DISCOVERY OF ENZYMES FROM THE ALPHA-KETO ACID DECARBOXYLASE FAMILY
20190010480 ยท 2019-01-10
Assignee
Inventors
- Justin Siegel (Davis, CA)
- Steve Bertolani (Citrus Heights, CA)
- Wai Shun Mak (Sacramento, CA)
- James Liao (Los Angeles, CA)
- Stephen Tran (La Canada, CA)
- Ryan Marcheschi (Rockville, MD)
- James Thompson (Seattle, WA)
- David Baker (Seattle, WA)
Cpc classification
C07K2319/70
CHEMISTRY; METALLURGY
International classification
Abstract
2-ketoacid decarboxylase enzymes, compositions encoding for 2 ketoacid decarboxylase enzymes, and host cells comprising such enzymes or compositions are provided
Claims
1. An expression cassette comprising a heterologous promoter operably linked to a nucleic acid encoding an enzyme comprising 2-ketoacid decarboxylase activity, wherein the enzyme: comprises a 3-layer alpha-beta-alpha sandwich; comprises a thiamine pyrophosphate (TPP) binding pocket; has a TM align score of at least 0.5 as compared against PDB ID:2VBG; and comprises at least a 100-fold greater catalytic efficiency for C8 2-ketoacid substrates as compared to C3 or isoC5 2-ketoacid substrates, wherein the catalytic efficiency is measured by kcat/Km.
2. The expression cassette of claim 1, wherein the enzyme comprising 2-ketoacid decarboxylase activity has a TM align score of at least 0.7 as compared against PDB ID:2VBG.
3. The expression cassette of claim 1, wherein the substrate binding pocket of the enzyme has a solvent accessible surface area of at least about 7500 .sup.2.
4. The expression cassette of claim 1, wherein the enzyme comprising 2-ketoacid decarboxylase activity comprises an amino acid sequence that is at least 14% identical to SEQ ID NO:1.
5. The expression cassette of claim 1, wherein the enzyme comprising 2-ketoacid decarboxylase activity comprises an amino acid sequence that contains a mutation of a native sequence wherein the mutation is in an amino acid residue having a C within 8 of a 2-ketoacid decarboxylase active site; wherein the 2-ketoacid decarboxylase active site comprises the amino acids corresponding to amino acid positions 23-27, 50, 51, 56, 75, 76, 79, 82, 113, 114, 287, 352, 373-377, 379, 394, 396-399, 424-428, 430, 450-458, 461, and 532 of PDB ID:2VBG.
6. The expression cassette of claim 1, wherein the enzyme comprising 2-ketoacid decarboxylase activity comprises an amino acid sequence that contains a mutation of a native sequence wherein the mutation is in an amino acid residue within 8 of a 2-ketoacid decarboxylase active site, wherein the 2-ketoacid decarboxylase active site comprises the amino acids corresponding to amino acid positions 23-27, 50, 51, 56, 71, 75, 76, 79, 82, 112, 114, 287, 356, 373-377, 379, 394, 396-399, 423-428, 430, 450-458, 461, and 535 of SEQ ID NO:1.
7. The expression cassette of claim 1, wherein the enzyme comprising 2-ketoacid decarboxylase activity comprises an amino acid sequence that is at least 90% or 99% identical to SEQ ID NO:1.
8. The expression cassette of claim 7, wherein the enzyme comprising 2-ketoacid decarboxylase activity comprises an amino acid sequence that contains a mutation in an amino acid residue corresponding to a residue selected from the group consisting of 6402, M538, and F542 of SEQ ID NO:1.
9. The expression cassette of claim 8, wherein the mutation in an amino acid residue corresponding to a residue selected from the group consisting of 6402, M538, and F542 of SEQ ID NO:1 is to a residue selected from the group consisting of Val, Leu, Ile, Met, Phe, His, Gly, Ala, Thr, Tyr, and Trp.
10. The expression cassette of claim 8, wherein the mutation corresponds to a mutation selected from the group consisting of G402V, M538L, and F542V of SEQ ID NO:1.
11. The expression cassette of claim 7, wherein the enzyme comprising 2-ketoacid decarboxylase activity comprises two mutations in amino acid residues corresponding to residues selected from the group consisting of G402, M538, and F542 of SEQ ID NO:1.
12. The expression cassette of claim 7, wherein the enzyme comprising 2-ketoacid decarboxylase activity comprises mutations corresponding to G402V, M538L, and F542V of SEQ ID NO:1.
13. The expression cassette of claim 1, wherein the enzyme comprising 2-ketoacid decarboxylase activity comprises an amino acid sequence at least 90% or 99% identical, or identical, to SEQ ID NO:2.
14. The expression cassette of claim 13, wherein the enzyme comprising 2-ketoacid decarboxylase activity comprises an amino acid sequence that contains a mutation, wherein the mutation is in an amino acid residue of SEQ ID NO:2 having a C within 8 of a 2-ketoacid decarboxylase active site, wherein the 2-ketoacid decarboxylase active site comprises the amino acids corresponding to amino acid positions 23-27, 48, 49, 54, 71, 74, 75, 78, 81, 112; 113, 286, 356, 376-380, 382, 399, 401-404, 427-432, 434, 454-462, 465, and 535 of SEQ ID NO:2.
15. The expression cassette of claim 1, wherein the enzyme comprising 2-ketoacid decarboxylase activity interacts with a C8 2-ketoacid substrate with a calculated interaction energy of less than 10.4 rosetta energy units.
16. A modified enzyme comprising 2-ketoacid decarboxylase activity, wherein the enzyme comprises: a 3-layer alpha-beta-alpha sandwich; thiamine pyrophosphate; and at least a 100-fold greater catalytic efficiency for C8 2-ketoacid substrates as compared to C3 or isoC5 2-ketoacid substrates, wherein the catalytic efficiency is measured by kcat/Km, wherein the modification comprises a mutation in the primary amino acid sequence of SEQ ID NO:1 or SEQ ID NO:2.
17. The modified enzyme of claim 16, wherein the enzyme has a TM align score against PDB ID:2VBG of at least 0.5.
18. The modified enzyme of claim 16, wherein the enzyme has a Ca root mean squared deviation of less than 1 over at least 100 structurally aligned residues as compared against PDB ID:2VBG.
19. The modified enzyme of claim 16, wherein the modification comprises a mutation in an amino acid residue, wherein the amino acid residue is within 8 of a 2-ketoacid decarboxylase active site, wherein the 2-ketoacid decarboxylase active site comprises the amino acids corresponding to amino acid positions 23-27, 50, 51, 56, 71, 75, 76, 79, 82, 112, 114, 287, 356, 373-377, 379, 394, 396-399, 423-428, 430, 450-458, 461, and 535 of SEQ ID NO:1.
20. The modified enzyme of claim 16, wherein the modification comprises a mutation in an amino acid residue corresponding to a residue selected from the group consisting of G402, M538, and F542 of SEQ ID NO:1.
21. The modified enzyme of claim 20, wherein the mutation in an amino acid residue corresponding to a residue selected from the group consisting of G402, M538, and F542 of SEQ ID NO:1, and wherein the mutation is to a residue selected from the group consisting of Val, Leu, Ile, Met, Phe, His, Gly, Ala, Thr, Tyr, and Trp.
22. The modified enzyme of claim 20, wherein the modification comprises two mutations in amino acid residues corresponding to residues selected from the group consisting of G402, M538, and F542 of SEQ ID NO:1.
23. The modified enzyme of claim 22, wherein the modification comprises one or two mutations corresponding to the mutations selected from the group consisting of G402V, M538L, and F542V of SEQ. ID NO:1.
