodies, derivatives, and antigen binding fragments may be capable of binding specifically to an antigenic epitope present in a GPC-1 variant (e.g. a GPC-1 isoform, splice variant, or allotype).
[0144] By way of non-limiting example, the antibodies, variants, derivatives, and antigen binding fragments may comprise a heavy chain and/or a light chain, combinations thereof, or component/s thereof.
[0145] Non-limiting examples of suitable anti-GPC1 antibodies include those set out in Table 1 below.
TABLE-US-00001 TABLE 1 non-limiting examples of anti-GPC1 antibodies Binding Company Cat# Reactivity Use Host M/P specificity Immunogen R & D BAF4519 Human WB, FC Goat poly aa24-530 mouse myeloma cell line NS0-derived recombinant human Glypican-1, Asp24-Ser530 (Accession# P35052) Bioss bs-2426R- Human, mouse, WB, Rabbit poly Unknown immunogen. Biotin conjugated Biotin rat, dog, cow, ELISA, horse IHC-P & F Bioss bs-2426-HRP Human, mouse, WB, Rabbit poly Unknown immunogen. HRP conjugated rat, dog, cow, ELISA, horse IHC-P & F antibodies ABIN740102 Human, mouse, WB, Rabbit poly C-term Synthetic peptide derived from human glypican 1 C- -online rat, dog, cow, ELISA, terminus. Biotin conjugated. horse IHC-P & F antibodies ABIN1174125 Human IHC, WB, Rabbit poly Unknown immunogen. Biotin conjugated -online ELISA antibodies ABIN740109 Human, mouse, WB, Rabbit poly C-term Synthetic peptide derived from human glypican 1 C- -online rat, dog, cow, ELISA, terminus. Enquire about sequence info. HRP horse IGC-P & F conjugated antibodies ABIN653109 Human WB, IHC, Rabbit poly N-term KLH conjugated synthetic peptide between 12-41aa -online FACS, from the N-terminal region of human Glypican-1 ELISA antibodies ABIN952553 human ELISA, Rabbit poly N-term KLH conjugated synthetic peptide between 12-41aa -online IHC-p, from the N-terminal region of human Glypican-1 WB, FACS antibodies ABIN797896 human IHC, WB Rabbit poly N-term synthetic peptide derived from N-terminal domain of -online human GPC1 antibodies ABIN347483 mouse, rat, IHC, WB Rabbit poly N-term synthetic peptide derived from N-terminal domain of -online human human GPC1 antibodies ABIN347484 human IHC, WB, Rabbit poly N-term synthetic peptide derived from N-terminal domain of -online ICC, human GPC1 ELISA antibodies ABIN740100 Human, mouse, WB, Rabbit poly C-term Synthetic peptide derived from human glypican 1 C- -online rat, dog, cow, ELISA, terminus. Enquire about sequence info. horse IHC- P & F, IF antibodies ABIN207433 human WB, Rabbit poly C-term synthetic peptide corresponding to C-terminal -online ELISA residues of human GPC1 precursor antibodies ABIN964659 human, mouse, WB, Rabbit poly internal synthetic peptide corresponding to an internal region -online rat ELISA region of human GPC-1 antibodies ABIN349638 human WB, Rabbit poly internal synthetic peptide corresponding to human GPC1 -online ELISA region antibodies ABIN1101824 human WB, Rabbit poly internal synthetic peptide corresponding to an internal region -online ELISA poly of human GPC-1 antibodies ABIN595376 human WB, Rabbit poly internal synthetic peptide corresponding to an internal region -online ELISA region of human GPC-1 antibodies ABIN330371 human WB, goat poly aa24-530 NS0-derived rhGlypican 1 aa24-530 -online ELISA antibodies ABIN1479675 human FACS, Rabbit poly aa12-41 KLH conjugated synthetic peptide from N-terminal -online IHC, WB, region of human GPC1 ELISA
[0146] The heavy chain or component/s thereof may comprise a heavy chain variable region comprising one, two, or three complementarity determining regions (CDR1, CDR2, and/or CDR3), also known in the art as heavy chain hypervariable (HV) regions. The heavy chain CDR1 may comprise or consist of an amino acid sequence as defined by residues 50-54 of SEQ ID NO: 3. The heavy chain CDR2 may comprise or consist of an amino acid sequence as defined by residues 69-85 of SEQ ID NO: 3. The heavy chain CDR3 may comprise or consist of an amino acid sequence as defined by residues 118-126 of SEQ ID NO: 3.
[0147] Additionally or alternatively, the heavy chain variable region may comprise one, two, three, or four framework regions (FR1, FR2, FR3, and/or FR4). The heavy chain FR1 may comprise or consist of an amino acid sequence as defined by residues 20-49 of SEQ ID NO: 3. The heavy chain FR2 may comprise or consist of an amino acid sequence as defined by residues 55-68 of SEQ ID NO: 3. The heavy chain FR3 may comprise or consist of an amino acid sequence as defined by residues 86-117 of SEQ ID NO: 3. The heavy chain FR4 may comprise or consist of an amino acid sequence as defined by residues 127-137 of SEQ ID NO: 3.
[0148] Additionally or alternatively, the heavy chain variable region may comprise a leader sequence. The heavy chain leader sequence may comprise or consist of an amino acid sequence as defined by residues 1-19 of SEQ ID NO: 3. The skilled person will recognise that the leader sequence is a signal sequence which facilitates the transport of a newly synthesised heavy chain into the endoplasmic reticulum, and is generally not present in the heavy chain of the final assembled form of the monoclonal antibody.
[0149] Additionally or alternatively, the light chain or component/s thereof may comprise a light chain variable region comprising one, two, or three complementarity determining regions (CDR1, CDR2, CDR3) also known in the art as light chain hypervariable (HV) regions. The light chain CDR1 may comprise or consist of an amino acid sequence as defined by residues 44-54 of SEQ ID NO: 4. The light chain CDR2 may comprise or consist of an amino acid sequence as defined by residues 70-76 of SEQ ID NO: 4. The light chain CDR3 may comprise or consist of an amino acid sequence as defined by residues 109-117 of SEQ ID NO: 4.
[0150] Additionally or alternatively, the light chain variable region may comprise one, two, three, or four framework regions (FR1, FR2, FR3, FR4). The light chain FR1 may comprise or consist of an amino acid sequence as defined by residues 21-43 of SEQ ID NO: 4. The light chain FR2 may comprise or consist of an amino acid sequence as defined by residues 55-69 of SEQ ID NO: 4. The light chain FR3 may comprise or consist of an amino acid sequence as defined by residues 77-108 of SEQ ID NO: 4. The light chain FR4 may comprise or consist of an amino acid sequence as defined by residues 118-127 of SEQ ID NO: 4.
[0151] Additionally or alternatively, the light chain variable region may comprise a leader sequence. The light chain leader sequence may comprise or consist of an amino acid sequence as defined by residues 1-20 of SEQ ID NO: 4. The skilled person will recognise that the leader sequence is a signal sequence which facilitates transport of a newly synthesised light chain into the endoplasmic reticulum, and is generally not present in the light chain of the final assembled form of the monoclonal antibody.
[0152] Additionally or alternatively, the heavy chain may comprise one, two, or three heavy chain constant regions. The heavy chain constant region may comprise or consist of an amino acid sequence as defined by residues 138-461 of SEQ ID NO: 3.
[0153] Additionally or alternatively, the light chain may comprise a light chain constant region. The light chain constant region may comprise or consist of an amino acid sequence as defined by residues 128-234 of SEQ ID NO: 4.
[0154] In some embodiments, monoclonal antibodies, variants, derivatives, and antigen binding fragments according to the present invention may comprise a heavy chain variable region which comprises or consists of an amino acid sequence as defined by residues 20-137 of SEQ ID NO: 3. The monoclonal antibodies, variants, derivatives, and antigen binding fragments may comprise one or two of the heavy chain variable regions.
[0155] In some embodiments, monoclonal antibodies, variants, derivatives, and antigen binding fragments according to the present invention may comprise a light chain variable region which comprises or consists of an amino acid sequence as defined by residues 21-127 of SEQ ID NO: 4. The monoclonal antibodies, variants, derivatives, and antigen binding fragments may comprise one or two of the light chain variable regions.
[0156] In some embodiments, monoclonal antibodies, variants, derivatives, and antigen binding fragments according to the present invention may comprise a heavy chain variable region which comprises or consists of residues 20-137 of SEQ ID NO: 3, and a light chain variable region which comprises or consists of residues 21-127 of SEQ ID NO: 4. The monoclonal antibodies, variants, derivatives, and antigen binding fragments may comprise a combination of two of the heavy chain variable regions and two of the light chain variable regions.
[0157] In some embodiments, monoclonal antibodies, variants, derivatives, and antigen binding fragments according to the present invention may comprise a heavy chain comprising or consisting of an amino acid sequence as defined by residues 20-461 of SEQ ID NO: 3. The monoclonal antibodies, variants, derivatives, and antigen binding fragments may comprise one or two of the heavy chains.
[0158] In some embodiments, monoclonal antibodies, variants, derivatives, and antigen binding fragments according to the present invention may comprise a light chain comprising or consisting of an amino acid sequence as defined by residues 21-234 of SEQ ID NO: 4. The monoclonal antibodies, variants, derivatives, and antigen binding fragments may comprise one or two of the light chains.
[0159] In some embodiments, monoclonal antibodies, variants, derivatives, and antigen binding fragments according to the present invention may comprise a heavy chain comprising or consisting of an amino acid sequence as defined by residues 20-461 of SEQ ID NO: 3, and a light chain comprising or consisting of an amino acid sequence as defined by residues 21-234 of SEQ ID NO: 4. The monoclonal antibodies, variants, derivatives, and antigen binding fragments may comprise or consist of a combination of two of the heavy chains and two of the light chains.
[0160] Monoclonal antibodies, variants and derivatives of such antibodies, and antigen binding fragments thereof according to the present invention are not restricted to any particular isotype, and thus may be IgA (IgA1 or IgA2), IgD, IgE, IgG (IgG1, IgG2, IgG3, IgG4), or IgM isotype. In some embodiments, they are IgG1 isotype.
[0161] Included within the scope of the present invention are monoclonal antibodies produced by hybridoma cells submitted under the terms of the Budapest Treaty at Cellbank Australia at 214 Hawkesbury Road, Westmcad NSW 2145, Australia on 22 Aug. 2014 under accession number CBA20140026. The hybridoma is a clonal population that produces a single antibody species having binding specific for an epitope existing in glypican-1 heparan sulfate proteoglycan (GPC-1).
[0162] Included within the scope of the present invention are fragments of the antibodies described herein. In general, the fragments are antigen binding fragments in the sense that they are capable of specifically binding to same antigen/epitope (e.g. GPC-1) as the parent antibody from which they are derived or upon which they are based. Typically, an antigen binding fragment retains at least 10% of the antigen/epitope binding capacity of the parent antibody, or, at least 25%, 50%, 60%, 70%, 80%, 90%, 95%, 99% or 100% (or more) of the antigen/epitope binding capacity of the parent antibody. It is also contemplated that an antigen binding fragment of an antibody described herein may include conservative amino acid substitutions that do not substantially alter its antigen/epitope binding specificity/capacity (e.g. at least 70%, 80%, 90%, 95%, 99% or 100% (or more) of its antigen/epitope binding specificity/capacity may be retained).
[0163] Non-limiting examples of antigen binding fragments include portions of a full length antibody, peptides and derivatives thereof including, for example, Fab, Fab, F(ab).sub.2, F(ab).sub.2, F(ab).sub.3, Fv, single-chain Fv (scFv), dsFv, Fd fragments, dAB fragments Fse, VH, VL, VhH, and V-NAR domains, paratopes, CDR regions, single-chain antibody molecules (e.g. sc-Fv), minibodies, diabodies, triabodies, tetrabodies, kappa bodies, linear antibodies, multispecific antibodies, domain antibodies formed from antibody fragments, multispecific antibody fragments formed from antibody fragments, and any portion or peptide sequence of the antibody that is capable of specifically binding to the relevant antigen/epitope (e.g. GPC-1).
[0164] Also included within the scope of the present invention are derivatives of the antibodies described herein. A derivative of an antibody of the present invention refers to an antibody described herein that is modified to incorporate additional components or have existing component/s altered, but is still capable of specifically binding to the same antigen/epitope (e.g. GPC-1) as the parent antibody from which it is derived. Typically, an antibody derivative as contemplated herein retains at least 10% of the antigen/epitope binding capacity of the parent antibody, or, at least 25%, 50%, 60%, 70%, 80%, 90%, 95%, 99% or 100% (or more) of the antigen/epitope binding capacity of the parent antibody.
[0165] Non-limiting examples of modifications suitable to form antibody derivatives include amidation, glycosylation, phosphorylation, pegylation, linkage to a cellular ligand or other protein, derivatisation by known protecting/blocking groups, acetylation, and the like. Additionally or alternatively, the derivative may contain one or more non-classical amino acids. Modifications may also include conjugation with a chelating agent such as DOTA, DTPA, NOTA, NODAGA, MeCOSAR, TETA, TRAP, TE2A, and CBTE2A.
[0166] The antibody derivatives may include labelled antibodies such as, for example, monoclonal antibodies labelled with radioactive iodine, indium, sulphur, carbon, tritium or the like; monoclonal antibodies conjugated with avidin or biotin, monoclonal antibodies conjugated with enzymes (e.g. horseradish, glucose 6-phosphate dehydrogenase glucose oxidase, beta-D-galactosidase, alkaline phosphatase, glucoamylase, acetylcholine esterase, carboxylic acid anhydrase, malate dehydrogenase, lysozyme, or peroxidase), and monoclonal antibodies conjugated with chemiluminescent agents (e.g. acridine esters), bioluminescent agents (e.g. luciferase), or fluorescent agents (e.g. phycobiliproteins). Further examples of antibody derivatives include bifunctional antibodies, such as bispecific antibodies generated by combining parts of two separate antibodies that recognize two different antigenic groups (e.g. by recombinant techniques or crosslinking).
[0167] The antibody derivatives may be formed from covalent modification of the antibodies described herein, for example, by reacting targeted amino acid residues of the antibody with an agent capable of reacting with selected side chains or terminal residues. For example, derivatisation with bifunctional agents is a useful means for cross-linking an antibody or fragment thereof to macromolecular carriers such as water-insoluble support matrices. Antibody derivatives as contemplated herein may have an agent attached to a base antibody or a fragment thereof capable of increasing its half-life in vivo (e.g. extending the length of time before clearance from the blood stream). A non-limiting example of such a technique includes addition of PEG moieties.
[0168] In certain embodiments, the antibody derivative may be a multimer, such as, for example, a dimer, comprising one or more monomers, where each monomer includes (i) an antigen-binding region of an anti-GPC-1 antibody as described herein, or a polypeptide region derived therefrom (such as, for example, by conservative substitution of one or more amino acid/s), and (ii) a multimerising (e.g. dimerising) polypeptide region, such that the antibody derivative forms multimers (e.g. homodimers) that specifically bind to GPC-1. For example, an antigen binding region of an anti-GPC-1 antibody as described herein, or a polypeptide region derived therefrom, may be recombinantly or chemically fused with a heterologous protein, wherein the heterologous protein comprises a dimerisation or multimerisation domain. The derivative may be subjected to conditions allowing formation of a homodimer or heterodimer. The heterodimer may comprise identical dimerisation domains but different anti-GPC-1 antigen-binding regions, identical anti-GPC-1 antigen-binding regions but different dimerisation domains, or different anti-GPC-1 antigen-binding regions and different dimerisation domains. Suitable dimerisation domains include those that originate from transcription factors (e.g. a basic region leucine zipper), a basic-region helix-loop-helix protein, and an immunoglobulin constant region (e.g. a heavy chain constant region or a domain thereof such as a CH1 domain, a CH2 domain, or a CH3 domain).