24. The modified enzyme of claim 23, wherein the modification comprises mutations corresponding to G402V, M538L, and F542V of SEQ ID NO:1.
25. The modified enzyme of claim 16, wherein the ratio of kcal/Km against C8 2-ketoacid substrates over the heat/Km against isoC5 2-ketoacid substrates is at least 50-fold greater than the native enzyme.
26. The modified enzyme of claim 16, wherein the solvent accessible surface area of the substrate binding pocket is at least about 7500 .sup.2.
27. A host cell comprising the expression cassette of claim 1, or the modified enzyme of claim 16, wherein the host cell produces long chain (C5) alcohols at a concentration of at least 500 mg/L.
28. The host cell of claim 27, wherein the host cell produces heptanol as the major alcohol product.
29. The host cell of claim 27, wherein the host cell produces octanol.
30. The host cell of claim 27, wherein the host cell does not produce ethanol or propanol.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0023]
[0024]
[0025]
[0026]
where the log scaled catalytic efficiencies for C8 relative to C5 and C3 are compared. The three active GEOs and the naively selected set of decarboxylases are represented as dots and diamonds, respectively. Native KIVD and KIVD_VLV are depicted as a square and triangle, respectively. The genomic mining method and computational active site redesign approach both produced enzymes with enhanced specificity relative to native KIVD.
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
DEFINITIONS
[0047] As used in this specification and the appended claims, the singular forms a, an, and the include plural reference unless the context clearly dictates otherwise.
[0048] The term nucleic acid or polynucleotide refers to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof in either single- or double-stranded form. Unless specifically limited, the term encompasses nucleic acids containing known analogues of natural nucleotides that have similar binding properties as the reference nucleic acid and are metabolized in a manner similar to naturally occurring nucleotides. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), alleles, orthologs, SNPs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)). The term nucleic acid is used interchangeably with gene, cDNA, and mRNA encoded by a gene.
[0049] The term gene means the segment of DNA involved in producing a polypeptide chain. It may include regions preceding and following the coding region (leader and trailer) as well as intervening sequences (introns) between individual coding segments (exons).
[0050] A promoter is defined as an array of nucleic acid control sequences that direct transcription of a nucleic acid. As used herein, a promoter includes necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerase II type promoter, a TATA element. A promoter also optionally includes distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription.
[0051] An expression cassette is a nucleic acid construct, generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular polynucleotide sequence in a host cell. An expression cassette may be part of a plasmid, viral genome, or nucleic acid fragment. Typically, an expression cassette includes a polynucleotide to be transcribed, operably linked to a promoter. In some cases, the promoter is heterologous to the polynucleotide to be transcribed. In some cases, the expression cassette is heterologous to the host cell in which it resides.
[0052] The term amino acid refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, -carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds having a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
[0053] There are various known methods in the art that permit the incorporation of an unnatural amino acid derivative or analog into a polypeptide chain in a site-specific manner, see, e.g., WO 02/086075.
[0054] Amino acids may be referred to herein by either the commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
[0055] Polypeptide, peptide, and protein are used interchangeably herein to refer to a polymer of amino acid residues. All three terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. As used herein, the terms encompass amino acid chains of any length, including full-length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
[0056] The term heterologous as used in the context of describing the relative location of two elements, refers to the two elements such as nucleic acids (e.g., promoter and protein encoding sequence), a nucleic acid and a host cell, a protein (e.g., a 2-ketoacid decarboxylase, or portion thereof) and a host cell or reaction mixture, or a protein and a ligand that are not naturally found in the same relative positions. Thus, a heterologous promoter of a gene refers to a promoter that is not naturally operably linked to that gene. Similarly a host cell containing a heterologous expression cassette can refer to an expression cassette that is not naturally found in that host cell.
[0057] A 3-layer alpha-beta-alpha sandwich refers to the 3-layer (aba) Sandwich architecture according to the CATH classification (version 4.0.0). Proteins containing such architecture have a Rossmann fold topology. For enzymes that have not been characterized by X-ray crystallography, NMR spectroscopy, or other experimental means, the presence or absence of a 2-layer alpha beta alpha sandwich can be assessed by homology modeling. Exemplary methods of homology modeling can include the use of one or more of the following programs, program codes, scripts, and/or parameters, e.g. in their default settings: RosettaCM, SWISS-MODEL, MODELLER, 3D-JIGSAW, ModPipe, Fugue, HHPred, i-Tasser, IntFOLD, M4T, ModWeb, Phyre2, RaptorX, Robetta, HHsuite, and the like, such as derivative works thereof.
[0058] A thiamine pyrophosphate (TPP) binding pocket refers to a binding pocket of a enzyme that productively binds TPP, such that the TPP bound by the enzyme can perform a ketoacid decarboxylation reaction. The presence of a TPP binding pocket can be detected by detecting bound TPP, or a radical intermediate thereof (e.g., via mass spectrometry, electron paramagnetic resonance (EPR) spectroscopy, or the like). The presence of a TPP binding pocket can also be inferred on the basis of detection of TPP mediated catalysis by the enzyme. In some cases, the presence of a TPP binding pocket can be determined from an experimentally determined structure of the enzyme (e.g., determined by X-ray crystallography). In some cases, the presence of a TPP binding pocket can be determined by homology modeling using any of the homology modeling methods described herein. In some cases, the presence of a TPP binding pocket can be inferred from the presence of sequence data indicative of a TPP binding domain. For example, a comparison of a candidate sequence to the Pfam database (e.g., Pfam 28.0) can reveal the presence or absence of a TPP binding pocket.
[0059] A TM align score refers to a normalized structural similarity score comparing two 3-dimensional protein structures (e.g., experimentally determined or homology model structures) calculated by version 2012/05/07 of the TM-align algorithm (TMalign.f). See, Y. Zhang & J. Skolnick, Nucleic Acids Research, 33: 2302-2309 (2005); Y. Zhang & J. Skolnick, Proteins, 57: 702-710 (2004); and J. Xu & Y. Zhang, Bioinformatics, 26, 889-895 (2010). Where one or both structures contain multiple chains of substantially the same structure (e.g., due to non-crystallographic symmetry or due to the availability of an ensemble of homology models), the TM align score refers to the lowest score between the one or more chains of a first structure and the one or more chains of a second structure.
[0060] Solvent accessible surface area or SASA in reference to a substrate binding pocket of an enzyme described or claimed herein refers to a SASA calculated using RosettaScripts with Rosetta version c2bf8f674e7b416b5b756630d7ccd5d64c57512c 2015-05-04 14:47:46-0700 from git@github.com:RosettaCommons/main.git. The SASA can be calculated from a structure file (PDB) with a bound ligand. The structure file can be an experimentally determined structure or a structure determined by any one or more of the homology modeling methods described herein.
[0061] As used herein, 2-ketoacid active site, in the context of the claims can refer to amino acid residues corresponding to amino acid positions: (i) 23-27, 50, 51, 56, 75, 76, 79, 82, 114, 287, 373-377, 379, 394, 396-399, 423-428, 430, 450-458, and 461 of SEQ ID NO:1; (ii) 23-27, 50, 51, 56, 72, 75, 76, 79, 82, 113, 114, 287, 352, 373-377, 379, 394, 396-399, 423-428, 430, 450-458, 461, and 532 of SEQ ID NO:1; (iii) 23-27, 48, 49, 54, 74, 75, 78, 81, 113, 286, 376-380, 382, 399, 401-404, 427-432, 434, 454-462, and 465 of SEQ ID NO:2; (iv) 23-27, 48, 49, 54, 71, 74, 75, 78, 81, 112, 113, 286, 356, 376-380, 382, 399, 401-404, 427-432, 434, 454-462, 465, and 535 of SEQ ID NO:2; or (v) 22-29, 32, 43, 46-50, 54, 69-79, 81, 82, 111-113, 240, 285-287, 290, 356, 360, 376-383, 398-407, 426-435, 453-466, 472, 473, 475, 477, 526-528, and 530-535 of SEQ ID NO:2.