[0169] In other embodiments, the antibody derivative may be an anti-GPC1 antibody as described herein conjugated to a second antibody (an antibody heteroconjugate).
[0170] Also contemplated herein are humanised derivatives of the antibodies described herein. A humanised antibody as contemplated herein is a human/non-human chimeric antibody that contains a minimal sequence derived from non-human immunoglobulin. For example, a humanised antibody may be a human immunoglobulin (recipient antibody) in which residues from CDR region/s of the recipient are replaced by residues from a CDR region of a non-human species (donor antibody) (e.g. a mouse, rat, rabbit, or non-human primate having the desired specificity and affinity for a GPC-1 antigen/epitope). Framework region (FR) residues of the human immunoglobulin may also (optionally) be replaced by corresponding non-human residues, and in some cases humanised antibodies may comprise residues not present in the recipient antibody or in the donor antibody to enhance antibody performance.
[0171] Further contemplated herein are chimeric antibody derivatives in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences of an antibody described herein derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain/s is/are identical with or homologous to corresponding sequences in antibodies derived from another different species or belonging to another different antibody class or subclass. For example, a chimeric antibody as contemplated herein may comprise variable regions derived from an anti-GPC-1 monoclonal antibody as described herein, and constant regions derived from a second species. Chimeric antibodies may be generated, for example, by genetic engineering of immunoglobulin gene segments belonging to different species. The chimeric antibodies and antigen-binding fragments thereof may or may not be conjugated to a cytotoxic agent as described herein.
[0172] By way of non-limiting example only, a chimeric antibody according to the present invention may comprise a chimeric Mouse Human CH1-CH3 Chain Sequence Mouse VH-Human CH1-CH3 Chain (heavy chain) and/or a Mouse Human Kappa Chain Sequence Mouse VK-Human CK sequence MIL-38 Mouse VK (light chain). The heavy chain of the chimeric antibody may comprise or consist of an amino acid sequence as set out in residues 20-467 of SEQ ID NO: 7. The light chain of the chimeric antibody may comprise or consist of an amino acid sequence as set out in residues 21-234 of SEQ ID NO: 8. The heavy chain variable region may comprise: a complementarity determining region 1 (CDR1) comprising or consisting of an amino acid sequence defined by positions 50-54 of SEQ ID NO: 7; and/or a complementarity determining region 2 (CDR2) comprising or consisting of an amino acid sequence defined by positions 69-85 of SEQ ID NO: 7; and/or a complementarity determining region 3 (CDR3) comprising or consisting of an amino acid sequence defined by positions 118-126 of SEQ ID NO: 7. Additionally or alternatively, the light chain variable region may comprise: a complementarity determining region 1 (CDR1) comprising or consisting of an amino acid sequence defined by positions 44-54 of SEQ ID NO: 8; and/or a complementarity determining region 2 (CDR2) comprising or consisting of an amino acid sequence defined by positions 70-76 of SEQ ID NO: 8; and/or a complementarity determining region 3 (CDR3) comprising or consisting of an amino acid sequence defined by positions 109-117 of SEQ ID NO: 8. A chimeric antibody according to the present invention may be a variant of this chimeric antibody.
[0173] Included within the scope of the present invention are variants of the antibodies described herein. A variant antibody refers to an antibody which differs in amino acid sequence from a parent anti-GPC-1 antibody amino acid sequence by virtue of addition, deletion, and/or substitution of one or more amino acid residue/s in the parent antibody sequence. For example, the variant antibody may comprise one or more amino acid substitution/s in one or more CDR and/or framework region/s of the parent antibody (e.g. between 1 and 10, between 2 and 5, or 1, 2, 3, 4, or 5 substitutions in one or more heavy and/or light chain CDR and/or framework regions of the parent antibody). The antibody variant may comprise a heavy chain variable domain sequence and/or a light chain variable domain sequence amino acid sequence having at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 98% amino acid sequence homology (i.e. sequence identity) with the corresponding variable domain of the parent antibody.
[0174] Sequence homology or identity between two sequences is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the parent antibody residues, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. If the two sequences which are to be compared with each other differ in length, sequence identity relates to the percentage of amino acid residues of the shorter sequence which are identical with the amino acid residues of the longer sequence. Sequence identity can be determined conventionally with the use of computer programs such as the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive Madison, Wis. 53711) and/or the program fasta20u66 (version 2.0u66, September 1998 by William R. Pearson and the University of Virginia; see also W. R. Pearson (1990), Methods in Enzymology 183, 63-98).
[0175] In some embodiments, a variant antibody as described herein may differ from a parent antibody by way of conservative amino acid change/s in the sequence of the variable antibody. A conservative change refers to an alteration that is substantially antigenically or conformationally neutral, producing minimal changes in the tertiary structure of the variant antibody, or producing minimal changes in the antigenic determinants of the variant antibody, as compared to the parent antibody, and one which does not render the derivative incapable of binding to the same epitope in GPC-1 as the parent antibody. Non-limiting examples of conservative amino acid changes include substitution of hydrophobic amino acids and substitution of physicochemically similar amino acids. Persons of ordinary skill in the art can routinely and without difficulty assess whether a given amino acid substitution can be made while maintaining conformational and antigenic neutrality (see, for example, Berzofsky, (1985) Science 229:932-940; Bowie et al. (1990) Science 247:1306-1310). Alterations in protein conformation may be achieved using well-known assays including, but not limited to, microcomplement fixation methods (see Wasserman et al. (1961) J. Immunol. 87:290-295; Levine et al. (1967) Meth. Enzymol. 11:928-936) and through binding studies using conformation-dependent monoclonal antibodies (see Lewis et al. (1983) Biochem. 22:948-954). The conservative amino acid change/s may occur in one or more CDR and/or framework region/s of the parent antibody (e.g. between 1 and 10, between 2 and 5, or 1, 2, 3, 4, or 5 conservative substitutions in one or more CDR and/or framework regions of the parent antibody).
[0176] In general, humanised, chimeric, derivative, fragment and variant antibodies as contemplated herein are still capable of specifically binding to same antigen/epitope (e.g. GPC-1) as the parent antibody from which they derive or which they contain component/s of. Typically, they may retain at least 10% of the antigen/epitope binding capacity of the parent antibody, or, at least 25%, 50%, 60%, 70%, 80%, 90%, 95%, 99% or 100% (or more) of the antigen/epitope binding capacity of the parent antibody. For example, they may have a stronger binding affinity and/or binding specificity compared to the parent antibody.
[0177] The capacity of an antibody fragment, derivative, or variant to bind specifically to an antigen/epitope that is targeted by the parent antibody (i.e. a GPC-1 antigen/epitope) can be tested using known methods in the art including, for example, competitive and non-competitive assay systems using techniques such as Western blots, radioimmunoassays, enzyme linked immunosorbent assay (ELISA), immunoprecipitation assays, sandwich immunoassays, immunodiffusion assays, precipitin reactions, protein A immunoassays, fluorescent immunoassays, gel diffusion precipitin reactions, complement-fixation assays, immunoradiometric assays, agglutination assays, and the like (see, for example, Ausubel et al., eds., Short Protocols in Molecular Biology (John Wiley & Sons, Inc., New York, 4th ed. 1999); Harlow & Lane, Using Antibodies. A Laboratory Manual (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1999)).
[0178] Specifically included within the scope of the present invention are variants of any antibody or antigen binding fragment thereof described herein including, but not limited to, antibodies (including chimeric antibodies) and antigen binding fragments defined by specific sequences herein, and antibodies produced by hybridomas described herein including the hybridoma submitted under the terms of the Budapest Treaty at Cellbank Australia at 214 Hawkesbury Road, Westmead NSW 2145, Australia on 22 Aug. 2014 under accession number CBA20140026.
Cytotoxic Agents
[0179] Antibodies and antibody-binding fragments thereof according to the present invention may be conjugated to at least one cytotoxic agent. The cytotoxic agent may be any compound that is toxic to a cell (e.g. a prostate, bladder, and/or pancreatic cancer cell) such as, for example by, inhibiting cell function, and including but not limited to, causing cell death directly and/or indirectly.
[0180] Cytotoxic agents may cause direct toxicity to the prostate, bladder, and/or pancreatic cancer cell, or may induce apopotosis. Alternatively, in the case of a radiolabel, the radiation may cause DNA damage resulting in cell growth arrest, apoptosis induction or cell death.
[0181] Enhanced prostate, bladder, and/or pancreatic cancer death may result from immune recognition of proteins from dead or dying prostate, bladder, and/or pancreatic cancer cells thereby resulting in an immunisation effect.
[0182] Non-limiting examples of suitable cytotoxic agents include: afatinib, aplidin, anastrozole, anthracyclines, AVL-101, AVL-291, axitinib, azaribine, bendamustine, bleomycin, bortezomib, bosutinib, bryostatin-1, busulfan, camptothecans, carboplatin, calicheamycin, camptothecin, carboplatin, carmustine, celecoxib, chlorambucil, cisplatinum, cladribine, COX-2 inhibitors, crizotinib, cyano-morpholino doxorubicin, cyclophosphamide, cytarabine, dacarbazine, dactinomycin, dasatinib, daunorubicin, dinaciclib, 3,5-0-dioleoyl-FudR (FUdR-d0), DM1, DM3, DM4, docetaxel, doxorubicin, doxorubicin glucuronide, duocarmycin, endostatin, entinostat, epidophyllotoxin, epirubicin glucuronide, erlotinib, estramustine, estrogen receptor binding agents, etoposide glucuronide, etoposide phosphate, etoposide (VP16), exemestane, famesyl-protein transferase inhibitors, fingolimod, flavopiridol, floxuridine (FUdR), fludarabine, 5-fluorouracil, flutamide, fostamatinib, ganetespib, GDC-0834, gefitinib, gemcitabine, GS-1101, 10-hydroxycamptothecin, hydroxyurea, ibrutinib, idarubicin, idelalisib, ifosfamide, imatinib, irinotecan (CPT-11), lapatinib, lenolidamide, leucovorin, LFM-A13, lomustine, mechlorethamine, melphalan, mercaptopurine, 6-mercaptopurine, methotrexate, mithramycin, mitomycin, mitotane, mitoxantrone, monomethylauristatin D (MMAD), monomethylauristatin E (MMAE), monomethylauristatin F (MMAF), navelbine, neratinib, nilotinib, nitrosurea, olaparib, so paclitaxel, PCI-32765, pentostatin, plicomycin, a 2-PDox pro-drug (pro-2-PDox), procarbazine, PSI-341, 2-pyrrolinodoxorubicine (2-PDox), raloxifene, semustine, SN-38, sorafenib, streptozocin, SU1 1248, sunitinib, tamoxifen, temazolomide, teniposide, thalidomide, thioguanine, thiotepa, topotecan, transplatinum, uracil mustard, vatalanib, vinblastine, vinca alkaloids, vincristine, vinorelbine, and ZD 1839.
[0183] Additionally or alternatively, the cytotoxic agent may be a radioisotope. Non-limiting examples of suitable radioisotopes include: .sup.90Y, .sup.188Re, .sup.166Ho, .sup.165Dy, .sup.109Pd, .sup.111Ag, .sup.186Re, .sup.198Au, .sup.153Sm, .sup.64Cu, .sup.177Lu, .sup.131I, .sup.125I, .sup.67Cu, .sup.175Yb, .sup.166Dy, .sup.169Er, .sup.212Bi, .sup.213Bi, .sup.225Ac, .sup.212Pb, .sup.66Ga, .sup.67Ga, .sup.68Ga, .sup.86Y, .sup.94mTc, and .sup.89Zr.
[0184] In some embodiments, the antibody or antigen-binding fragment thereof is conjugated to the cytotoxic agent or agent(s) directly.
[0185] In other embodiments the antibody or antigen-binding fragment thereof is conjugated to the cytotoxic agent or agent(s) indirectly (e.g. via a chelating agent selected from the group consisting of: DOTA, DTPA, NOTA, NODAGA, MeCOSAR, TETA, TRAP, TF2A, CBTE2A).
Conjugated Antibody Production
[0186] Processes for the preparation of the monoclonal antibodies, derivatives and variants thereof, and antigen binding fragments thereof are readily available and capable of being performed without difficulty by persons of ordinary skill in the art.
[0187] Apart from the hybridoma method of Kohler et al. (1975) and described above in the section entitled Hybridomas, another non-limiting process that may be utilised is recombinant DNA technology (see, for example, U.S. Pat. No. 4,816,567). For example, the monoclonal antibodies, derivatives and variants thereof, and antigen binding fragments thereof, may be recombinantly produced in any well-established expression system including, but not limited to, baculovirus, yeast (e.g. Pichia sp., Saccharomyces sp.) E. coli, mammalian cells, plants, or transgenic animals (see Breitling and Dubel, 1999, Recombinant Antibodies, John Wiley & Sons, Inc., NY, pp. 119-132).
[0188] In some embodiments, nucleic acid sequences encoding monoclonal antibodies, derivatives and variants thereof, and antigen binding fragments thereof in accordance with the present invention may be used in production processes based on recombinant DNA technologies. Non-limiting examples include a heavy chain polynucleotide sequence as defined in SEQ ID NO: 1 or a variant or fragment thereof, and/or a light chain polynucleotide sequence as defined in SEQ ID NO: 2 or a variant or fragment thereof.
[0189] A variant polynucleotide refers herein to a polynucleotide which differs in sequence from a parent or reference polynucleotide. Polynucleotide sequence divergence may result from mutational changes such as deletions, substitutions, or additions of one or more nucleotides. Each of these changes may occur alone or in combination, one or more times in a given sequence. A variant polynucleotide refers to a polynucleotide that has a substantially similar sequence to a parent or reference polynucleotide. In general, two sequences are substantially similar if the two sequences have a specified percentage of nucleotides that are the same (percentage of sequence homology or sequence identity). Sequence homology or identity between two polynucleotide sequences is defined herein as the percentage of nucleotides in the candidate (variant) sequence that are identical with those of the parent/reference polynucleotide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity. If the two sequences which are to be compared with each other differ in length, sequence identity relates to the percentage of the nucleotides of the shorter sequence which are identical with the nucleotides of the longer sequence. Sequence identity can be determined conventionally with the use of computer programs such as the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive Madison, Wis. 53711) and/or the program fasta20u66 (version 2.0u66, September 1998 by William R. Pearson and the University of Virginia; see also W. R. Pearson (1990), Methods in Enzymology 183, 63-98). The degree of sequence homology/identity between the variant polynucleotide and the reference/parent polynucleotide may, for example, be at least 75%, 80%, 83% 85%, 88%, 90%, 93%, 95%, 96%, 97%, 98% or 99%.
[0190] A polynucleotide fragment is a polynucleotide molecule that encodes a constituent or is a constituent of a large parent/reference polynucleotide. In general, the fragment will encode a fragment of an antibody of the present invention, the fragment being capable of specifically binding to GPC-1.
[0191] Monoclonal antibodies, derivatives and variants thereof, and antigen binding fragments thereof produced in accordance with the present invention may be isolated from various sources using appropriate methods including, but not limited to, immunoglobulin-binding molecules (for example, proteins A, L, G or H), tags operatively linked to the antibody or antibody fragment (for example, His-tag, c-myc tag), affinity chromatography, and the like.
[0192] Monoclonal antibodies, derivatives and variants thereof, and antigen binding fragments thereof as described herein may be produced by hybridomas and/or cell cultures comprising single or mixed populations of hybridomas including, for example, those described in the section above entitled Hybridomas, then isolated using known techniques. In some embodiments, the monoclonal antibodies can be produced by culturing a single (monoclonal) species of hybridoma cells deposited under the terms of the Budapest Treaty at Cellbank Australia under accession number CBA20140026, and isolated from the culture.
[0193] Processes for the preparation and cultivation of the hybridoma cell lines and isolation of the antibody produced are well known to those of ordinary skill in the art and are standard procedures.
[0194] Antibodies and antibody-binding fragments thereof according to the present invention may be conjugated to at least one cytotoxic agent. Methods for conjugating cytotoxic agents to antibodies and antigen binding fragments thereof are well known to those skilled in the art (see, for example, Zhang et al. PLOS One December 2011, Volume 6 Issue 12).
Medicaments and Pharmaceutical Formulations
[0195] Medicaments and pharmaceutical formulations according to the present invention comprise antibodies and antibody-binding fragments thereof, which may be conjugated to at least one cytotoxic agent, as described herein, or alternatively be provided without such agent(s) (i.e. naked). The medicaments and pharmaceutical formulations may be prepared using methods known to those of ordinary skill in the art. Non-limiting examples of suitable methods are described in Gennaro et al. (Eds), (1990), Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa., USA.
[0196] The medicaments and pharmaceutical formulations may comprise a pharmaceutically acceptable carrier, excipient, diluent and/or adjuvant. Pharmaceutically acceptable carriers, excipients, diluents and/or adjuvants as contemplated herein are substances which do not produce adverse reaction(s) when administered to a particular recipient such as a human or non-human animal. Pharmaceutically acceptable carriers, excipients, diluents and adjuvants are generally also compatible with other ingredients of the medicaments and pharmaceutical formulations. Non-limiting examples of suitable excipients, diluents, and carriers can be found in the Handbook of Pharmaceutical Excipients 4th Edition, (2003) Rowe et al. (Eds), The Pharmaceutical Press, London, American Pharmaceutical Association, Washington.
[0197] Non-limiting examples of pharmaceutically acceptable carriers, excipients or diluents include demineralised or distilled water; saline solution; vegetable based oils such as peanut oil, safflower oil, olive oil, cottonseed oil, maize oil, sesame oils, arachis oil or coconut oil; silicone oils, including polysiloxanes, such as methyl polysiloxane, phenyl polysiloxane and methylphenyl polysolpoxane; volatile silicones; mineral oils such as liquid paraffin, soft paraffin or squalane; cellulose derivatives such as methyl cellulose, ethyl cellulose, carboxymethylcellulose, sodium carboxymethylcellulose or hydroxypropylmethylcellulose; lower alkanols, for example ethanol or isopropanol; lower aralkanols; lower polyalkylene glycols or lower alkylene glycols, for example polyethylene glycol, polypropylene glycol, ethylene glycol, propylene glycol, 1,3-butylene glycol or glycerin; fatty acid esters such as isopropyl palmitate, isopropyl myristate or ethyl oleate; polyvinylpyrridone; agar; carrageenan; gum tragacanth or gum acacia, and petroleum jelly. Typically, the carrier or carriers will form from 10% to 99.9% by weight of the compositions.
[0198] Medicaments and pharmaceutical formulations of the present invention may be in a form suitable for administration by injection, in the form of a formulation suitable for oral ingestion (such as capsules, tablets, caplets, elixirs, for example), in the form of an ointment, cream or lotion suitable for topical administration, in a form suitable for delivery as an eye drop, in an aerosol form suitable for administration by inhalation, such as by intranasal inhalation or oral inhalation, or in a form suitable for parenteral administration, that is, intradermal, subcutaneous, intramuscular or intravenous injection.
[0199] Solid forms of the medicaments and pharmaceutical formulations for oral administration may contain binders acceptable in human and veterinary pharmaceutical practice, sweeteners, disintegrating agents, diluents, flavourings, coating agents, preservatives, lubricants and/or time delay agents. Suitable binders include gum acacia, gelatine, corn starch, gum tragacanth, sodium alginate, carboxymethylcellulose or polyethylene glycol. Suitable sweeteners include sucrose, lactose, glucose, aspartame or saccharine. Suitable disintegrating agents include corn starch, methylcellulose, polyvinylpyrrolidone, guar gum, xanthan gum, bentonite, alginic acid or agar. Suitable diluents include lactose, sorbitol, mannitol, dextrose, kaolin, cellulose, calcium carbonate, calcium silicate or dicalcium phosphate. Suitable flavouring agents include peppermint oil, oil of wintergreen, cherry, orange or raspberry flavouring. Suitable coating agents include polymers or copolymers of acrylic acid and/or methacrylic acid and/or their esters, waxes, fatty alcohols, zein, shellac or gluten. Suitable preservatives include sodium benzoate, vitamin E, alpha-tocopherol, ascorbic acid, methyl paraben, propyl paraben or sodium bisulphite. Suitable lubricants include magnesium stearate, stearic acid, sodium oleate, sodium chloride or talc. Suitable time delay agents include glyceryl monostearate or glyceryl distearate.
[0200] Liquid forms of the medicaments and pharmaceutical formulations for oral administration may contain, in addition to the above agents, a liquid carrier. Suitable liquid carriers include water, oils such as olive oil, peanut oil, sesame oil, sunflower oil, safflower oil, arachis oil, coconut oil, liquid paraffin, ethylene glycol, propylene glycol, polyethylene glycol, ethanol, propanol, isopropanol, glycerol, fatty alcohols, triglycerides or mixtures thereof.
[0201] Suspensions for oral administration may further comprise dispersing agents and/or suspending agents. Suitable suspending agents include sodium carboxymethylcellulose, methylcellulose, hydroxypropylmethyl-cellulose, poly-vinyl-pyrrolidone, sodium alginate or acetyl alcohol. Suitable dispersing agents include lecithin, polyoxyethylene esters of fatty acids such as stearic acid, polyoxyethylene sorbitol mono- or di-oleate, -stearate or -laurate, polyoxyethylene sorbitan mono- or di-oleate, -stearate or -laurate and the like.
[0202] For preparation of the medicaments and pharmaceutical formulations as injectable solutions or suspensions, non-toxic parenterally acceptable diluents or carriers may be used such as Ringer's solution, isotonic saline, phosphate buffered saline, ethanol and 1,2 propylene glycol.
[0203] Emulsions for oral administration may further comprise one or more emulsifying agents. Suitable emulsifying agents include dispersing agents as exemplified above or natural gums such as guar gum, gum acacia or gum tragacanth.
[0204] Topical formulations comprise an active ingredient(s) (e.g. i.e. antibodies and/or antigen-binding fragments thereof of the present invention) together with one or more acceptable carriers, and optionally any other therapeutic ingredients. Formulations suitable for topical administration include liquid or semi-liquid preparations suitable for penetration through the skin to the site of where treatment is required, such as liniments, lotions, creams, ointments or pastes, and drops suitable for administration to the eye, ear or nose.
[0205] When formulated as drops, the medicaments and pharmaceutical formulations may comprise sterile aqueous or oily solutions or suspensions. These may be prepared by dissolving the active ingredient in an aqueous solution of a bactericidal and/or fungicidal agent and/or any other suitable preservative, and optionally including a surface active agent. The resulting solution may then be clarified by filtration, transferred to a suitable container and sterilised. For example, sterilisation may be achieved by filtration followed by transfer to a container by an aseptic technique. Examples of bactericidal and fungicidal agents suitable for inclusion in the drops are phenylmercuric nitrate or acetate (0.002%), benzalkonium chloride (0.01%) and chlorhexidine acetate (0.01%). Suitable solvents for the preparation of an oily solution include glycerol, diluted alcohol and propylene glycol.
[0206] When formulated as creams, ointments or pastes, the medicaments and pharmaceutical formulations may be semi-solid formulations of the active ingredient for external application. They may be made by mixing the active ingredient in finely-divided or powdered form, alone or in solution or suspension in an aqueous or non-aqueous fluid, with a greasy or non-greasy basis. The basis may comprise hydrocarbons such as hard, soft or liquid paraffin, glycerol, beeswax, a metallic soap; a mucilage; an oil of natural origin such as almond, corn, arachis, castor or olive oil; wool fat or its derivatives, or a fatty acid such as stearic or oleic acid together with an alcohol such as propylene glycol or macrogols.
[0207] The medicaments and pharmaceutical formulations may include any suitable surfactant such as an anionic, cationic or non-ionic surfactant such as sorbitan esters or polyoxyethylene derivatives thereof. Suspending agents such as natural gums, cellulose derivatives or inorganic materials such as siliceous silicas, and other ingredients such as lanolin, may also be included.
Methods for Treating Prostate, Bladder, and/or Pancreatic Cancer
[0208] According to the present invention, antibodies and antibody-binding fragments thereof, which may be naked or conjugated to at least one cytotoxic agent, are suitable for the treatment of prostate, bladder, and/or pancreatic cancer. The antibodies and/or fragments thereof may be administered as components of pharmaceutical formulations or medicaments as are described herein.
[0209] The identification of subjects with or at risk of developing prostate, bladder, and/or pancreatic cancer is well known to those of ordinary skill in the art. For example, in the case of prostate cancer suitable methodologies include, but are not limited to, digital rectal exam, PSA-based assays, and prostate biopsy.
[0210] One of the distinguishing factors between benign prostate tumors (non cancerous) and malignant prostate tumors (cancerous) is the ability of the cancerous form to metastasise. Metastasis is the capacity for cancerous cells to spread (metastasise) to other parts of the body. Prostate cancer in patients is further categorised into stages according to the TNM Classification of Malignant Tumours (TN M), which categorises cancer based on the size and extent of the primary tumor (T), the spread of the cancer to nearby lymph nodes (N), and the presence of secondary tumor formed by the metastasis (M) of the primary tumor to other parts of the body (American Cancer Society). Table 2 shows example definitions for each cancer stage.
TABLE-US-00002 TABLE 2 Definitions for cancer stages of the TNM system, adapted from the American Cancer Society. Stage Definition Stage 0 Carcinoma in situ Stage I, Stage II, and Higher numbers indicate more extensive disease: Stage III Larger tumor size and/or spread of the cancer beyond the organ in which it first developed to nearby lymph nodes and/or tissues or organs adjacent to the location of the primary tumor Stage IV The cancer has spread to distant tissues or organs
[0211] The methods may be used for treating prostate, bladder, and/or pancreatic cancer in a subject. Non-limiting examples of prostate cancers that may be treated with the present invention include prostatic intraepithelial neoplasia, adenocarcinoma, leiomyosarcoma, and rhabdomyosarcoma. Non-limiting examples of bladder and/or pancreatic cancer that may be treated with the present invention include T categories for bladder cancer, N categories, and M categories, as defined in the American Joint Committee on Cancer (AJCC) TNM system, muscle invasive bladder cancer, and non-muscle invasive bladder cancer.
[0212] It will be under stood that treating within the context of the methods described herein refers to the alleviation, in whole or in part, of symptoms associated with prostate, bladder, and/or pancreatic cancer, or slowing, inhibiting or halting of further progression or worsening of those symptoms, or the prevention of prostate, bladder, and/or pancreatic cancer. Accordingly, treating prostate, bladder, and/or pancreatic cancer may include, for example, inhibiting or preventing the metastasis of the cancer, a reduction in the speed and/or number of the metastasis, a reduction in tumour volume of the metastasised prostate, bladder, and/or pancreatic cancer, a complete or partial remission of the metastasised prostate, bladder, and/or pancreatic cancer, or other therapeutic benefit(s).
[0213] The subject may be any animal that can benefit from the administration of the antibodies and/or antibody-binding fragments thereof. In some embodiments, the subject is a mammal, for example, a human, a dog, a cat, a horse, a cow, a pig, a primate, or a rodent (e.g. a rat or mouse).
[0214] The methods may involve the administration of a therapeutically effective amount of antibodies and antibody-binding fragments thereof according to the invention. A therapeutically effective amount will be understood to refer to an amount of the antibodies and/or fragments that alleviates, in whole or in part, symptoms associated with prostate, bladder, and/or pancreatic cancer, or slows, inhibits or halts further progression or worsening of those symptoms, or prevents or provides prophylaxis for prostate, bladder, and/or pancreatic cancer in a subject at risk for developing prostate cancer.
[0215] The therapeutically effective amount may vary depending upon the route of administration and dosage form. Effective amounts of conjugated antibodies and/or fragments thereof according to the present invention typically fall in the range of about 0.001 up to 100 mg/kg/day, for example in the range of about 0.05 up to 10 mg/kg/day. Typically, the antibodies and/or fragments are selected to provide a formulation that exhibits a high therapeutic index. The therapeutic index is the dose ratio between toxic and therapeutic effects which can be expressed as the ratio between LD.sub.50 and ED.sub.50. The LD.sub.50 is the dose lethal to 50% of the population and the ED.sub.50 is the dose therapeutically effective in 50% of the population. The LD.sub.50 and ED.sub.50 are determined by standard pharmaceutical procedures in animal cell cultures or experimental animals.
[0216] Generally, an effective dosage of conjugated antibodies and/or fragments thereof according to the present invention is expected to be in the range of about 0.0001 mg to about 1000 mg of active component(s) (i.e. of conjugated antibodies and/or fragments thereof according to the present invention) per kg body weight per 24 hours; typically, about 0.001 mg to about 750 mg per kg body weight per 24 hours; about 0.01 mg to about 500 mg per kg body weight per 24 hours; about 0.1 mg to about 500 mg per kg body weight per 24 hours; about 0.1 mg to about 250 mg per kg body weight per 24 hours; about 1.0 mg to about 250 mg per kg body weight per 24 hours. More typically, an effective dose range is expected to be in the range about 1.0 mg to about 200 mg per kg body weight per 24 hours; about 1.0 mg to about 100 mg per kg body weight per 24 hours; about 1.0 mg to about 50 mg per kg body weight per 24 hours; about 1.0 mg to about 25 mg per kg body weight per 24 hours; about 5.0 mg to about 50 mg per kg body weight per 24 hours; about 5.0 mg to about 20 mg per kg body weight per 24 hours; about 5.0 mg to about 15 mg per kg body weight per 24 hours.
[0217] Alternatively, an effective dosage may be up to about 500 mg/m.sup.2 of active component(s) (i.e. of conjugated antibodies and/or fragments thereof according to the present invention). Generally, an effective dosage is expected to be in the range of about 25 to about 500 mg/m.sup.2, preferably about 25 to about 350 mg/m.sup.2, more preferably about 25 to about 300 mg/m.sup.2, still more preferably about 25 to about 250 mg/m.sup.2, even more preferably about 50 to about 250 mg/m.sup.2, and still even more preferably about 75 to about 150 mg/m.sup.2.