[0062] Amino acid positions corresponding to any one or more of the foregoing residues can be determined by structural alignment to a template structure (e.g., a structure of SEQ ID NO:1 or 2). One or both structures used in the structural alignment can be experimentally determined or determined by homology modeling using any one or more of the homology modelling methods described herein. Exemplary structural alignment methods and/or programs include, but are not limited to, TM-align, LSQMAN, Fr-TM-align, DALI, DaliLite, CE, CE-MC, and the like. Additional structural alignment tools useful in determining active site amino acids include, but are not limited to, those described in web.archive.org/web/20151221055428/https://en.wikipedia.org/wiki/Structural alignment software.
[0063] As used herein, rosetta energy units in the context of ligand binding interaction energy refers to an interaction energy between a bound ligand and a protein calculated using Rosetta Enzyme Design style constraints. Program code for calculating rosetta energy units is provided herein.
DETAILED DESCRIPTION OF THE INVENTION
I. Introduction
[0064] In the current synthetic recursive+1 pathway, the enzymes LeuA, LeuB, LeuC, and LeuD (collectively known as LeuABCD) are recruited to recursively elongate 2-ketobutyrate into longer chain 2-ketoacids..sup.3,4 These 2-ketoacids are then converted to aldehydes by ketoisovalerate decarboxylase.sup.6 (KIVD) and subsequently to alcohols by alcohol dehydrogenase.sup.3 (ADH). (Figure. 1) In this engineered pathway, the primary determinant for the final product chain length is the number of cycles through LeuABCD..sup.7 (
[0065] Previous efforts to engineer the product specificity of this pathway have focused on broadening the specificity of LeuA and KIVD. When the specificity of LeuA and KIVD are broadened, branched C.sub.8 products are produced..sup.3 When only the specificity of LeuA is broadened, additional cycles through the pathway are carried out, resulting in a mixture of C.sub.2-C.sub.8 linear alcohols;.sup.4 however, the primary product is still 1-butanol. In order to enhance long chain alcohol production, the inventors have focused on discovering a ketoacid decarboxylase specific for long chain ketoacids. By replacing KIVD with an enzyme specific for long chain ketoacids, the short chain substrates are able to reenter the +1 iteration cycle until conversion to long chain ketoacids, which are then decarboxylated and reduced into the corresponding long chain alcohols.
II. Methods
[0066] Provided herein are methods of identifying 2-ketoacid decarboxylase enzymes having an altered specificity, or having a desired endogenous specificity. In some cases, the 2-ketoacid decarboxylases have or are altered to have improved specificity for or catalytic efficiency against long chain (C5) ketoacids and/or provide or are altered to provide an increased amount or concentration of long chain (C5) alcohols when present in a synthetic recursive+1 pathway in a host cell or reaction mixture, e.g., as compared to SEQ ID NO:1.
[0067] The methods can include mining known protein sequences to identify enzymes having homology to a known 2-ketoacid decarboxylase template, at least a subset of which can be predicted to have a desired endogenous specificity or can be predicted to be able to be redesigned to have an altered specificity. Protein sequences having homology to a template enzyme sequence (e.g., SEQ ID NO:1) can, e.g., be identified using a hidden markov model algorithm such as that implemented in HMMER3 or using a BLAST-type sequence similarity search. Sequences can be filtered by removing sequences that are highly similar in sequence, e.g., using CD-HIT. Exemplary cut-offs for highly similar sequences can include a cut-off which removes sequences having at least about 50%, 60%, 70%, 80%, 90%, 95%, or 99% identity to the template sequence.
[0068] Structural features of sequences identified as having sequence homology to the template sequence can then be assessed. For example, a homology model of candidate hits can be generated, e.g., using RosettaCM, SWISS-MODEL, MODELLER, 3D-JIGSAW, ModPipe, Fugue, HHPred, i-Tasser, IntFOLD, M4T, ModWeb, Phyre2, RaptorX, Robetta, HHsuite, and the like. Homology models so generated can be scored for three dimensional structural similarity to the structure of the template sequence. For example, a structural alignment program or methods as described herein, including but not limited to one or more of TM align, the DALI server (e.g., DaliLite v. 3 available at ekhidna.biocenter.helsinki.fi/dali_server), or the cealign algorithm implemented in PyMOL (e.g., version 1.7.6 available at www.pymol.org) can be used to assess structural similarity by calculating a TM align score, Z-score, or an RMSD value respectively.
[0069] In some embodiments, a TM align score is used to assess structural similarity. For example, a TM align score cut-off of at least about 0.5 to a known 2-ketoacid decarboxylase (e.g., SEQ ID NO:1, SEQ ID NO:2 or any other 2-ketoacid decarboxylases described herein) can be used to filter out candidate 2-ketoacid decarboxylases from homology models of the initial sequence search results or from homology models of the sequence search results after removing highly similar sequences. Alternatively, a more stringent cut-off can be applied. For example, a TM align score of at least about 0.55, 0.6, 0.65, 0.7, 0.75, 0.8, 0.81, 0.815, 0.817, 0.85, or 0.9 can be utilized.
[0070] In some embodiments, an RMSD value as calculated by, e.g., cealign or other similar methods or programs can be utilized to assess structural similarity and filter out candidate 2-ketoacid decarboxylases from homology models of the initial sequence search results or from homology models of the sequence search results after removing highly similar sequences. In exemplary embodiments, RMSD cutoffs calculated as described herein of less than about 6.7 , 6 , 5.5 , 5 , 4 , or 3.5 can be used to filter out candidate 2-ketoacid decarboxylases from homology models of the initial sequence search results or from homology models of the sequence search results after removing highly similar sequences. Alternatively, a more stringent cut-off can be applied. For example, an RMSD value of less than about 3 , 2.5 , 2 , or 1.6 can be utilized.
[0071] In some embodiments, a Z-score calculated by the DALI server is used to assess structural similarity. For example, a Z-score cut-off of at least about 2 to a known 2-ketoacid decarboxylase (e.g., SEQ ID NO:1, SEQ ID NO:2 or any other 2-ketoacid decarboxylases described herein) can be used to filter out candidate 2-ketoacid decarboxylases from homology models of the initial sequence search results or from homology models of the sequence search results after removing highly similar sequences. Alternatively, a more stringent cut-off can be applied. For example, a Z-score of at least about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, or 62 can be utilized.
[0072] The homology models (e.g., after removing models that lack significant structural similarity as assessed by, e.g., TM align score, Z-score, and/or RMSD) can be assessed to identify sequences that bind a preferred substrate. For example, a covalent intermediate of a 2-ketoacid decarboxylase reaction can be modeled in the active site of the generated homology models, the complex can be relaxed computationally, e.g., using Rosetta Enzyme Design, and a ligand binding energy calculated. Candidate sequences having a low ligand binding energy can be selected for in vitro and/or in vivo analysis or selected as a preferred enzyme for catalyzing decarboxylation of a substrate to produce a product that corresponds to the modeled catalytic intermediate ligand. In some embodiments, candidate sequences having a ligand binding energy of less than, or less than about, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, 10, 10.3, 10.4, 10.5, 10.6, 10.7, 10.8, 10.9, 11, 11.5, 12, 12.5, 13, 13.5, 14, 14.5, 15, 15.5, 16, 16.5, 17, 17.5, 18, 18.5, 19, 19.5, or 20 Rosetta energy units can be selected for in vitro and/or in vivo analysis or selected as a preferred enzyme for catalyzing decarboxylation of a substrate to produce a product that corresponds to the modeled catalytic intermediate ligand.