[0218] Typically, in therapeutic applications, the treatment would be for the duration of prostate, bladder, and/or pancreatic cancer disease in the subject. Further, it will be apparent to one of ordinary skill in the art that the optimal quantity and spacing of individual dosages will be determined by the nature and extent of the prostate, bladder, and/or pancreatic cancer being treated, the form, route and site of administration, and the nature of the particular individual being treated. Also, such optimum conditions can be determined by conventional techniques.
[0219] In many instances, it will be desirable to have several or multiple administrations of conjugated antibodies and/or fragments thereof according to the present invention. For example, a given dosage may be administered 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more times. The administrations may be from about one to about twelve week intervals, and in certain embodiments from about one to about four week intervals. Periodic re-administration may be desirable in the case or risk of recurrent occurrence of prostate, bladder, and/or pancreatic cancer in a given subject.
[0220] It will also be apparent to one of ordinary skill in the art that the optimal course of treatment can be ascertained using conventional course of treatment determination tests.
[0221] The conjugated antibodies and/or fragments thereof according to the present invention can be formulated for various routes of administration, for example, by oral, parenteral (e.g. intradermal, intravenous, intraspinal, intraperitoneal, subcutaneous or intramuscular), nasal, rectal, topical, or by way of an implanted reservoir. Systemic or parenteral administration includes, but is not limited to, intraperitoneal, intramuscular, subcutaneous, and intravenous injections. In one embodiment, they are administered by a mucosal route. Non-limiting examples of acceptable routes of mucosal administration including intranasal, ocular, buccal, genital tract, rectal, intratracheal, skin, and the gastrointestinal tract.
[0222] In some embodiments, the treatment methods described herein antibodies and/or fragments thereof may be administered in combination with other agents or therapies. The antibodies and/or fragments thereof may be components of pharmaceutical formulations or medicaments as are described herein. Non-limiting examples of the additional agents or therapies include hormonal agents, LHRH agonists and antagnoists, CYP17 inhibitors, taxane therapy, radioisotope treatment, immunomodulatory therapy. Examples include docetaxel, mitoxantrone, abiraterone acetate, enzalutamide, ketoconazole, corticosteroids, Sipuleucel-T, cabazitaxel, .sup.223radium, gemcitabine and Bacille Camlette Guerin (BCG) immunotherapy. Additional radiation therapies also used include external beam radiation and brachytherapy. The antibodies and/or fragments thereof may be administered to the subject simultaneously with the additional agents or therapies. Additionally or alternatively, the antibodies and/or fragments may be administered to the subject before or after the additional agents or therapies are administered.
EXAMPLES
[0223] The present invention will now be described with reference to specific examples, which should not be construed as in any way limiting.
Example 1: Analysis of Antibodies from MIL-38 Hybridoma Populations
1.1 Materials and Methods
[0224] MIL-38 Antibody Preparation
[0225] Preparations MIL-38 antibody hybridoma were obtained from the following sources:
[0226] (i) In house cell stocks of the BLCA-38 hybridoma were used to generate MIL-38 antibody preparations designated 33A.
[0227] (ii) An early passage (<6) freezedown of cells from the original deposit of the BLCA-38 hybridoma (HB11785) was used to perform single cell cloning and provide a number of clones to characterize. The MIL-38 1F5 clone was selected and deposited at CellBank Australia under deposit number CBA20140026.
[0228] (iii) The hybridoma stock used as a basis to generate the preparations described in (i) and (ii) above was prepared as described in U.S. Pat. No. 5,622,8361 to Walker et al., the entire contents of which are incorporated herein by cross-reference.
[0229] For purification of MIL-38 antibody, frozen cell stocks were quickly thawed followed by resuspension in RPMI 1640 medium and allowed to grow at 37 C. with 5% CO.sub.2 for 24 hours. Cells were expanded, split and scaled up in a sequential process. At each step, cells were resuspended in fresh medium and incubated at 37 C. with 5% CO.sub.2. After scale up, cells were transferred to sterile serum free medium and grown till the start of death phase. The supernatant was harvested to collect the MIL-38 antibody and filter sterilised. Antibody supernatant was stored at 80 C. until required. Antibody was purified using Pierce protein G according to the manufacturer's recommendations.
[0230] Western Blot and Sypro Gel Analysis
[0231] Protein extraction: DU-145 (MIL-38 antigen positive) or C3 (MIL-38 antigen negative) cells were cultured according to standard tissue culture techniques. Cell membrane proteins were enriched using the Merck Millipore ProteoExtract Native Membrane Protein Extraction Kit (MPEK) according to the manufacturer's instructions.
[0232] Transfer
[0233] Gels were transferred onto a nitrocellulose membrane for 10 min at 2.5 A and 25V maximum using the Transblot Turbo system (Biorad).
[0234] Western Blot
[0235] Briefly, after transfer membranes were blocked with 5% skim milk in PBS-Tween (0.1%) for 2 h at room temperature. Primary antibodies (1 g/ml in 5% skim milkPBS-Tween (0.1%) were applied and incubated overnight at 4 C. After washing (310 min PBS-Tween (0.1%)) membranes were incubated with secondary antibody (1:2000 sheep-anti-mouse HRP-labelled in 5% skim milkPBS-Tween (0.1%)). After washing (310 min PBS-Tween (0.1%)) antigen was detected by using ECL detection kit (Biorad) and imaging with LAS4000 mini (GE Life Science).
[0236] Sypro Gels
[0237] Gels were fixed in fixing solution (10% Ethanol, 7% acetic acid) for 2 h before being transferred into Sypro Ruby Protein Stain and incubated overnight at room temperature in the dark. Before imaging gels were rinsed and washed with destaining solution (10% Ethanol, 7% acetic acid) for a minimum of 2 h. Imaging was performed with a Pharos X Scanner.
[0238] Immunofluorescence assay (IFA)
[0239] IFA: Cells were grown on coverslips until 75% confluent and placed in 6 well plates. The cells were washed with PBS followed by fixing with acetone. Cells were washed again with PBS followed by incubation with TBS then blocked with PBS containing 5% skim milk. Cells were then incubated in the dark with MIL-38, chimeric MIL-38 or Cetuximab followed by incubation with a Goat anti-mouse or Goat anti-human antibody labelled with FITC or Alexa488. Both antibodies were prepared in PBS containing 1% skim milk followed. Washing with PBS was performed between the primary and secondary antibody incubations. After secondary incubation, cells were washed with PBS containing DAPI and visualised for green fluorescence (MIL-38 positive).
[0240] SDS-PAGE Electrophoresis
[0241] SDS-PAGE: Samples were mixed with non-reducing SDS-containing sample buffer and loaded onto a 4-15% precast polyacrylamide gel (Criterion TGX; Biorad). Gels were run for 10 min at 80V and additional 50 min at 200V in Tris-Glycine running buffer.
[0242] Sequencing (DNA)
[0243] Previous results indicated that the BLCA-38 cells deposited at ATCC accession number HB11785 contained two populations of cells. Subcloning identified two types of clones: AM3/Alfio II type (did not bind GPC-1) or AM4/Alfio 1 (bound GPC-1 strongly). The two populations were sequenced together with a low passage stock obtained from ATCC (termed 1-0 or original).
[0244] For sequencing runs 224945 (1-O) and 449295-1 (Alfio I), total RNA was extracted from frozen hybridoma cells and cDNA was synthesized from the RNA. PCR was then performed to amplify the variable regions (heavy and light chains) and constant regions of the antibody, which were then cloned into a standard cloning vector separately and sequenced. Total RNA was isolated from the hybridoma cells following the technical manual of TRizol Plus RNA Purification System. The total RNA was analysed by agarose gel electrophoresis. Total RNA was reverse transcribed into cDNA using isotype-specific anti-sense primers or universal primers following the technical manual of SuperScript III First-Strand Synthesis System. The antibody fragments of VH, VL, CH and CL were amplified according to the standard operating procedure of RACE of GenScript. Amplified antibody fragments were separately cloned into a standard cloning vector using standard molecular cloning procedures. Colony PCR screening was performed to identify clones with inserts of correct sizes. No less than five single colonies with inserts of correct sizes were sequenced for each antibody fragment. VH and VL plasmids encoded the full-length variable regions of the antibody and a part of CH1 and CL. CH plasmid encoded a part of CH1 and full-length CH2 and CH3. CL plasmid encoded a part of CL. In order to get full-length constant regions or heavy/light chain, the part of constant regions encoded by VH and VL plasmids and the part of constant regions encoded by CH and CL plasmids were amplified by PCR separately, and then overlap extension PCR was employed to obtain full-length DNAs. Five single colonies with correct VH, VL, CH and CL insert sizes were sent for sequencing. The isolated total RNA of the sample was run alongside a DNA marker (Marker IIITIANGEN, Cat. No.: MD103) on a 1.5% agarose/GelRed gel. Four microliters of PCR products of each sample were run alongside the DNA marker (Marker 111) on a 1.5% agarose/GelRed gel. The PCR products were purified and stored at 20 C. until further use.
[0245] The V.sub.H, V.sub.L, C.sub.H and C.sub.L genes of five different clones were nearly identical. The consensus sequence, listed below, was determined to be the sequence of the antibody produced by the monoclonal hybridoma population (AM-4).
TABLE-US-00003 MIL-38MouseIgG1HeavyChainDNAConsensusSequence (SEQIDNO:1) ATGGCTTGGGTGTGGACCTTGCTATTCCTGATGGCTGCTGCCCAAAGTATCCAAGCA CAGATCCAGTTGGTGCAGTCTGGACCTGAGCTGAAGAAGCCTGGAGAGACAGT CAAGATCTCCTGCAAGGCTTCTGGTTATGCCTTCACAGACTATTCAATGAACTGGG TGAAGCAGGCTCCAGGAAAGGGTTTAAGGTGGATGGGCTGGATAAACACTGAGA CTGGTGAGCCAACATATACAGATGACTTCAAGGGACGGTTTGCCTTCTCTTTGGAAA CCTCTGCCAGCACTGCCTTTTTGCAGATCAACAACCTCAGAAATGAAGACACGG CTACATATTTCTGTGCTAGACACTATGATTACGGGGGGTTTCCTTACTGGGGCCAA GGGACTCTGGTCACTGTCTCTGCAGCCAAAACGACACCCCCATCTGTCTATCCACT GGCCCCTGGATCTGCTGCCCAAACTAACTCCATGGTGACCCTGGGATGCCTGGTCAA GGGCTATTTCCCTGAGCCAGTGACAGTGACCTGGAACTCTGGATCCCTGTCCAGCGG TGTGCACACCTTCCCAGCTGTCCTGCAGTCTGACCTCTACACTCTGAGCAGCTCAGTG ACTGTCCCCTCCAGCACCTGGCCCAGCGAGACCGTCACCTGCAACGTTGCCCACCC GGCCAGCAGCACCAAGGTGGACAAGAAAATT
GTCCCAGAAGTATCATCTGTCTTCATCTTCCCCCCAAAGCCCAA GGATGTGCTCACCATTACTCTGACTCCTAAGGTCACGTGTGTTGTGGTAGACATCAGC AAGGATGATCCCGAGGTCCAGTTCAGCTGGTTTGTAGATGATGTGGAGGTGCACACA GCTCAGACGCAACCCCGGGAGGAGCAGTTCAACAGCACTTTCCGCTCAGTCAGTGAA CTTCCCATCATGCACCAGGACTGGCTCAATGGCAAGGAGTTCAAATGCAGGGTCAAC AGTGCAGCTTTCCCTGCCCCCATCGAGAAAACCATCTCCAAAACCAAAGGCAGACCG AAGGCTCCACAGGTGTACACCATTCCACCTCCCAAGGAGCAGATGGCCAAGGATAAA GTCAGTCTGACCTGCATGATAACAGACTTCTTCCCTGAAGACATTACTGTGGAGTGGC AGTGGAATGGGCAGCCAGCGGAGAACTACAAGAACACTCAGCCCATCATGGACACAG ATGGCTCTTACTTCGTCTACAGCAAGCTCAATGTGCAGAAGAGCAACTGGGAGGCAG GAAATACTTTCACCTGCTCTGTGTTACATGAGGGCCTGCACAACCACCATACTGAGAA GAGCCTCTCCCACTCTCCTGGTAAATGA Individualregionsofmouseheavychainencodedsequenceareindicatedwithalternating italics.Positions1-57= leadersequence,58-147= frameworkregion(HFR1);148-162= complementarydeterminingregion(HCDR1);163-204= HFR2;205-255= HCDR2;256- 351= HFR3;352-378= HCDR3;379-411= HFR4;412-1383= constantregions(CH1- CH3);703-741= hingeregion(bolded);1384-1386= stopcodon. MIL-38MouseKappaLightChainDNAConsensusSequence (SEQIDNO:2) ATGAGTGTGCTCACTCAGGTCCTGGCGTTGCTGCTGCTGTGGCTTACAGGTGCCAGA TGTGACATCCAGATGACTCAGTCTCCAGCCTCCCTATCTGCATCTGTGGGAGAAA CTGTCACCATCACATGTCGAGCAAGTGGGAATGTTCACAATTATTTAGCATGGTATC AGCAGAAACAGGGAAAATCTCCTCAACTCCTGGTCTATACTGCAAAAACCTTAGC AGATGGTGTGCCATCAAGGTTCAGTGGCAGTGGATCAGGAACACAATATTCTCTC AAGATCAATAGCCTGCAGCCTGAAGATTTTGGGACTTATTACTGTCAACATTTTTG GAGTAATCCGTGGACGTTCGGTGGAGGCACCAAGCTGGAAATCAAACGGGCTGAT GCTGCACCAACTGTATCCATCTTCCCACCATCCAGTGAGCAGTTAACATCTGGAGGTG CCTCAGTCGTGTGCTTCTTGAACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAA GATTGATGGCAGTGAACGACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAG CAAAGACAGCACCTACAGCATGAGCAGCACCCTCACGTTGACCAAGGACGAGTATGA ACGACATAACAGCTATACCTGTGAGGCCACTCACAAGACATCAACTTCACCCATTGTC AAGAGCTTCAACAGGAATGAGTGTTAG Individualregionsofmouselightchainencodedsequencearewithalternatingitalics. Positions:1-60= leadersequence;61-129= frameworkregion(LFR1);130-162= complementaritydeterminingregion(LCDR1);163-207= LFR2;208-228= LCDR2;229- 324= LFR3;325-351= LCDR3;352-381LFR4;382-702= constantregions(CK);703- 705= stopcodon.
[0246] The heavy and light chain AM-4 MIL-38 consensus DNA sequences above translate to the following heavy chain and light chain amino acid sequences:
TABLE-US-00004 AM-4MIL-38MouseIgG1HeavyChainAmino AcidConsensusSequence (SEQIDNO:3) MAWVWTLLFLMAAAQSIQAQIQLVQSGPELKKPGETVKISCKASGYAF TDYSMNWVKQAPGKGLRWMGWINTETGEPTYTDDFKGRFAFSLETSAS TAFLQINNLRNEDTATYFCARHYDYGGFPYWGQGTLVTVSAAKTTPPS VYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPA VLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI VPEVSSVFIFPPKPKDVLTITLTPKVTCVV VDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMHQ DWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMA KDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVY SKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGK]* IndividualregionsofmouseIgG1heavychain sequenceareindicatedintheaminoacid sequenceabove.Positions1-19= leader sequence;20-49= frameworkregion(HFR1);50- 54= complementaritydeterminingregion1 (HCDR1);55-68= HFR2;69-85= HCDR2;86-117= HFR3;118-126= HCDR3;127-137= HFR4(also calledthejoiningregionorJ-region);138- 61= IgG1chainconstantregions(CH1-CH3)& stopcodon(*).Hingeregionisboldedinthe sequenceabove. AM-4consensusMIL-38LightChainAminoAcid ConsensusSequence (SEQIDNO:4) MSVLTQVLALLLLWLTGARCDIQMTQSPASLSASVGETVTITCRASGN VHNYLAWYQQKQGKSPQLLVYTAKTLADGVPSRFSGSGSGTQYSLKIN SLQPEDFGTYYCQHFWSNPWTFGGGTKLEIKRADAAPTVSIFPPSSEQ LTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST YSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC* Individualregionsoflightchainaminoacid sequenceareindicatedbyalternatingitalics: Positions1-20= Leadersequence;21-43= frame- workregion(LFR1);44-54= complementarity determiningregion1(LCDR1);55-69= LFR2; 70-76= LCDR2;77-108= LFR3;109-117= LCDR3; 118-127= LFR4;128-234= kappaconstantregion (CK)&stopcodon(*)
Example 2: Preparation and Testing of Chimeric MIL-38 Antibodies
2.1 Materials and Methods
[0247] Preparation of Chimeric Antibodies
[0248] Two optimised cDNA sequences were developed for cloning purposes. These were based on the AM-4 Heavy chain and Light chain consensus sequences identified above in Example 1.
[0249] The first optimised cDNA sequence was used in the generation of a mouse-human chimeric heavy chain sequence:
TABLE-US-00005 CHOcodonOptimizedcDNASequence#1-mouse- humanchimericheavychain1404bp (SEQIDNO:5) ATGGCTTGGGTGTGGACACTGCTGTTCCTGATGGCTGCTGCCCAGAGT ATTCAGGCTCAGATTCAGCTGGTCCAGAGCGGTCCCGAGCTGAAGAAG CCAGGCGAGACCGTGAAGATCTCCTGCAAGGCCAGCGGCTACGCTTTC ACAGACTATTCTATGAACTGGGTGAAGCAGGCCCCAGGCAAGGGCCTG AGGTGGATGGGCTGGATCAATACCGAGACAGGCGAGCCCACCTACACA GACGATTTCAAGGGCCGGTTCGCTTTTTCCCTGGAGACCTCTGCCTCC ACAGCTTTTCTGCAGATCAACAATCTGAGAAACGAGGACACCGCCACA TACTTCTGCGCTAGGCACTACGATTATGGCGGCTTTCCTTATTGGGGC CAGGGCACCCTGGTGACAGTGTCCAGCGCCTCTACCAAGGGCCCATCC GTGTTTCCACTGGCTCCCTCTTCCAAGAGCACCTCTGGCGGCACAGCC GCTCTGGGCTGTCTGGTGAAGGATTACTTCCCAGAGCCCGTGACAGTG TCTTGGAACTCCGGCGCCCTGACCTCCGGAGTGCATACATTTCCCGCT GTGCTGCAGAGCTCTGGCCTGTACAGCCTGTCCAGCGTGGTGACCGTG CCTTCTTCCAGCCTGGGCACCCAGACATATATCTGCAACGTGAATCAC AAGCCATCCAATACAAAGGTGGACAAGAAGGTG
GCTCCAGAGCT GCTGGGAGGACCTAGCGTGTTCCTGTTTCCACCCAAGCCTAAGGACAC CCTGATGATCTCTAGGACCCCCGAGGTGACATGCGTGGTGGTGGACGT GTCCCACGAGGATCCTGAGGTGAAGTTCAACTGGTACGTGGATGGCGT GGAGGTGCATAATGCTAAGACCAAGCCTAGGGAGGAGCAGTACAACAG CACCTATCGGGTGGTGTCTGTGCTGACAGTGCTGCACCAGGACTGGCT GAACGGCAAGGAGTATAAGTGCAAGGTGAGCAATAAGGCCCTGCCCGC TCCTATCGAGAAGACCATCTCTAAGGCCAAGGGCCAGCCTCGGGAGCC ACAGGTGTACACACTGCCTCCAAGCAGAGACGAGCTGACCAAGAACCA GGTGTCTCTGACATGTCTGGTGAAGGGCTTCTATCCTTCTGATATCGC TGTGGAGTGGGAGTCCAATGGCCAGCCAGAGAACAATTACAAGACCAC ACCCCCTGTGCTGGACAGCGATGGCTCTTTCTTTCTGTATTCCAAGCT GACCGTGGATAAGAGCAGGTGGCAGCAGGGCAACGTGTTCTCCTGTAG CGTGATGCACGAGGCACTGCACAACCACTACACTCAGAAATCCCTGTC CCTGTCACCTGGCAAATGA Individualregionsofmouse-humanchimericheavy chainencodedsequenceareindicatedwithalter- natingitalics.Positions:1-57= leader sequence;58-147= frameworkregion(FR1);148- 162= complementaritydeterminingregion(CDR1); 163-204= FR2;205-255= CDR2;256-351= FR3; 352-378= CDR3;379-411= FR4;412-1401= human constantregions(CH1-CH3);706-750= hinge region(bolded);1402-1405= stopcodon.
[0250] The second optimised cDNA sequence generated was used in the generation of a mouse-human chimeric light chain sequence:
TABLE-US-00006 CHOCodonOptimizedcDNASequence#2-mouse- humanchimericlightchain705bp (SEQIDNO:6) ATGAGCGTGCTGACCCAGGTGCTGGCCCTGCTGCTGCTGTGGCTGACC GGAGCCCGTTGCGACATCCAGATGACCCAGTCCCCTGCCTCTCTGTCC GCCAGCGTGGGCGAGACCGTGACAATCACCTGCAGAGCCTCTGGCAAC GTGCACAATTACCTGGCTTGGTATCAGCAGAAGCAGGGCAAGTCCCCA CAGCTGCTGGTGTACACAGCCAAGACCCTGGCTGACGGCGTGCCCAGC AGGTTCTCTGGCTCCGGCAGCGGCACACAGTATAGCCTGAAGATCAAC TCTCTGCAGCCTGAGGATTTTGGCACCTACTATTGCCAGCATTTCTGG TCTAATCCATGGACATTTGGCGGCGGCACCAAGCTGGAGATCAAGAGG ACAGTGGCCGCTCCCTCCGTGTTCATCTTTCCCCCTAGCGACGAGCAG CTGAAGTCTGGCACCGCTTCCGTGGTGTGCCTGCTGAACAATTTCTAC CCTCGGGAGGCCAAGGTGCAGTGGAAGGTGGATAACGCTCTGCAGTCT GGCAATTCCCAGGAGAGCGTGACAGAGCAGGACTCTAAGGATTCCACC TATAGCCTGTCCAGCACACTGACCCTGTCCAAGGCCGACTACGAGAAG CACAAGGTGTATGCTTGTGAGGTCACTCACCAGGGGCTGTCAAGTCCA GTCACAAAGTCCTTCAATAGGGGGGAATGCTGA Individualregionsofmouse-humanchimericlight chainencodedsequenceareindicatedwithalter- natingitalics.Positions:1-60= leader sequence;61-129= frameworkregion(LFR1); 130-162= complementaritydeterminingregion (LCDR1);163-207= LFR2;208-228= LCDR2;229- 324= LFR3;325-351= LCDR3;352-381= LFR4; 382-702= humanconstantregion(CK);703-705= stopcodon.
[0251] Chimeric MIL-38 Mouse Human CH1-CH3 chains were transiently expressed in suspension CHO-3E7 cells using serum free medium, followed by one-step purification.
[0252] CHO-3E7 cells were grown in serum free FreeStyle CHO Expression Medium (Life Technologies, Carlsbad, Calif., USA). The cells were maintained in Erlenmeyer Flasks (Corning Inc., Acton, Mass.) at 37 C. with 5% CO.sub.2 on an orbital shaker (VWR Scientific, Chester, Pa.). On the day of transfection, DNA and PEI (Polysciences, Eppelheim, Germany) were mixed at an optimal ratio and then added into the flask with cells ready for transfection. The supernatant collected on day 6 was used for further purification.
[0253] Cell culture broth was centrifuged and followed by filtration. Filtered supernatant was loaded onto a 5 ml Protein A CIP column (GenScript, Cat. No. L00433) at 3.0 ml/min. After washing and elution with appropriate buffer, the fractions were collected and neutralized with IM Tris-HCl, pH 9.0. The purified protein was analyzed by SDS-PAGE, Western blot by using standard protocols for molecular weight, yield and purity measurements.
[0254] Chimeric MIL-38 Antibody Assays (Slide Immunofluorescence)
[0255] The MIL-38 chimeric antibody was used in immunofluorescence assays with DU-145 cells. The murine MIL-38 prep 33A was used as a positive control for GPC-1 antigen staining, while Cetuximab (a chimeric antibody targeting the EGFR) was used as a positive control for staining of human IgG constant regions. A slide with no primary antibody was used as a negative control. Staining was performed essentially as described in Section 1.1 with the exceptions that secondary antibodies were labelled with Alexafluor 488 and that anti-human antibodies were used to stain the chimeric and cetuximab samples.
[0256] Chimeric MIL-38 Western Blots
[0257] The reactivity of the chimeric MIL-38 and murine MIL-38 towards DU-145 and C3 MPEK extracts as well as to recombinant NS0-produced GPC-1 antigen was tested by Western blot. Western blots were probed either by murine MIL-38 or chimeric MIL-38. Chimeric MIL-38 was detected by goat anti-human secondary antibody followed by a sheep-anti-goat HRP antibody. As a control, murine MIL-38 was detected by goat anti-mouse secondary antibody followed by a sheep-anti-goat HRP antibody. Equivalent reactivity was observed for chimeric MIL-38 and murine MIL-38 when detected under equivalent conditions.
2.2 Results
[0258] Expression of Chimeric Antibody Sequences
[0259] The recombinant plasmids encoding heavy chain and light chain of Chimeric MIL-38 Mouse Human CH1-CH3 Chain were transiently transfected into suspension CHO-3E7 cell cultures. The target protein was captured from the cell culture supernatant by Protein A CIP 5 ml column and followed by buffer exchange. The purified protein was analyzed by SDS-PAGE and Western blot.
[0260] Chimeric Antibody Sequences
[0261] Optimised cDNA sequence #1 (SEQ ID NO: 5) was used to generate a chimeric MIL-38 antibody heavy chain with the following amino acid sequence:
TABLE-US-00007 ChimericMIL-38MouseHumanCH1-CH3Chain SequenceMouseVH-HumanCH1-CH3Chain(heavy chain) (SEQIDNO:7) MAWVWTLLFLMAAAQSIQAQIQLVQSGPELKKPGETVKISCKASGYAF TDYSMNWVKQAPGKGLRWMGWINTETGEPTYTDDFKGRFAFSLETSAS TAFLQINNLRNEDTATYFCARHYDYGGFPYWGQGTLVTVSSASTKGPS VFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPA VLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV APELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDE LTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFF LYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK* Individualregionsofmouse-humanchimericheavy chainsequenceareindicatedwithalternating italicsintheaminoacidsequenceabove: Positions1-19= leadersequence;20-49= frame- workregion(HFR1);50-54= complementarity determiningregion1(HCDR1);55-68= HFR2;69- 85= HCDR2;86-117= HFR3;118-126= HCDR3;127- 137= HFR4(alsocalledthejoiningregionorJ- region);138-467= IgG1chainconstantregions (CH1-CH3),&stopcodon(*). Hingesequence-humanIgG1heavychainhinge sequenceisboldedabove.
[0262] Optimised cDNA sequence #2 (SEQ ID NO: 6) was used to generate a chimeric MIL-38 antibody light chain with the following amino acid sequence:
TABLE-US-00008 ChimericMIL-38Mouse-HumanKappaLightChain Sequence:MouseVK-HumanCKsequence (SEQIDNO:8) MSVLTQVLALLLLWLTGARCDIQMTQSPASLSASVGETVTITCRASGN VHNYLAWYQQKQGKSPQLLVYTAKTLADGVPSRFSGSGSGTQYSLKIN SLQPEDFGTYYCQHFWSNPWTFGGGTKLEIKRTVAAPSVFIFPPSDEQ LKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDST YSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC* Individualregionsofmouse-humanchimericlight chainaminoacidsequenceareindicatedwith alternatingitalics:Positions1-20= Leader sequence;21-43= frameworkregion(LFR1); 44-54= complementaritydeterminingregion1 (LCDR1);55-69= LFR2;70-76= LCDR2;77-108= LFR3;109-117= LCDR3;118-127= LFR4;128-234= kappaconstantregion(CK)&stopcodon(*)
[0263] Chimeric MIL-38 Antibody Assays (Slide Immunofluorescence)
[0264]
[0265] Chimeric MIL-38 Antibody Assays (Western Blots)
[0266]
[0267] The murine MIL-38 anti-mouse recognises the antigen in DU-145 lysates and recombinant GPC-1 NS0. Reactivity was not observed in C3 lysates as expected (
[0268] A three-antibody detection method was required to test reactivity of the chimeric MIL-38 with DU-145 and C3 extracts as well as recombinant NS0 GPC-1 (
[0269] As shown in
2.3 Discussion
[0270] The Chimeric MIL-38 antibody was successfully expressed and purified in suspension CHO-3E7 cells. The H and L chains of target antibody were detected with estimated molecular weights of 55 kDa (Cal.M.W. 52 kDa) and 28 kDa (Cal.M.W. 26 kDa) based on SDS-PAGE and Western blot analysis.
[0271] Equivalent reactivity between the chimeric MIL-38 and the murine parent was observed in IFA and western blotting, indicating that binding specificity has been maintained in the construction of the chimeric antibody.
Example 3: Preparation and Single Chain Variable Fragment (scFv) MIL-38 Antibody
3.1 Materials and Methods
[0272] Preparation of scFv antibody
[0273] An optimised cDNA sequence was developed for cloning purposes. This was based on the AM-4 Heavy chain and Light chain consensus sequences identified above in Example 1. The heavy chain variable region was positioned at the N-terminus and linked to the light chain variable region using a flexible to serine/glycine linker. The scFv protein incorporated a C-terminal tag consisting of six histidines (hexa his) to facilitate purification of the recombinant protein and a C-terminus cysteine residue to facilitate Cys-based labeling.