[0073] Methods of identifying 2-ketoacid decarboxylase enzymes having a desired altered specificity (e.g., greater catalytic efficiency against long chain (C.sub.5) ketoacids) can additionally or alternatively include reprogramming substrate specificity of a known 2-ketoacid decarboxylase (e.g., SEQ ID NO:1 or any of the GEOs described herein) using computation enzyme design methods. For example, the Rosetta Molecular Modeling Suite, or another computational design platform, can be used to design such enzymes. For example, experimentally determined structures and/or homology models of known or suspected 2-ketoacid decarboxylases can be used to explore potential active-site sequence space that would accommodate long chain (C5) 2-ketoacids, e.g., 2-ketooctanoate as substrates. In some embodiments, a modeled reaction intermediate of, e.g., a C8 substrate, is docked within a predicted active site of an experimentally determined structure or homology model structure, the complex optionally minimized, and a ligand binding energy calculated. In some embodiments, ligand binding energies are sampled among a number of computationally generated enzyme mutations or ensemble conformations by allowing the identity and conformation of non-catalytic residues within the active site to change, and/or allowing backbone distances and/or angles to move during minimization.
[0074] Candidate 2-ketoacid decarboxylases can be cloned into an expression cassette, e.g., under the control of a promoter such as a heterologous promoter, expressed and assayed for activity. For example 2-ketoacid decarboxylase enzymes identified by one or more of sequence mining, homology modeling, structural similarity scoring, and ligand binding analysis can be assayed for activity against one or more 2-ketoacid substrates. As another example, 2-ketoacid decarboxylase enzymes identified by virtual screening of mutants of a known 2-ketoacid decarboxylase can be assayed for activity against one or more 2-ketoacid substrates.
II. Compositions
[0075] Described herein are 2-ketoacid decarboxylases, expression cassettes encoding such 2-ketoacid decarboxylases, and host-cells and/or reaction mixtures containing such 2-ketoacid decarboxylases or expression cassettes. In some embodiments, the expression cassette is heterologous to the host cell or reaction mixture in which it resides. In some embodiments, the expression cassette contains a heterologous promoter operably linked to a polynucleotide encoding a 2-ketoacid decarboxylase. The expression cassette can, e.g., comprise a heterologous promoter operably linked to a nucleic acid encoding an enzyme comprising 2-ketoacid decarboxylase activity, wherein the enzyme: comprises a 3-layer alpha-beta-alpha sandwich; comprises a thiamine pyrophosphate (TPP) binding pocket; has a TM align score of at least 0.5 as compared against PDB ID:2VBG; and comprises at least a 100-fold greater catalytic efficiency for C8 2-ketoacid substrates as compared to C3 or isoC5 2-ketoacid substrates, wherein the catalytic efficiency is measured by kcat/Km.
[0076] In some cases, the enzyme comprising 2-ketoacid decarboxylase activity comprises an amino acid sequence that is at least 10%, 12%, 14%, 15%, 20%, 25%, 30%, 35%, 40%, 50%, 60%, 70%, 80%, 90% or 99% identical to SEQ ID NO:1. Sequence identity can be determined using methods known in the art. For example, using BLAST, HMMER3, or the like, e.g., using the default settings.
[0077] In some cases, the enzyme comprising 2-ketoacid decarboxylase activity has a TM align score of at least 0.4, 0.45, 0.5, 0.55, 0.6, 0.65, 0.7, 0.75, 0.8, 0.81, 0.815, 0.817, 0.85, or 0.9; a Z-score of or of at least about 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, or 62; or an RMSD of or of less than about 6.7 , 6 , 5.5 , 5 , 4 , 3.5 3 , 2.5 , 2 , or 1.6 as compared against PDB ID:2VBG. In some cases, the substrate binding pocket of the enzyme has a solvent accessible surface area of, or of at least about 7,500; 8,000; 8,500; 9,000; 9,500; or 10,000 .sup.2.
[0078] In some cases, the enzyme comprising 2-ketoacid decarboxylase activity comprises an amino acid sequence that contains a mutation of a native sequence wherein the mutation is in an amino acid residue with a Ca within 8 of a 2-ketoacid decarboxylase active site, wherein the 2-ketoacid decarboxylase active site comprises the amino acids corresponding to one or more of (e.g., corresponding to 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13,14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, or 46 of) the following amino acid positions: (i) 23-27, 50, 51, 56, 75, 76, 79, 82, 114, 287, 373-377, 379, 394, 396-399, 423-428, 430, 450-458, and 461 of SEQ ID NO:1; (ii) 23-27, 50, 51, 56, 72, 75, 76, 79, 82, 113, 114, 287, 352, 373-377, 379, 394, 396-399, 423-428, 430, 450-458, 461, and 532 of SEQ ID NO:1; (iii) 23-27, 48, 49, 54, 74, 75, 78, 81, 113, 286, 376-380, 382, 399, 401-404, 427-432, 434, 454-462, and 465 of SEQ ID NO:2; (iv) 23-27, 48, 49, 54, 71, 74, 75, 78, 81, 112, 113, 286, 356, 376-380, 382, 399, 401-404, 427-432, 434, 454-462, 465, and 535 of SEQ ID NO:2; or (v) 22-29, 32, 43, 46-50, 54, 69-79, 81, 82, 111-113, 240, 285-287, 290, 356, 360, 376-383, 398-407, 426-435, 453-466, 472, 473, 475, 477, 526-528, and 530-535.
[0079] Amino acid positions corresponding to any one or more of the foregoing residues can be determined by structural alignment to a template structure (e.g., a structure of SEQ ID NO:1 or 2). One or both structures used in the structural alignment can be experimentally determined or determined by homology modeling using any one or more of the homology modelling methods described herein. Exemplary structural alignment methods and/or programs include, but are not limited to, TM-align, LSQMAN, Fr-TM-align, DALI, DaliLite, CE, CE-MC, and the like. Additional structural alignment tools useful in determining active site amino acids include, but are not limited to, those described in en.wikipedia.org/wiki/Structural alignment software.
[0080] In some embodiments, the enzyme comprising 2-ketoacid decarboxylase activity comprises an amino acid sequence that contains a mutation in an amino acid residue corresponding to a residue selected from the group consisting of G402, M538, and F542 of SEQ ID NO:1. In some embodiments, the mutation in an amino acid residue corresponding to a residue selected from the group consisting of G402, M538, and F542 of SEQ ID NO:1, and wherein the mutation is to a residue selected from the group consisting of Val, Leu, Ile, Met, Phe, His, Gly, Ala, Thr, Tyr, and Trp. In some embodiments, the mutation in an amino acid residue corresponding to a mutation selected from the group consisting of G402V, M538L, and F542V of SEQ ID NO:1. In some embodiments, the enzyme comprising 2-ketoacid decarboxylase activity comprises two or three mutations in amino acid residues corresponding to residues selected from the group consisting of G402, M538, and F542 of SEQ ID NO:1. In some cases, the enzyme comprising 2-ketoacid decarboxylase activity comprises one, two, or three of the mutations corresponding to G402V, M538L, and F542V of SEQ ID NO:1.