[0274] An optimised cDNA sequence was used to generate a mouse-human chimeric heavy chain amino acid sequence:
TABLE-US-00009 scFvMIL-38aminoacidsequence (SEQIDNO:9) MGWSCIILFLVATATGVHSQIQLVQSGPELKKPGETVKISCKASGYAF TDYSMNWVKQAPGKGLRWMGWINTETGEPTYTDDFKGRFAFSLETSAS TAFLQINNLRNEDTATYFCARHYDYGGFPYWGQGTLVTVSS DIQMTQSPASLSASVGETVTITCRAS GNVHNYLAWYQQKQGKSPQLLVYTAKTLADGVPSRFSGSGSGTQYSLK INSLQPEDFGTYYCQHFWSNPWTFGGGTKLEIKHHHHHHC* Individualregionsofmouse-humanchimericheavy chainsequenceareindicatedwithalternating italicsintheaminoacidsequenceabove: Positions1-19= leadersequence;20-49= frame- workregion(HFR1);50-54= complementarity determiningregion1(HCDR1);55-68= HFR2; 69-85= HCDR2;86-117= HFR3;118-126= HCDR3; 127-137= HFR4(alsocalledthejoiningregionor J-region);138-152= gly/serflexiblelinker sequence,153-175= frameworkregion(LFR1); 176-186= complementaritydeterminingregion1 (LCDR1);187-201= LFR2;202-208= LCDR2;209- 240= LFR3;241-249= LCDR3;250-259= LFR4; 260-265= HexaHistag&stopcodon(*). Linkersequence-Gly/serlinkersequenceis boldedabove.
[0275] ScFv MIL-38 was transiently expressed in CHO cells followed by one-step purification utilizing the hexa-histidine tag and a nickel affinity column.
[0276] FLOW Cytometry
[0277] Murine 1F5 MIL-38 antibody or the scFv MIL-38 construct were labelled with CY5 fluorophor using standard methods. These antibodies were then used to stain DU-145 prostate cancer cells.
[0278] Briefly, DU-145 cells were detached using PBS/2 mM EDTA. Following centrifugation, cells were incubated with antibodies or control solutions in FACS wash solution (PBS/5% fetal calf serum) on ice for 45 min. Following washing with FACS wash solution, cells were resuspended in PBS then assessed for cell binding using FLOW cytometry.
[0279] To examine the specificity of binding, DU-145 cells were pre-incubated with unlabelled murine MIL-38 antibody prior to incubation with CY5-labelled MIL-38.
[0280]
3.3 Discussion
[0281] The MIL-38 antibody was successfully converted to an scFv format. Binding to DU-145 cells was lower than the parent MIL-38 murine antibody.
Example 4: Internalisation of Murine 1F5 MIL-38 and Chimeric MIL-38 Antibody in DU-145 Prostate Cancer Cells
4.1 Materials and Methods
[0282] FLOW Cytometry of MDA-MB-231, T-24, PANC-1 or DU-145 Cells
[0283] Cells were detached with PBS-EDTA then incubated with MIL-38 primary antibody on ice for 45 min in FACS wash buffer (PBS +5% FCS). Cells were washed three times in FACS wash buffer then incubated with AlexaFluor 488 secondary antibody for 30 min on ice in the dark. Following washing 3 times with FACS wash buffer cells were transferred to FACS tubes and assayed using FLOW cytometry.
[0284] Antibody Internalisation Assay
[0285] MDA-MB-231 or DU-145 cells were seeded in 8-well chamber slides (5) and grown for 24 hours in media containing 10% FCS. Cells were changed to serum free medium for 36 hours. Slides were put on ice, the medium was removed and 200 L of 10 ug/mL of cold antibody solution in serum free medium were added per well. Cells were incubated for 30 minutes on ice, then washed once with cold serum free medium, 200 L of serum free medium were added per well, and cells were incubated at 37 C., 5% CO.sub.2 for 0, 5, 15 and 30 min. The medium was then removed and cells were fixed with 3% PFA in PBS for 15 min at room temperature. After fixation, cells were washed once with PBS and permeabilised with cold Triton X-100 0.1% in PBS for 5 min. Cells were then washed with PBS to remove excess of detergent, and then blocked with 5% skim milk in Tris Buffered Saline (TBS, pH 7.5) for 30 min. The corresponding secondary antibody (goat anti-mouse-Alexa488 and goat anti-human-Alexa488) was diluted (4 g/mL and 2 g/mL respectively) in PBS. 200 uL/well to the secondary antibody solution was added per well, and incubated for 45 min at room temperature in the dark. Cells were washed once with PBS, then incubated with 200 L per well of 1 g/mL Hoechst (nuclear counterstaining) for 5 minutes, then washed twice with PBS. Chambers were removed, and slides were mounted using 70% glycerol in water as mounting media.
[0286] For T-24 cells, cells were seeded in 8-well chamber slides and grown for 3 days, until they reached about 50% confluency. Cells were incubated for 72 hours in serum free medium. Slides were then processed as described above for MDA-MB-231 and DU-145 cells.
[0287] For the PANC-1 timecourse, cells were treated as described above for DU-145 cells. Duplicate slides were made, and the cells fixed following 15 min or 60 min at 37 C.
4.2 Results
[0288]
[0289]
4.3 Discussion
[0290] MIL-38 antibodies bind to the GPC-1 heparan sulfate proteoglycan antigen (
[0291] GPC-1 may therefore be able to transport bound MIL-38 antibodies into the cell via these trafficking mechanisms to enable delivery of toxic moieties such as drugs or radionuclides. The target of the BLCA-38 antibody has recently been identified as GPC-1 (PCT application no: PCT/AU2015/000018). However, the BLCA-38 antibody (a parent cell line to the 1F5 murine MIL-38 antibody) has been reported as not undergoing internalisation (Khatri 2010). BLCA-38 cells were recently shown to be bi-clonal with only one cell population recognising GPC-1 (PCT/AU2014/000999). The 1F5 murine MIL-38 subclone and the chimeric MIL-38 antibody both recognise GPC-1, however their internalization has not to date been investigated in a range of cell types.
[0292] DU-145 prostate cancer cells show higher antibody binding than MDA-MBA-231 breast cancer cells or T-24 bladder cancer cells and chMIL-38 is also able to bind PANC-1 cells (
[0293] GPC-1-mediated internalisation of MIL-38 antibodies therefore depends on more than expression of the MIL-38 antigen and may depend on the level of expression or the cell type. The role of cell type is supported by a recent report describing alterations of endosomal function in prostate cancer compared to normal prostate (Johnson et al 2014 Mol Cancer Res. 2014 December; 12(12):1851-62).
[0294] The chimeric MIL-38 antibody was internalised after binding GPC-1 on the cell surface of either prostate, bladder or pancreatic cancer cell lines. The strong internalisation of chMIL-38 indicates its suitability as an antibody drug conjugate (ADC).
Example 5: Targeting of MIL-38 Antibodies to DU-145 Xenografts
5.1 Materials and Methods
[0295] Xenograft Model
[0296] Nude mice were injected subcutaneously in the left flank with 110.sup.6 DU-145 cells. The cells were allowed to grow for approximately four weeks, then 100 l of 5 M Cy-5-labelled antibody in PBS was injected i.v. into the tail vein. Optical images were taken 24 hrs post injection using a Bruker MS-FX Pro scanner. Three mice were injected with Cy-5 labelled 1F5 murine MIL-38 and three mice were injected with Cy-5 labelled chimeric MIL-38.
5.2 Results
[0297] Both 1F5 MIL-38 (
5.3 Discussion
[0298] Previous data using radio-conjugated BLCA-38 indicated targeting to prostate cancer xenograft (Carter et al 1994), however due to the biclonal nature of the BLCA-38 antibody it is unclear if the 1F5 clone would show similar targeting or whether the AM3-like clone is responsible for the tumour localization seen.
[0299] The results shown in
[0300] The tumour-specific localization of the 1F5 and chimeric MIL-38 antibodies suggests that they would be good agents to deliver anti-prostate cancer therapies such as antibody drug conjugates or radio-immunotherapies.
Example 6: Cell Growth Inhibition Assays
6.1 Materials and Methods
[0301] Cell Growth Inhibition Assay
[0302] This assay is designed to screen antibodies that may internalise and deliver toxins to cells resulting in cell growth inhibition and/or cell death. Antibodies that induce cell growth inhibition are candidates to convert to an antibody-drug conjugate (ADC) format with the toxin payloads identified.
[0303] The assay involves first the incubating the test antibody and target cells in the presence of Protein G that has been linked to different toxins suitable for use in ADC technology. An antibody dose response curve is established with fixed final concentration of protein G-toxin.
[0304] The following protein G combinations were chosen:
TABLE-US-00010 TABLE 3 protein G combinations Working Preloaded Protein G Linker Concentration PSGD (preloaded with DM1) Non-cleavable 10 nM PSGE (preloaded with MMAE) Cleavable 50 nM PSGF (preloaded with MMAF) Non-cleavable 100 nM PSGDuc (preloaded with Duocarmycin) Cleavable 50 nM
The assay format was performed as follows:
[0305] Cells were plated in 96 well at 20-30% confluency in 100 l culture medium then incubated overnight. Antibodies were serially diluted, starting from the concentrations indicated in the graph at 19:60 ratio, then added to the 96 well plate containing cells.
[0306] Preloaded protein G-drug conjugate was added to treated wells at concentration indicated above. Cells were then incubated for 3 days, then measurement of cell viability was performed using CelltitreGlo.
The following antibodies were tested: [0307] to a. Chimeric MIL-38 (human IgG1) [0308] b. Murine 1F5 MIL-38 (murine IgG1, high GPC-1 binding subclone of BLCA-38) [0309] c. Murine BLCA-38 (murine IgG1, mixed population consisting of 1F5-type and AM3 type antibodies) [0310] d. Murine AM3 (murine IgG, low GPC-1 binding subclone of BLCA-38) [0311] e. Erbitux (control human IgG1 chimeric anti-EGFR antibody)
6.2 Results
[0312] Two cell lines were chosen for inclusion in the assay DU-145 and MDA-MB-231. Both are GPC-1 positive, but exhibit different levels of MIL-38 reactivity and internalization. The antibodies chosen represent a range of different characteristics:
TABLE-US-00011 TABLE 4 antibodies used DU-145 MDA-MB-231 Internalisa- Internalisa- Antibody Binding tion Binding tion Isotype Chimeric ++++ ++++ Not Human IgG1 tested BLCA-38 ++++ Negative* ++ Not tested Murine IgG1 AM3 /+ Not tested Not Not tested Murine IgG1 tested IF5 ++++ ++++ ++ Not tested Murine IgG1 Erbitux Positive Assumed Positive Assumed Human IgG1 control positive control positive *BLCA-38 is reported not to internalise (Kharti et al 2010).
[0313] MDA-MB-231 cells were insensitive to all anti-GPC-1 antibody/toxin combinations (
[0314] DU-145 cells were sensitive to all the toxins used in this assay when targeted by Erbitux, but showed no inhibition with Erbitux alone (
[0315] The concentrations of protein G-duocarmycin used in experiments depicted in
[0316] Internalisation of the antibody alone does not predict growth inhibition: the chimeric MIL-38 and the 1F5 murine MIL-38 internalise to equivalent levels (
6.3 Discussion
[0317] A number of key questions were assessed in these assays: [0318] 1. If a cell line expresses the GPC-1 antigen (regardless of expression level) it will be sensitive to anti-GPC-1 antibodies? [0319] 2. If an antibody internalises it will be able to cause growth inhibition via internalization of a GPC-1/anti-GPC-1 antibody/protein G toxin complex? [0320] 3. Equivalent levels of antibody internalization should lead to equivalent growth inhibition. [0321] 4. Relative sensitivity of a cell line/antibody/toxin combination.
[0322] MIL-38-derived antibodies display a distinct activity profile compared to the positive control in these assays (Erbitux). Firstly chimeric MIL-38 in combination with the toxins tested shows no activity towards the breast cancer cell line MDA-MBA-231 despite expression of GPC-1 on this cell line. In contrast Erbitux is active against MDA-MB-231 cells with all toxins tested.
[0323] Secondly, chimeric MIL-38 shows growth inhibition with MMAE and MMAF toxins for DU-145 cells, whereas murine 1F5, AM3 or BLCA-38 shows no activity. This is particularly unexpected in the case of 1F5 where equivalent internalization has been demonstrated (
[0324] It is clear from these results that internalization of either the antigen alone or the antibody do not predict the potential activity of given antibody/antigen complex and that empirical data must be obtained to determine the potential utility of a given molecule.
[0325] The observation that MDA-MB-231 cells that express the lowest levels of GPC-1 antigen do not show cell growth inhibition with chimeric MIL-38 despite expressing the GPC-1 antigen suggests that an ADC version of the chimeric MIL-38 may be able to target prostate cancer cells specifically and not affect other tissues with low GPC-1 antigen expression. The identification of growth inhibition with chimeric MIL-38 but not 1F5 suggests that the chimeric format provides unexpected advantages for the deployment of ADC-based strategies.
Example 7: Development of a Scalable Chimeric Expression System
7.1 Materials and Methods
[0326] Cell Line Development
[0327] Production of sufficient chimeric antibody for clinical trials and ultimately commercial supply requires a production system capable of high antibody expression and good recoveries following purification. Production of the chimeric antibody described in Example 1 was performed using transient expression, a technique unsuitable to large scale GMP production. Therefore a suitable expression/purification system was developed with the following characteristics: [0328] 1. Use of an established gene transduction technology. [0329] 2. Use of a cell line of sufficient quality and lineage suitable for clinical grade production [0330] 3. Use of cell growth medium, bioreactors and purification techniques suitable for scalable GMP production of final product.
[0331] Catalent was selected as the manufacturer due to their extensive experience with GMP production of antibodies and their proprietary GPEX retrovector expression technology.
[0332] A stable cell pool was developed using the chimeric MIL-38 heavy and light chains coding sequences incorporated into Catalent's GPEX expression retrovectors.
[0333] Following selection, a stable pool was established and used for 25 L scale up production of chimeric MIL-38. The cell supernatant was purified using processes suitable for scalable production.
7.2 Results
[0334] A stable pool was established and used for an early stage production run. A 25 L production run was performed as an 18-day fed-batch using the stable cell pool. Viable cell density (
[0335] The supernatant harvest from the fed batch was clarified, then purified using scalable techniques used for antibody purification, host cell protein and virus reduction (Table 5). Yield of approximately 50% were obtained using non-optimised purification, indicating that a scalable process had been developed.
TABLE-US-00012 TABLE 5 yields and recovery during purification of chimeric MIL-38. Step Overall Volume Conc. Total Yield Yield Step (L) (mg/mL) (g) (%) (%) Harvest 25.0 0.81 20.3 100 100 Clarification 24.7 0.77 18.9 93 93 Protein A/Low pH 2.4* 6.6 15.9 84 78 Hold Q Flow through 2.22 5.2 11.5 94 73 CEX Bind and 0.50 16.1 8.0 75** 55 Elute Viral Filtration 0.77 9.2 7.1 89 49 Formulation 0.78 9.3 7.3 103 50
7.3 Results
[0336] A stable CHO cell pool expressing chimeric MIL-38 was established using the GPEX technology and used for an early stage production run. Good expression was observed during the initial fed batch production run and good recoveries were achieved using standard purification processes known to be suitable for GMP production.
[0337] The stable pool will form the basis for future cell line development, incorporating clone isolation and master and working cell bank construction. The purification process used can be further optimized to increase yields.
[0338] Use of well established cell lines, expression vectors, cell growth systems and purification techniques means that the final antibody product obtained from the 25 L pilot batch should possess very similar characteristics to that produced from the final production process. The yields obtained to date indicate that the product can be produced at costs consistent with other marketed antibody products.