[0081] In some embodiments, the enzyme comprising 2-ketoacid decarboxylase activity comprises SEQ ID NO:2 or SEQ ID NO:3. In some embodiments, the enzyme is, or is at least about, 80%, 90% or 99% identical to SEQ ID NO:2 or 3. In some embodiments, the enzyme comprises 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more insertions, substitutions, or deletions, relative to SEQ ID NO:1, 2 or 3, or relative to any of the GEOs described herein. In some cases, the insertion, substitution, or deletion is independently an insertion, substitution, or deletion of 1, 2, 3, or 4 amino acids at a given amino acid position.
[0082] In some embodiments, the enzyme comprising 2-ketoacid decarboxylase activity interacts with a C8 2-ketoacid substrate with a calculated interaction energy of less than, or less than about, 10, 10.3, 10.4, 10.5, 10.6, 10.7, 10.8, 10.9, 11, 11.5, 12, 12.5, 13, 13.5, 14, 14.5, 15, 15.5, 16, 16.5, 17, 17.5, 18, 18.5, 19, 19.5, or 20 Rosetta energy units.
[0083] All patents, patent applications, and other publications, including GenBank Accession Numbers, cited in this application are incorporated by reference in the entirety for all purposes.
EXAMPLES
[0084] The following examples are provided by way of illustration only and not by way of limitation. Those of skill in the art will readily recognize a variety of non-critical parameters that could be changed or modified to yield essentially the same or similar results.
Example 1
[0085] Introduction
[0086] To rationally engineer the product profile of the synthetic recursive+1 pathway two computationally directed approaches were employed to discover a decarboxylase with the desired functional profile. The first is a new approach to mine the rapidly growing sequence databases derived from genomic sequencing. Since the vast majority of these proteins are derived from the genomic sequencing of organisms (i.e., genomic enzyme orthologs: GEOs), most of them have not been experimentally characterized and neither function nor specificity is known. Previous efforts to mine GEOs for function have relied on random sampling or sequence-based bioinformatics over an entire enzyme family..sup.8,9,10 While enzymes with a desired function have been found using these methods, it requires a large number of genes to be produced and experimentally characterized. To enable a more efficient sampling method, a novel computational pipeline was developed that integrates the use of bioinformatics and molecular modeling to carry out forward predictions of a GEO's ability to carry out a function of interest. Using this integrative genomic mining approach a highly diverse set of ketoacid decarboxylases capable of utilizing 2-ketooctanoate (C8) as a substrate was identified. The median activity of GEOs selected using the integrative genomic mining approach is 75-fold greater than a set of naively selected proteins from the enzyme family.
[0087] The second approach focuses on reprogramming the substrate specificity of KIVD by using computational enzyme design methods. The Rosetta Molecular Modeling Suite was used to direct the generation and screening of over 400 mutants..sup.11 This effort lead to the discovery of a mutant with >600-fold increase in specificity for C8. Finally, the most specific and active enzyme from each approach is incorporated into the synthetic recursive+1 pathway to evaluate its ability to modulate in vivo alcohol production. Both enzymes result in a complete switch of the alcohol production profile towards long chain alcohols, demonstrating the ability to rationally control biosynthetic product specificity for chemicals not commonly found in Nature.
[0088] Results
Integrative Genomic Mining for Enzyme Function
[0089] KIVD belongs to the thiamine pyrophosphate enzyme family that is composed of more than 17,000 sequences..sup.12 To identify GEOs with the desired function within this vast sequence space, bioinformatics.sup.13 and molecular modeling.sup.14 with functional constraints were combined to guide our exploration. (
[0090] The approach assumed that all potential scaffolds with the desired function should be structurally homologous to KIVD and the sequence set was further refined accordingly. Since crystal structures for most of these predicted proteins are not available for analysis, homology models were produced to obtain a predicted ternary structure. Using RosettaCM one hundred models were generated for each of the 239 GEOs..sup.14 The lowest energy model was selected as the representative for each GEO and evaluated for structural similarity to KIVD. The TMalign algorithm.sup.16 was used to overlay the models with the native KIVD crystal structure and only those with a TMalign score of >0.5 were kept. These bioinformatics and structural filters resulted in 239 GEOs as candidates for the targeted function. (
[0091] To further enrich the set for GEOs likely to function on C8, a modeled reaction intermediate of the C8 substrate was docked within the predicted active site. The lowest energy model for each GEO was used as a template for docking a modeled C8 intermediate with functional constraints, which ensured a productive geometric orientation between the predicted catalytic residues in the protein and intermediate. The C8 reaction intermediate used for docking is based on the synthetic thiamine pyrophosphate (TPP) analogue from a crystal structure of KIVD (PDB ID: 2VBG), which mimics the initial nucleophilic attack by the thiazolium..sup.17 Docking calculations were carried out using Rosetta Design in which both the identity and conformation of non-catalytic residues within the active site were allowed to change, and the backbone was allowed to move during minimization. The calculated interface energy after the dock and design simulations was used to evaluate each GEO's ability to accommodate C8.
[0092] A phylogenetic tree based on sequence similarity was built for the 239 GEOs in which the lowest protein-ligand interface energy from the Rosetta Design simulation for each GEO are depicted. (
[0093] From the design simulations, ten GEOs were chosen for experimental characterization based on the predicted protein-ligand interface energy as well as sequence diversity (
[0094] Among the active GEOs, the enzyme with the highest efficiency on C8 is the computationally top ranked GEO 175, with a k.sub.cat/K.sub.M of 17,000 M.sup.1s.sup.1. (Table 1,
TABLE-US-00001 TABLE 1 Kinetic Characteristics of 2-ketoacid Decarboxylase Enzymes C3 C5 C8 iso C5 k.sub.cat/K.sub.M (M.sup.1 s.sup.1) GEO179 0.90 0.02 100 15 1200 130 41 1.2 GEO195 2.4 0.1 200 14 1400 160 8.0 0.3 GEO175 0.51 0.02 48.0 3.7 17000 2700 3.3 0.2 GEO175 L376T_T240S 0.27 0.02 30.0 7.2 1100 160 1.6 0.1 1OVM 32.0 0.5 2100 420 80000 4300 1300 130 2VBI 5700 1400 52.0 1.8 14.0 0.8 1.8 0.1 3FZN 5.4 0.1 1700 110 350 30 110 10 1ZPD 8200 545 140.0 5.6 19.0 2.0 0.33 0.01 1OZF n.d. 0.53 0.04 n.d. 17.0 0.9 Native KIVD 42.0 0.6 9500 470 32000 5500 14000 1100 KIVD_VLV 0.71 0.07 1.3 0.2 2800 860 0.24 0.02 k.sub.cat (s.sup.1) GEO179 n.d. 0.47 0.03 0.32 0.01 0.39 0.01 GEO195 n.d. 0.49 0.01 0.56 0.02 0.072 0.001 GEO175 n.d. 0.97 0.04 10.1 0.6 n.d. GEO175 L376T_T240S n.d. 0.28 0.04 3.4 0.2 n.d. 1OVM 0.2 0.01 1.0 0.1 1.7 0.1 7.8 0.4 2VBI 25 2.6 n.d. 0.051 0.01 0.025 0.001 3FZN n.d. 4.7 0.1 1.3 0.1 0.52 0.02 1ZPD 46.7 1.4 0.95 0.02 0.021 0.001 n.d. 1OZF n.d. n.d. n.d. 0.030 0.001 Native KIVD n.d. 14.3 0.2 7.0 0.3 61.0 2.1 KIVD_VLV n.d. 0.013 0.001 0.50 0.03 n.d. K.sub.M (mM) GEO179 n.d. 4.6 0.6 0.27 0.03 9.4 0.2 GEO195 n.d. 2.5 0.2 0.40 0.04 9.1 0.3 GEO175 n.d. 20.0 1.3 0.58 0.09 n.d. GEO175 L376T_T240S n.d. 10 2 3.1 0.4 n.d. 1OVM 7.5 0.1 0.5 0.1 0.021 0.001 6.1 0.6 2VBI 4.3 1.0 n.d. 3.6 0.2 14.0 0.5 3FZN n.d. 2.7 0.2 3.8 0.3 4.9 0.3 1ZPD 5.7 0.3 7.1 0.3 1.2 0.1 n.d. 1OZF n.d. n.d. n.d. 1.8 0.1 Native KIVD n.d. 1.5 0.1 0.21 0.04 4.5 0.3 KIVD_VLV n.d. 10.0 1.0 0.18 0.05 n.d.