Example 8: Development of a Chimeric MIL-38 DOTA Conjugate for Imaging and Radiotherapy
8.1 Materials and Methods
[0339] Conjugation of MIL-38 with DOTA for .sup.177Lu Labeling
[0340] DOTA was conjugated to chimeric MIL-38 at a 10:1 ratio as follows. p-SCN-Bn-DOTA was prepared in 0.1M PBS (pH 8.5) buffer, then chimeric MIL-38 (cMIL-38) was added to the mixture. The mixture was allowed to react for 20 hours at room temperature in the dark.
[0341] The conjugated mAb mixture was purified using a pre-conditioned mini PD-10 gel column. Fractions were screen fractions for activity by HPLC.
[0342] Labeling of MIL-38 with .sup.177Lu
[0343] 0.472.1 mCi of .sup.177Lu in 10 L of 0.05N HCl was added to 0.2 mg of DOTA-cMIL-38, then the pH adjusted to pH 7.5. The mixture was incubated at 50 C. for 60 min in the dark, then cooled to room temperature and let sit for 20 min.
[0344] The radiolabelled MIL-38 DOTA was purified using a pre-conditioned mini PD-10 gel column. The column was preconditioned with 2 mL of 1PBS and the effluent discarded. This was repeated four times in total, then the radioactive solution was added to the centre of the column. 0.2 ml of PBS was added and the fraction collected in a low binding Eppendorf tube. This was repeated another 19 times, then the activity in each fraction was determined using a dose calibrator. A sample of the radioactive mAb was analysed using radio-HPLC for confirmation analysis.
[0345] Mock Labeling of MIL-38 DOTA and FLOW Cytometry
[0346] To confirm that binding of chimeric MIL-38 to DU-145 cells was retained following conjugation with DOTA and after the radio-labeling process, MIL-38 DOTA was put through a mock radiolabeling process in which it was incubated with the same buffers and exposed to the same temperatures that are used during the radio-labeling process described above. The PD-10 column purification steps were omitted.
[0347] The chimeric MIL-38, MIL-38 DOTA and mock-labelled MIL-38 DOTA were then each used as the primary antibody for FLOW cytometry analysis.
[0348] Conjugation of chMIL-38 with DOTA for Scale Up Manufacture and .sup.67Ga Labelling
[0349] Conjugation of chMIL-38 to p-SCN-Bn-DOTA (DOTA) was undertaken following the method outlined by Forrer et al. titled in vitro characterization of .sup.177Lu-radiolabelled chimeric anti-CD20 monoclonal antibody and a preliminary dosimetry study. Three conditions were used: 5, 10 and 20 fold excess of DOTA. Briefly, three vials of chMIL-38 (9.3 mg/ml) were combined and buffer exchanged from 0.01M PBS to 0.2Na.sub.2CO.sub.3, pH9.5. The chMIL-38 solution was then concentrated to a final volume of 433 l, giving an effective concentration of 64.4 mg/ml. The material was split into three 144 l aliquots then reacted with DOTA (5, 10 or 20 equivalents). Each reaction mixture was maintained at 37 C. or 1 hour. Samples were then washed with 5 ml of Na.sub.2CO.sub.3 buffer pH 9.5 then buffer exchanged with 0.25M ammonium acetate, pH7.
[0350] Mass spectral analysis indicated that the number of DOTA attached was 4.3 DOTA: MAb (5 fold reaction excess), 4.6 DOTA: MAb (10 fold reaction excess) and 7.5 DOTA: MAb (20 fold reaction excess).
[0351] .sup.67Ga labeling of chMIL-38 DOTA
[0352] 67Ga-labeling of chMIL-38 DOTA was performed using the product generate from the fold reaction excess containing 7.5 DOTA:MAb ratio. Reaction conditions: 50 l .sup.67GaCl.sub.3 in 0.02M HCl, 100 l 0.1M NaOAc buffer at pH 5.0, chMIL-38 DOTA: 5 to 25 l of antibody (46-230 g) was used. The mixture was incubated at 40C for 1 or 16 hours. The radiochemical yield and derived specific activity were calculated.
[0353] Assessment of DOTA Conjugation and Labelling Conditions on MIL-Antigen Binding by FLOW Cytometry and Direct Binding ELISA
[0354] To confirm that the reaction conditions used to conjugate DOTA to chMIL-38 using 5, 10 or 20 fold excess of DOTA did not significantly alter binding of chMIL-38 DOTA to GPC-1 two assays were used: FLOW cytometry and a direct binding ELISA. FLOW cytometry was performed as follows. DU-145 or T-24 cells were detached using 2 mM EDTA (10 min at 37 C.). Cells were pelleted, and then 210.sup.5 cells per tube were prepared. Cells were incubated with primary antibody (1 g/ml, 50 l) on ice for 45 min, then washed three times in FACS wash buffer (1PBS solution). Cells were then incubated with 50 l of secondary antibody (1 g/ml AlexaFluor 488 goat anti-human (H+L)) for 45 min. Cells were washed three times in FACS wash buffer then run through BD LSRFortessaCell analyser using software BD FACSDIVA.
[0355] The GPC-1 direct binding ELISA was performed as follows. 96 well plates were coated with 10 mM Carbonate buffer, pH 9 for 15 mins. The carbonate buffer was removed and wells were coated overnight at room temperature with 1.5 g/ml recombinant human GPC-1 (R&D systems) in 10 mM Carbonate buffer, pH 9. The following day wells were washed with 5 mM carbonate buffer, pH 9 then blocked with 10% casein in PBS for 1 hours. The primary antibody was serially diluted starting at 25 ng/mL to 0.39 ng/mL then incubated 1 hours at room temperature. Plates were then washed four times with PBS-Tween 20 (0.1%). Secondary antibody Thermofisher rabbit anti-human was diluted 1:8000 in PBS-Tween, 10% casein then incubated for 1 hours at room temperature. Plates were washed four times with PBS-Tween and 100 l TMB added. Plates were developed for 2 min and read at .sub.450 nm.
8.2 Results
[0356]
[0357] Using the conjugation, labeling and purification procedures described above, a single peak of .sup.177Lu radiolabelled chimeric MIL-38 DOTA is obtained.
[0358]
[0359] Alternate conjugation conditions were used for scale up production of chMIL-38 DOTA and for labelling with .sup.67Ga. .sup.67Ga has a half-life of 3.3 days and is therefore a better isotope to predict the in-vivo biodistribution of chMIL-38 DOTA-labelled chMIL-38 than isotopes such as .sup.68Ga (half life 68 min).
[0360]
[0361] To maximise specific activity of the .sup.67Ga-labelled chMIL-38 DOTA, the effects of the ratio of chMIL-38 DOTA to .sup.67GaCl.sub.3 and incubation time (1 hours vs 16 hours) were examined. As shown in Table 6 the amount of antibody in the reaction mix was the most important variable in determining radiochemical yield (RC) and the derived specific activity (SA).
TABLE-US-00013 TABLE 6 Effects of antibody mass and incubation times on radiochemical yield and derived specific activity for chMIL-38 labelling with .sup.67Ga Mass of Reaction Time 67 Ga Activity Antibody Derived SA Reaction ID (h) (MBq) (ug) RC Yield (%) MBq/mg NGL07104-1 1 40.4 230 98 170 NGL07104-2 1 39.5 92 79 340 NGL07104-3 1 37.4 46 72 585 NGL07104-4 16 37.8 230 97 136* NGL07104-5 16 38.1 92 83 293* NGL07104-6 16 38.1 46 84 594* *Decay corrected value (18 h decay, x0.853)
[0362] As the conditions used for conjugation of DOTA to chMIL-38 and for labelling with .sup.67Ga labelling may affect the binding activity a series of experiments was designed to examine the effects of these procedures on chMIL-38 binding to the GPC-1 antigen in two distinct assays: FLOW cytometry (targeting the cell-bound antigen) and a direct binding ELISA (targeting a surface bound recombinant form of GPC-1).
[0363] The effects of the labelling conditions were determined by mock-labeling as described previously. As well, the intra- and inter-assay reproducibility of these assays was assessed.
[0364]
[0365] The conjugation of DOTA to chMIL-38 reduced its binding to GPC-1 in the direct assay compared to the un-conjugated chMIL-38, although this effect was only observed at lower antibody concentrations and was not dependent on the DOTA ratio used in the experiment or the number of DOTA molecules attached (
8.3 Discussion
[0366] A method has been successfully developed to conjugate chimeric MIL-38 with the DOTA chelation molecule. A chimeric MIL-38 DOTA antibody can be labelled with agents such as .sup.67Ga for imaging, or .sup.177Lu for imaging and radio immunotherapy treatment. Other agents such as Gadolinium or .sup.90Yttrium can also be chelated with the DOTA chelator.
[0367] FLOW cytometry and direct binding data indicates that the conjugation and labeling processes have minimal effect on the ability of chimeric MIL-38 to bind DU-145 cells.
Example 9: Chimeric MIL-38 Localization in a Mouse Xenograft Model
[0368] 9.1 Materials and Methods
[0369] Antibody Labelling and Internalisation
[0370] Chimeric MIL-38 was labelled with the Cy5 fluorophor for visualisation. Retention of binding activity post labelling was confirmed by FLOW cytometry using DU-145 cells. ChMIL-38 Cy5 demonstrated clear internalisation into DU-145 cells.
[0371] Xenografts and Antibody Infusions
[0372] Three 8-week-old male Balb/c nude mice were injected subcutaneously with 510.sup.6 DU-145 cells in 100 L serum free media (RPMI) into the right flank of each mouse. At 26 days all mice had palpable tumours (approximately 4 mm across). Antibody solution (approx. 150 g/injection) was injected via the tail vein and then imaged using the Bruker In-Vivo Xtreme Optical Scanner at 0, 4 hours, 24 hours, 48 hours, 72 hours and 144 hours.
9.2 Results
[0373] Tumour localisation was seen at 4 hours in two of three mice and was clearly evident at 24 hours post infusion in all three mice tested (
Example 10: Biodistribution Study of .SUP.177.Lu DOTA MIL-38
10.1 Materials and Methods
[0374] Biodistribution Study
[0375] Male Wistar rats were injected at T.sub.0 with 5 planned exsanguination time points for dissection and measurement of key organ radioactivity accumulation. Planned time points were 6 hours, 24 hours, 48 hours, 7 days and 14 days.
[0376] DOTA conjugated MIL-38 antibody, supplied by Singapore Radiopharmaceuticals was radiolabelled with .sup.177Lu and passed bench top quality assurance testing.
10.2 Results
[0377] A standardised plot of % of injected activity per gram of organ at the different timepoints (
[0378] No adverse events were noted with the test animals.
10.3 Discussion
[0379] .sup.177Lu-labelled chimeric MIL-38 DOTA showed good tolerability with no evidence of toxic accumulation in tissues or organs, in particular excretory organs. The agent was well tolerated with no adverse events noted.
[0380] These results in normal rats combined with the tumour targeting seen with fluorescently labelled chimeric MIL-38 (
Example 11: PET Imaging Study of .SUP.64.Cu chMIL-38 DOTA and NOTA in Xenografts
11.1 Materials and Methods
[0381] The aim of this study was to examine in vivo targeting of radio-labelled chMIL-38 to DU-145 xenografts using PET-CT and ex vivo organ analysis. As neither .sup.67Ga nor .sup.177Lu can be used for used for PET-CT imaging .sup.64Cu was used as the radiolabel. NOTA is the preferred chelator for .sup.64Cu, hence chimeric MIL-38 was also conjugated to the NOTA chelator and .sup.64Cu was used as the imaging isotope. Imaging was performed using a Siemens Inveon PET-CT scanner. Both .sup.64Cu chMIL-38 NOTA and .sup.64Cu chMIL-38 DOTA were used for imaging and biodistribution purposes.
[0382] 8-week-old male Balb/c nude mice were injected subcutaneously with 510.sup.6 DU-145 cells in 100 L serum free media (RPMI) into the right flank of each mouse. There was no evidence of ulceration at the time of dosing, the animals were closely monitored and remained in good condition apart from the tumours. At 38 days all mice had palpable tumours (approximately 4 mm across). Antibody solutions were injected via the tail vein at 54 days post inoculation and then imaged using the Siemens Inveon PET-CT instrument. Two mice were infused with .sup.64Cu chMIL-38-DOTA and three mice with .sup.64Cu chMIL-38-NOTA. Each mouse received approximately 100 g of chMIL-38 with activities of 3.1-3.4MBq (chMIL-38 DOTA) or 4-4.8MBq (chMIL-38 NOTA).
[0383] The PET Images were reconstructed using an ordered-subset expectation maximization (OSEM2D) algorithm and analysed using the Inveon Research Workplace software (IRW 4.1) (Siemens) that allows fusion of CT and PET images and definition of regions of interest (ROIs). CT and PET datasets of each individual animal were aligned using IRW software (Siemens) to ensure good overlap of the organs of interest.
[0384] Mice were imaged at 24 hours and 48 hours, then the major organs were removed from the mice and the amount of antibody present was measured by -analysis.
11.2 Results
[0385] In vivo imaging showed good tumour accumulation and long term localisation (over 2 days) for the chMIL38 NOTA antibody as was observed for the Cy5-labelled chMIL-38 (
[0386] Ex vivo analyses showed biodistribution at 48 hours for the chMIL38 antibody labelled using the two different approaches (
Example 12: Targeting and Tolerability Study of Goat Anti-GPC-1 in Xenografts
12.1 Materials and Methods
[0387] MIL-38 does not recognise mouse GPC-1, therefore there is a possibility that the tumour-specific localisation of chMIL-38 and the good tolerability seen in other studies may be due to the chMIL-38 only targeting human GPC-1 on the xenograft tumours and not targeting endogenous murine or rat GPC-1.
[0388] A goat anti-GPC-1 antibody was identified that recognises mouse recombinant GPC-1 on western blots and can immunoprecipitate mouse recombinant GPC-1 suggesting that it recognises the native (cell surface) form of mouse GPC-1. The Goat anti-GPC-1 antibody was therefore used to confirm that the safety and tolerability results seen for chMIL-38 were also seen with an antibody that recognised mouse GPC-1.
[0389] The FDA guidance on exploratory Investigational New Drugs suggests a maximum microdose for proteins of <30 nmoles. For a full-length monoclonal antibody this is approximately 4.5 mg protein. 0.3 mg of antibody in a mouse is equivalent to a Human Equivalent Dose (HED) of 4.5 mg antibody with a safety factor of 22 or 1 mg antibody with a safety factor of 100 (see Table 7). 300 g of Goat anti-GPC-1 was used as the highest dose per infusion.
[0390] 6 BalbC mice with DU-145 xenografts were dosed with goat anti-GPC-1 labelled with Cy5 via the tail vein. Three were dosed with 150 g of antibody and three were dosed with 300 g of antibody.