[0095] To evaluate if the integrative genomic mining approach enriches the mining for C8 activity, an additional set of previously characterized ketoacid decarboxylases diverse in sequence were experimentally characterized in an equivalent manner. Five enzymes were selected (PDB: 1OVM, 2VBI, 3FZN, 1ZPD, 1OZF) and all were found to have detectable activity on at least one of the four ketoacids used for GEO characterization. The median C8 activity from the GEOs selected using the integrative genomic mining approach is 75-fold higher than the naively picked decarboxylases (Table 1,
[0096] The protein sequence for GEO 175 is not predicted to require any mutations to be capable of utilizing the C8 substrate, and therefore represents the native enzyme from Streptomyces sp. C. Comparing the active site pocket of GEO 175 with native KIVD (16.8% identity to each other) reveal significant differences which gave implications to the high specificity of this newly identified enzyme. (
[0097] From these observations it was hypothesized that the specificity of GEO 175 could be attributed to a combination of hydrophobic interactions with the sixth through eighth carbons of the alkyl chain, while lacking interactions with the third through fifth carbons. (
Computationally Directed KIVD Active Site Redesign
[0098] In the second effort to reprogram the specificity of KIVD, Rosetta Design methods were used to explore the potential active site sequence space that would accommodate 2-ketooctanoate as a substrate..sup.11 Design simulations were carried out with the same reaction intermediate and functional constraints utilized in the genomic mining pipeline. Ten residues in the active site were targeted for mutagenesis. At each site, one of eleven relatively hydrophobic amino acids (Val, Leu, Ile, Met, Phe, His, Gly, Ala, Thr, Tyr, Trp) was systematically introduced, and the remaining nine sites were allowed to be redesigned. The identities of amino acids at all other residues were kept constant. (
[0099] Since KIVD can already efficiently utilize C8 as a substrate, enzyme specificity is of primary importance. Therefore each mutant was screened against a panel of 2-ketoacid substrates in order to assess the specificity and activity of each mutant. (
In Vivo Testing of Engineered and Genomic Enzymes for Long-Chain Alcohol Production
[0100] The measured specificity and activity for each enzyme was used to select two candidates for further characterization of their ability to modulate alcohol production in vivo. The two enzymes with the highest activity and specificity (
[0101] Consistent with previous reports, the primary products (82% of total alcohol production) with native KIVD are short alcohols (C.sub.2-C.sub.4) (
TABLE-US-00002 TABLE 2 In vivo Alcohol Production Native KIVD (mg/L) KIVD_VLV (mg/L) GEO 175 (mg/L) 1-Ethanol 652 32 n.d. n.d. 1-Propanol 693 4 n.d. n.d. 1-Butanol 1964 24 n.d. 19 2 1-Pentanol 594 20 118 29 88 12 1-Hexanol 75 6 341 63 160 18 1-Heptanol 20 3 269 23 274 19 1-Octanol n.d. n.d. 10 1
Cells were incubated for forty hours in microaerobic conditions in a defined media. The best enzyme in shifting the product profile was GEO175 with 1-heptanol being the major product.
[0102] Replacing KIVD with GEO 175 or KIVD_VLV results in a significant increase of long chain alcohol production, however the overall alcohol production drops 10-fold from the 4.0 g/L obtained with KIVD. We hypothesized that a potential reason for this could be due to the toxicity of long chain alcohols. To explore the potential of toxicity being a limiting factor in alcohol production, E. coli growth was monitored over a 7-hour incubation with 10-1000 mg l.sup.1 C.sub.5-C.sub.8 alcohols supplemented at the beginning of growth. (
[0103] Discussion
[0104] In this study an integrative genomic mining approach was introduced to enable discovery of enzymes for a targeted function from sequence databases. The function of interest here was an enzyme with high activity for the decarboxylation of long chain ketoacids in order to modulate the carbon flux of a synthetic pathway and increase titers of long-chain alcohols. The integrative genomic mining approach led to the discovery of a previously uncharacterized protein that we demonstrate has the targeted functional properties, and only required experimental characterization of ten new proteins. In parallel, a more traditional computationally directed library screening approach was utilized to reengineer the activity of a well-established enzyme. This required two successive rounds of screening over four hundred mutants against a panel of substrates in order to identify an enzyme with the desired functional properties. When evaluated for their ability to modulate carbon flux in vivo both are able to completely shift the product profile towards long chain alcohols.
[0105] The enzyme GEO 175 represents the product of a general and rapid approach for obtaining enzymes with a desired function from the rapidly growing sequence databases. This approach provides a viable alternative to often expensive and laborious enzyme engineering efforts that require screening libraries of mutants. By combining bioinformatics and molecular modeling this approach enables the identification of proteins likely to carry out a targeted function regardless of their native or putatively annotated activity. This overcomes issues with misannotation of protein function.sup.23 or biased assumptions based on the closest, but often distal in sequence, characterized protein. The enzyme identified in this study, GEO175, is a clear illustration of this as it is roughly 15% identical to KIVD and its closest characterized sequence homolog (ppBFD, roughly 50% sequence identity) has a significantly different functional profile.
[0106] While GEO175 and KIVD_VLV both increased long chain alcohol titer >10-fold, we identified that toxicity needs to be addressed in order to further increase total long-chain alcohol titer. The titer of long chain alcohols produced is on the order of 0.5 g/L, which we then demonstrate is highly toxic for the cell lines used in this study. For industrial applications, bio-alcohol production often requires yields on the order of grams per liter..sup.24 To avoid the need of a continuous extraction fermentation system, future efforts for increasing long chain alcohol production should focus on engineering or finding strains that are tolerant to this level of product formation. Efforts to integrate pumps and reengineer the cell wall to be resistant to alcohols could potentially mitigate toxicity effects and concurrently enable higher titers of long-chain alcohols to be produced through this pathway..sup.20,21
[0107] In summary, a new genomic mining approach and computationally directed library design efforts were both successfully implemented to obtain enzymes that enabled specific production of long chain alcohols in vivo. These results demonstrate the modularity of the synthetic+1 recursive pathway and provided a clear path forward to engineer industrial level production of long-chain alcohols. Finally, the integrative genomic mining approach introduced here is highly general, and with the rapid growth of sequence databases it has the potential to revolutionize the development and discovery of enzyme catalysts.
[0108] Methods
Integrative Genomic Mining
[0109] To obtain the GEO sequences, the native KIVD sequence was input for a homologous sequence search using HMMER3's* online server..sup.13 The resulting sequences were filtered using the CD-HIT* online server with a 90% identity cutoff..sup.15,25 A homology model of each sequence was made using Rosetta Comparative Modeling..sup.14 At this point, the intermediate was placed into the active site and 1000 simulations were ran to relax the intermediate according to the constraints. For each model, the lowest 100 in overall protein energy models were selected and then from that subset, the lowest protein-ligand interface was chosen as the energy for the GEO.
[0110] An intermediate of the C8 product-yielding reaction was modeled using Spartan*..sup.26 Different conformations of the alkyl chain were included in the modeling and a conformational library was made using OpenEye Omega*..sup.27 For the enzyme design of KIVD, this intermediate was placed into the active site using distance and angle constraints. Rosetta Enzyme Design was run with default settings, an example of which is provided in the Rosetta Molecular Modeling Suite demos.
[0111] From the design simulations for each GEO the lowest protein-ligand interface Rosetta energy was used to select a tractable number of GEOs for experimental characterization. During these simulations, any amino acids with a C.sub. within 8 of the active site could be mutated to any of the 20 amino acids. An exemplary mapping of GEO175 active site residues to 2VBG active site residues is provided as Table 3. Ten GEOs of significant interest were chosen with the following criteria: Five GEOs were chosen because they had the lowest predicted energies; the second five were chosen with the purpose of maximizing sequence space diversity. The 234 GEOs (less the five lowest in energy) were filtered with a sequence identity cutoff of 40% and the five sequences from this filtered list with the lowest energy were picked as the second five GEOs in our final list. Each model was evaluated in the Foldit interface and mutations made during the design simulations were reverted to the native amino acid if not predicted to improve the interface energy by more than 2 Rosetta energy units.
TABLE-US-00003 TABLE 3 Mapping of GEO175 active site residues to active site residues in 2VBG crystal structure Corresponding Amino GEO175 Active Site Amino Acid Acid position in 2VBG Crystal Position Structure 23 23 24 24 25 25 26 26 27 27 48 50 49 51 54 56 71 gap before 73 74 75 75 76 78 79 81 82 112 113 113 114 286 287 356 352 376 373 377 374 378 375 379 376 380 377 382 379 399 394 401 396 402 397 403 398 404 399 427 gap before 424 428 424 429 425 430 426 431 427 432 428 434 430 454 450 455 451 456 452 457 453 458 454 459 455 460 456 461 457 462 458 465 461 535 532
[0112] Phylogenetic tree of GEOs was generated using Geneious software* using a Muscle sequence alignment..sup.28* The resulting tree was visualized using iTOL online tool in circular tree mode and rooted at native KIVD..sup.29,30
[0113] Synthetic genes coding for each GEO were synthesized as a DNA String by Life Technologies or the Joint Genome Institute. Genes were codon optimized for Escherichia coli and the amino acid sequences are provided herein. See,
[0114] All programs referenced in this section and denoted with an asterisk (*) were run using the default settings unless otherwise specified.
KIVD Active Site Redesign
[0115] In the design simulations, ten residues in the proposed active site pocket were allowed to either remain native or sample any of eleven relatively hydrophobic amino acids (Val, Leu, Ile, Met, Phe, His, Gly, Ala, Thr, Tyr, Trp). The identities of amino acids at all other positions were kept constant. Residues within 12 of the ligand were allowed to undergo conformational sampling during simulation. A total of 10,000 design simulations were ran, from which the 50 designs lowest in ligand-protein interface energy, and non-redundant in terms of sequence, were selected to represent the potential sequence space predicted to accommodate the C8 substrate. The profile was used to construct a small library of 400 KIVD mutants. Each amino acid in the library was sampled as a single mutation, with the exception of residues that were within five residues from one another. These were sampled in a combinatorial fashion as both single and double mutants in order to evaluate synergistic effects given their proximity to one another. A complete list of the amino acids allowed for each site is provided in
Construction and Selection of KIVD Libraries
[0116] Partially degenerate oligonucleotides were ordered from Integrated DNA Technologies (San Diego, Calif.) and were used to generate libraries of kivd mutants (with N-terminal his tags) by PCR. Library DNA was purified, inserted into the PCR-amplified pQE9 vector by isothermal Gibson assembly,.sup.31 and transformed into XL1-Blue cells. Individual ampicillin-resistant colonies were picked and grown in 96-well blocks at 37 C. overnight. The number of colonies picked was three times the theoretical library size to ensure approximately 95% probability of all possible mutation combinations occurring. Glycerol was added to 25% (w/v) and libraries were stored at 80 C. until enzyme activity and specificity were assayed. KIVD mutant libraries were screened using a pH-monitored enzyme assay (method explained below) to measure the rate of H.sup.+ consumption resulting from the decarboxylation of 2-ketoacids.
[0117] KIVD mutant libraries were grown overnight in culture blocks, diluted 1:100 into fresh media (Luria Broth), grown at 37 C. for 3 hours to OD.sub.600 0.6, induced with 0.1 mM IPTG (GoldBio, Saint Louis, Mo.), and grown for 2 additional hours at 37 C. Cells from the well blocks were transferred to 96-well assay plates (Costar, Corning, N.Y.) and cell density was measured at 600 nm. An equal volume of permeabilization solution (8.7 mM potassium phosphate, 43.4 mM KCl, 0.87 mM MgSO.sub.4, pH 7.10.1, 8.7% (v/v) chloroform, 0.0043% (w/v) SDS, 0.26% (v/v) 2-mercaptoethanol) was then added to break the cell membranes. Bromothymol blue, TPP (Sigma-Aldrich, St. Louis, Mo.), and substrate were added to 0.008% (w/v), 0.5 mM, and 10 mM, respectively. All substrates (2-ketobutyrate, 2-ketovalerate, 2-ketoisovalerate, 2-ketocaproate, and 2-ketooctanoate; Sigma-Aldrich, St. Louis, Mo.) were dissolved in MilliQ dH.sub.2O and pH was adjusted to 7.10.1. Absorbance was measured at 615 nm in a spectrophotometer (TEK Powerwave XS, BioTek, Winooski, Vt.). Data were acquired for 15 min at 30 C. Cells containing pQE_hiskivd_wt and pQE9 were used as positive and negative controls, respectively. Enzyme activity data were corrected for cell density. Mutants chosen from this screening had a 25% higher activity than wild-type KIVD for any of the 2-ketoacids.
[0118] The library derived from the pH-coupled assay was further screened using a second enzyme kinetics assay. This assay involved a second enzyme, alcohol dehydrogenase from S. Cerevisiae (ADH6), which is a key enzyme in the alcohol production pathway in reducing the aldehyde produced by KIVD into an alcohol. Alcohol dehydrogenase couples oxidation of NADPH to NADP.sup.+ to the reduction of aldehyde into an alcohol. Stoichiometrically, conversion of one mole of 2-ketoacid to n-alcohol depletes exactly one mole of NADPH. Therefore, activity of KIVD could be measured directly by measuring depletion of NADPH through ultra-violet spectrophotometry.
[0119] Overnight cultures of XL1B with pQE9 containing KIVD mutations were grown at 37 C. in a 96 well block. Cultures were diluted 1:100 and then grown 3 hours at 37 C. to OD.sub.600 of 0.6. Cultures were induced with 0.1 mM IPTG (GoldBio, Saint Louis, Mo.) for 3 hours at 37 C. Cultures were then centrifuged, and pellets were lysed with BugBuster (Novagen, Madison, Wis.). 5 L of cell lysate from each culture and 175 L of a buffer mix containing coenzyme 1.5 mM TPP (Sigma), 0.2 mM NADPH (Fisher, Waltham, Mass.), 0.045 U ADH6, 100 mM NaPO.sub.4, 100 mM NaCl, and 10 mM MgCl.sub.2, pH of 7 were added together into a 96 well plate. 20 L of 100 mM substrate was added to dilute to make a final concentration of 10 mM. The substrates tested were IsoC5, C4, C5, C6, C8 and H.sub.2O. (
[0120] Site-Directed Mutagenesis.