TABLE-US-00014 TABLE 7 Calculation of goat anti-GPC-1 does for tolerability study. Human Equivalent Dose (HED) calculations Proposed human total dose (mg) 1 4.5 Safety factor 100 22.2 Equivalent total dose (mg) 100 100 Av pt weight (kg) 75 75 Dose (mg/kg) 1.33 1.33 Conversion factor** 12.3 12.3 Animal dose (mg/kg) 16.4 16.4 Weight of mouse (g) 20 20 Dose per mouse (g) 328 328 *recommended margin for safety factor is 100-22 Guidance for Industry on Estimating the Maximum Safe Starting Dose in Initial Clinical Trials for Therapeutics in Audlt Health Volunteers **for human: mouse refer pg. 7 Guidance for Industry Estimating the Maximum Safety Sarting Dose in Initial CLinical Trials for Therapeutics in Adult Healthy Volunteers Chimeric MIL-38 does not bind recombinant mouse GPC-1 Goat anti-GPC-1 binds both recombinant human and mouse GPC-1 Goat anti-GPC-1 can act as a surrogate in a mouse tolerability study
12.2 Results
[0391] Targeting
[0392] In vivo imaging showed tumour accumulation and long-term localisation (over 5 days) for the goat anti-GPC antibody. This was particular apparent in mouse 2.2 and 2.3 images (
[0393] Ex vivo analyses (
[0394] Safety and Tolerability
[0395] Mice were assessed during the study according to appearance, clinical signs, unprovoked behavior and response to external stimuli (Table 8). Weight was also monitored.
[0396] None of the mice showed any significant health effects due to the antibodies used based on the score sheet used in this study. A single mouse (mouse 2.3) showed minor sluggishness following injection, but this was attributed to a minor burn on the tail incurred during injection. This mouse subsequently recovered during the course of the study.
[0397] Minimal variation in weight for each mouse was observed over the course of the study.
TABLE-US-00015 TABLE 8 Assessment of safety and tolerability. Indicators Date Score of each animal in group Scoring of independent variables: Appearance: 0. Normal coat is smooth, lies flat and often has a sheen, eyes are clear and bright. 1. Slightly ruffled coat but no other marked changes 2. Moderate ruffled coat, eyes and nose may have discharges 3. Very ruffled coat, external orifices ungroomed, abnormal posture, may look hunched up, eyes look pale and pupils enlarged. Clinical Signs 0. Respiration appeas normal, body, temperature feels normal on handling, no twitching behavior, normal bowel movements 1. Small changes in above parameters 2. Body temperature appears above normal, respiration rapid and shallow breathing, twitching behavior, altered bowel movement (change in consistency or amount). 3. Marked increasing body temperature, respiration noisy, comatose. Unprovoked behavior This behavior is best observed from a distance and before any handling is attempted. 0. Normal behavior pattern 1. Minor changes 2. Abnormal behavior, less mobile and less altert than normal, inactive when hyperactivity would be expected. 3. Unsolicited vocalization, self-mutilation, expirator grunts, very restless or does not move at all. Behavioral responses Often mice will show inquisitiveness with to external stimuli whisker twitching and sniffing, or attempts to escape if frightened. Mice can have good body tone and paw grip on handling. If the abdominal area of the body is painful then gently pressure and observation is a useful measure to pain. 0. Behavioral respoinses normal for the expected conditions 1. Shows some minor depression or minor exaggeration of responses. 2. Shows moderate signs of abnormal responses, there may be a change of behavior. 3. Reacts violently to stimuli or muscular responses may be very weak as in pre- comatose state Total scores of: 0-4Normal, no action required 5-10Monitor carefully, evidence of suffering 10 and aboveample evidence of sever pain, euthanase the animal One score of 3 in any of the criteriaeuthanase immediately.
[0398] Discussion
[0399] The Goat anti-GPC-1 showed almost identical targeting to the chMIL-38 results seen in
[0400] The goat anti-GPC-1 antibody was well tolerated at both doses.
Example 13: Detection of Glypican-1 Antigen Using AM4 MIL-38 Antibodies
[0401] Experiments performed by the present inventors determined that an original deposit of the hybridoma for MIL-38 antibody (ATCC accession no. HB11785: murine hybridoma BLCA-38), then referred to as the BLCA-38 hybridoma is a mixed population of hybridoma cells that produces two distinct antibody populations, referred to here as AM3 and AM4. Hybridoma cells responsible for producing each different antibody population were separated, and the AM4 hybridoma cells were deposited on 22 Aug. 2014 at CellBank Australia (CBA) under accession number CBA20140026.
[0402] Ninety-six well plates were coated with MIL-38 preps AM3 or AM4 (1 g/well) in carbonate buffer pH 9.5 overnight. Plates were blocked with PBS-Tween (0.1%) containing 5% skim milk at 37 C. and washed. Antigen (GPC-1 NS0) was diluted in Buffer II (20 mM HEPES pH 7.5, 0.5 mM EDTA, 0.5% Triton X-100) with the addition of 150 mM NaCl and incubated overnight at 37 C. Detection was performed with biotinylated AM4 antibody followed by detection with avidin HRP (1 g/mL). TMB (Sigma cat no T0440) was added and stopped with TMB stop solution (Sigma S5814). Absorbance was read at 450 nm. Results are shown in
[0403] In a second experiment, ninety-six well plates were coated with MIL-38 preps 34A (a mixture of AM3 and AM4 antibodies) or AM4 (2.5 g/well) in PBS pH 7.2 for 1 h at room temperature. Plates were blocked with Blocker Casein (Thermo) in PBS-Tween (0.05%) for 1 h at 37 C. Following washing, antigen (GPC-1 NS0) was diluted in TBS pH 7.2 containing 50 mM Tricine and 150 mM NaCl and incubated at 37 C. for 1 h. Detection was performed with biotinylated AM4 clone 1F5 followed by detection with avidin HRP (1 g/mL). TMB (Sigma cat no T0440) was added and stopped with TMB stop solution (Sigma S5814). Absorbance was read 450 nm. Results are shown in
[0404] The first ELISA described above was developed using MIL-38 to capture NS0 produced GPC-1 (i.e. MIL-38 antigen). This experiment compared monoclonal AM3 MIL-38 and monoclonal AM4 MIL-38 for capture. AM3 did not function as a capture agent in a sandwich ELISA assay, whereas AM4 was shown to do so (
[0405] The second ELISA described above compared the ELISA signal obtained when a mixed population of MIL-38 (AM3 and AM4) was compared to that obtained from a monoclonal AM4 1F5 clone. Using AM4 1F5 as a capture agent provided a higher ELISA signal than using the mixed 34A antibody population (
[0406] The sandwich ELISA results demonstrate that only the AM4-like forms of the monoclonal MIL-38 antibody have utility in detecting glypican-1 antigen as a capture reagent and that a capture agent containing a monoclonal population provides a superior ELISA signal to that consisting of a mixed population.
Example 14: Sequence Analysis of AM4 and AM3 MIL-38 Antibody Populations
Materials and Methods
[0407] Heavy and Light Chain Sequencing (DNA)
[0408] Three separate sequencing runs were performed. The first run (coded 224945) utilised bi-clonal hybridoma cells from a mixed (AM4 and AM3) preparation named 1-O. The second run (coded 449295-1) utilised cells from Alfio I a hybridoma stock that was used to generate AM4. The third run (coded 449295-5) utilised cells from Alfio II, a hybridoma stock that was used to generate AM3.
[0409] For sequencing runs 224945 (1-O) and 449295-1 (Alfio 1), total RNA was extracted from frozen hybridoma cells and cDNA was synthesized from the RNA. RT-PCR was then performed to amplify the variable regions (heavy and light chains) and constant regions of the antibody, which were then cloned into a standard cloning vector separately and sequenced.
[0410] Total RNA was isolated from the hybridoma cells following the technical manual of TRIzol Plus RNA Purification System. The total RNA was analysed by agarose gel electrophoresis. Total RNA was reverse transcribed into cDNA using isotype-specific anti-sense primers or universal primers following the technical manual of SuperScript III First-Strand Synthesis System. The antibody fragments of VH, VL, CH and CL were amplified according to the standard operating procedure of RACE of GenScript.
[0411] Amplified antibody fragments were separately cloned into a standard cloning vector using standard molecular cloning procedures.
[0412] Colony PCR screening was performed to identify clones with inserts of correct sizes. No less than five single colonies with inserts of correct sizes were sequenced for each antibody fragment.
[0413] V.sub.H and V.sub.L plasmids encoded the full-length variable regions of the antibody and a part of C.sub.H1 and C.sub.L. C.sub.H plasmid encoded a part of C.sub.H1 and full-length C.sub.H2 and C.sub.H3. C.sub.L plasmid encoded a part of C.sub.L. In order to get full-length constant regions or heavy/light chain, the part of constant regions encoded by V.sub.H and V.sub.L plasmids and the part of constant regions encoded by C.sub.H and C.sub.L plasmids were amplified by PCR separately, and then overlap extension PCR was employed to obtain full-length DNAs. Five single colonies with correct V.sub.H, V.sub.L, C.sub.H and C.sub.L insert sizes were sent for sequencing.
[0414] Sequencing run 449295-5 (Alfio II) encountered difficulty obtaining sequence corresponding to the expected IgG1 heavy chain sequence. Two RNA preparations were performed. For the 1st batch of cells, oligo-dT primer and CDS III primers were used for reverse transcription (RT). VH/CH and VK/CK were amplified by PCR using IgG1 and IgK specific primers, partial mouse -actin gene was amplified as positive control. Normal light chain bands were obtained easily while only weak VII could be observed on the gel. Five individual colonies with correct VK and CK insert sizes were sent for sequencing. The VK and CK genes of five different clones were found to be nearly identical. The consensus light chain sequences from the Alfio II hybridoma is listed below. One unproductive heavy chain sequence was obtained from eight randomly sequenced VH positive clones, shown as below. Three kinds of heavy chain constant region sequences were obtained from ten randomly sequenced CH positive clones (one IgG.sub.1CH, one IgG.sub.2aCH and eight IgG.sub.2bC.sub.H). In order to avoid the influence of potential class switching, amplification of the C.sub.H using IgM specific primer was performed, but no target PCR product was obtained. There was also no target PCR product when full-length heavy chain (V.sub.H-C.sub.H) was amplified using heavy chain FR1 degenerate primers.
[0415] As no productive heavy chain could be obtained after several attempts, isolation of heavy chain sequence from the 2nd vial of Alfio II cells was attempted. For the 2nd vial of cells, oligo-dT primer was used for reverse transcription initially. V.sub.H was amplified using IgG1, IgG2b, IgM, IgA specific primers and IgG degenerate primer, respectively, and VK was amplified using IgK specific primers. Productive light chain and unproductive heavy chain, which were identical with previous results, were obtained. Reverse transcription using Random 6 mers primer was also attempted without success.
[0416] In summary, multiple attempts to isolate light chain and heavy chain sequence were made. One rearranged light chain sequence was consistently obtained after different attempts on two batches of cells. However, only weak VH target PCR products were observed and sequencing did not result in any consistent heavy chain sequence.
Results
[0417] Sequencing (DNA)
[0418] The isolated total RNA of the sample was run alongside a DNA marker (Marker IIITIANGEN, Cat. No.: MD103) on a 1.5% agarose/GelRed gel.
[0419] Four microliters of PCR products of each sample were run alongside the DNA marker (Marker III) on a 1.5% agarose/GelRed gel. The PCR products were purified and stored at 20 C. until further use.
[0420] The V.sub.H, V.sub.L, C.sub.H and C.sub.L genes of five different clones were nearly identical. The consensus sequence (SEQ ID NO: 1AM4 MIL-38 Mouse IgG.sub.1 Heavy Chain DNA Consensus Sequence; SEQ ID NO: 2AM4 MIL-38 Mouse Kappa light Chain DNA Consensus Sequence) was determined to be the sequence of the antibody produced by the monoclonal hybridoma population (AM-4).
[0421] The heavy and light chain AM4 MIL-38 consensus DNA sequences above translate to the AM4 heavy chain amino acid sequence (SEQ ID NO: 3AM4 MIL-38 Mouse IgG1 Heavy Chain Amino Acid Consensus Sequence) and the AM4 light chain amino acid sequence (SEQ ID NO: 4AM4 consensus MIL-38 Light Chain Amino Acid Consensus Sequence).
AM3 Consensus Sequences
[0422] No consistent heavy chain sequence could be obtained from the AM3-like Alfio II cells. The light chain sequence obtained from sequencing run 449295-5 (Alfio II) was consistently obtained and showed clear differences in both the framework regions and the complementarity-determining regions compared to the sequence for the other two sequencing runs.
TABLE-US-00016 AM3MIL-38KappaLightChainDNAConsensus Sequence (SEQIDNO:10) ATGGGCATCAAGATGGAGTCACAGACTCAGGTCTTTGTATACATGTTG CTGTGGTTGTCTGGTGTTGATGGAGACATTGTGATGACCCAGTCTCAA AAGTTCATGTCCACATCAATAGGAGACAGGGTCAGCGTCACCTGCAAG GCCAGTCAGAATGTGGGTTCTCATGTAGCCGGTTTCAGCAGAAACCAG GGCAATCTCCTAAAGCACTGATTTACTCGGCATCCTACCGGTACAGCG GAGTCACTGATCGCTTCACAGGCAGTGGATCTGGGACAGATTTCACTC TCACCATCAACAATGTGCAGTCTGAAGACTTGGCAGAGTATTTCTGTC AGCAATATAACAGTTTTCCATTCACGTTCGGTTCGGGGACAAAGTTGG AAATAAAACGGGCTGATGCTGCACCAACTGTATCCATCTTCCCACCAT CCAGTGAGCAGTTAACATCTGGAGGTGCCTCAGTCGTGTGCTTCTTGA ACAACTTCTACCCCAAAGACATCAATGTCAAGTGGAAGATTGATGGCA GTGAACGACAAAATGGCGTCCTGAACAGTTGGACTGATCAGGACAGCA AAGACAGCACCTACAGCATGAGCAGCACCCTCACGTTGACCAAGGACG AGTATGAACGACATAACAGCTATACCTGTGAGGCCACTCACAAGACAT CAACTTCACCCATTGTCAAGAGCTTCAACAGGAATGAGTGTTAG *Individualregionsoflightchainencoded sequencearehighlightedwithalternating italics.Positions:1-72= leadersequence;73- 141= frameworkregion(LFR1);142-174= complementaritydeterminingregion(LCDR1);175- 219= LFR2;220-240= LCDR2;241-336= LFR3; 337-363= LCDR3;364-393= LFR4;394-714= constantregion(CK);715-717= stopcodon AM3MIL-38LightChainAminoAcidConsensus Sequence (SEQIDNO:11) MGIKMESQTQVFVYMLLWLSGVDGDIVMTQSQKFMSTSIGDRVSVTCK ASQNVGSHVAWFQQKPGQSPKALIYSASYRYSGVTDRFTGSGSGTDFT LTINNVQSEDLAEYFCQQYNSFPFTFGSGTKLEIKRADAAPTVSIFPP SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDS KDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC* Individualregionsoflightchainaminoacid sequenceareindicatedwithalternatingitalics aslabelled:Positions1-24= Leadersequence; 25-47= frameworkregion(LFR1);48-58= complementaritydeterminingregion1(LCDR1); 59-73= LFR2;74-80= LCDR2;81-112= LFR3;113-121= LCDR3;122-131= LFR4;132-238= kappaconstantregion(CK)&stopcodon(*)
[0423] Unless defined otherwise, all technical and scientific terms herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials, similar or equivalent to those described herein, can be used in the practice or testing of the present invention, the preferred methods and materials are described herein. All publications, patents, and patent publications cited are incorporated by reference herein in their entirety for all purposes.
[0424] The publications discussed herein are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the present invention is not entitled to antedate such publication by virtue of prior invention.
[0425] While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure as come within known or customary practice within the art to which the invention pertains and as may be applied to the essential features hereinbefore set forth and as follows in the scope of the appended claims.