[0121] Oligonucleotides encoding specific kivd mutations were ordered from Integrated DNA Technologies (Coralville, Iowa) and were used to mutate kivd in pZE_LeuA*BCDKA6 and pQE_hiskivd_wt by PCR. Amplified DNA fragments were purified, inserted into either the PCR-amplified pZE vector containing leuA*BCD and adh6 or the pQE vector by isothermal Gibson assembly, and transformed into XL1-Blue cells. Plasmid DNA was purified (Qiagen, Hilden, Germany) from overnight cultures of antibiotic-resistant colonies and the plasmid sequences were verified (Laragen, Culver City, Calif.).
[0122] Chromosomal Gene Knockout.
[0123] Genes were removed from the ATCC 98082 rhtA strain genome using P1 transduction from the Keio collection as previously..sup.32 The aldehyde-alcohol dehydrogenase gene (adhE) was knocked out to eliminate ethanol production from acetyl-coA. In all strains, recA was knocked out to prevent recombination between the genome and plasmids, thereby stabilizing the transformants. Primers used to target recA for knockout were designed based on the Keio collection (Genobase, ecoli.aist-nara.ac.jp) and ordered from Integrated DNA Technologies.
[0124] Fermentation Procedure and Analysis.
[0125] For n-alcohol production, strains of ST128 were transformed with pZS_thrO, pZAlac_ilvA.sub.BSleuA, and pZE_LeuA*BCDK*A6 containing various kivd mutations. Fermentation conditions were adapted from those in previous works,.sup.3,4 with the following changes: 20 mL of medium was used, with 100 g/mL ampicillin, 50 g/uL kanamycin, and 100 g/mL spectinomycin added. Cells were grown to an optical density at 600 nm of 0.6, followed by induction with 0.1 mM isopropyl-b-D-thiogalactoside (IPTG). After fermentation, cells were centrifuged for 15 minutes at 4000g and 4 C. The supernatant was split into two fractions for analysis, 5 mL for short chain alcohols (ethanol, 1-propanol, and 1-butanol), and 15 mL for long chain alcohols (1-pentanol, 1-hexanol, 1-heptanol, and 1-octanol). Long chain alcohols were extracted from the 15 mL fraction by 3 mL n-hexane prior to analysis. GC-FID analysis was performed as previously described..sup.4
[0126] Protein Expression, Purification, and Enzymatic Assay of KIVD.
[0127] For the native KIVD and KIVD_VLV mutant, 2 ml overnight cultures of XL1B cells were transformed with pQE9 containing N-terminal his-tagged KIVD enzymes and grown in Terrific Broth (BP biomedical, Cat#3046-042) with 50 g/mL of carbenicillin. (Fisher scientific, Cat# BP2648-5) For the GEOs, 2 ml overnight cultures of BLR cells were transformed with pet29b+ plasmid containing N-terminal his-tagged GEOs, and grown in Terrific Broth with 50 g/mL of kanamycin. (Fisher scientific, Cat# BP906-5) These cultures were diluted 1:1000 in 500 mL of Terrific Broth with 1 mM MgSO.sub.4, 1% glucose, and 50ug/mL of corresponding antibiotics, then grown at 37 C. for 24 hours. Cultures were pelleted down at 4700 rpm for 10 mins and resuspended in auto-induction media (LB broth, 1 mM MgSO.sub.4, 0.1 mM TPP, 1NPS, and 15052) for induction at 18 C. for 34 hours. At the end of induction, cells were centrifuged (4700 rpm, 4 C., 20 minutes), supernatant was removed, and cells were resuspended in 40 mL lysis buffer (100 mM Hepes pH 7.5, 100 mM NaCl, 10% glycerol, 0.1 mM TPP, 1 mM MgSO.sub.4, 10 mM Imidazole, 1 mM TCEP) and 1 mM PMSF) and sonicated for 2 minutes. Lysed cells were centrifuged at 4700 rpm at 4 C. for 60 mins to remove cell debris. Supernatant was loaded on gravity flow column with 700 l of cobalt slurry (Fisher scientific, CAT# PI-90091) washed with 10 ml of wash buffer (100 mM Hepes pH 7.5, 100 mM NaCl, 10% glycerol, 0.1 mM TPP, 1 mM MgSO.sub.4, 10 mM Imidazole, and 1 mM TCEP). Cobalt bead bed was washed with 15 ml of wash buffer 5 times and proteins were eluted with 1000 l of elution buffer (100 mM Hepes pH 7.5, 100 mM NaCl, 10% glycerol, 0.1 mM TPP, 1 mM MgSO.sub.4, 200 mM Imidazole, and 1 mM TCEP). Protein samples were immediately buffer exchanged with spin concentrators (Satorius, CAT# VS0112) into storage buffer (100 mM Hepes pH 7.5, 100 mM NaCl, 10% glycerol, 0.1 mM TPP, 1 mM MgSO.sub.4, and 1 mM TCEP) and stored at 4 C. until kinetics characterization. Protein concentrations were determined using a Synergy H1 spectrophotometer (Biotek) by measuring absorbance at 280 nm using their calculated extinction coefficients with ExPASy ProtParam Tool..sup.33 All other buffers and salts were purchased from Fisher Scientific unless otherwise specified.
[0128] The k.sub.cat and K.sub.M values of selective KIVD mutants were measured for the substrates: C.sub.3, C5, isoC.sub.5, and C.sub.8. All substrates were dissolved in MilliQ H.sub.2O and pH was adjusted to 7.5 as necessary. Activity was measured at 0.005 mM to 10 mM substrates. The assay was performed in a 96-well half-area plate. Each reaction contains a final concentration of 0.5 mM NADH, 1 mM DTT, 0.1 mM TPP, 1 mM MgSO.sub.4, reaction buffer (100 mM Hepes, 100 mM NaCl, 10% glycerol, pH 7.5) and ADH (Sigma Aldrich, A7011, 10 U/ml for C.sub.3, C.sub.5 and C.sub.8 reactions, 500 U/ml for isoC.sub.5 reactions). A wide range of ketoacid decarboxylase concentrations, 4.5 nM-15 M, were used according to the activity of each enzyme toward different substrates in order to perform steady state kinetics measurement over a period of an hour. Absorbance readings were taken every 1-minute at OD.sub.340 at 21 C. for 60 minutes using the Synergy H1. Kinetic parameters (k.sub.cat and K.sub.M) were determined by fitting initial velocity versus substrate concentration data to the Michaelis-Menten equation.
[0129] Alcohol Toxicity.
[0130] Alcohol tolerance of the in vivo alcohol production strain was evaluated by supplementing the fermentation media with specified quantities of long chain alcohols, and measuring growth over 7 hours. Both the E. coli strain (ATCC 98082 pZS_thrO, pZAlac_ilvA_LeuA, pZE12LeuA*BCDKA6_KIVD_wt) and fermentation media (1M9 metals+1 trace metal mix+0.5% yeast extract+2% glucose+antibiotics) and conditions are the same as described above (Fermentation procedure and analysis). Cells were grown in media without IPTG-induction to a starting OD.sub.600 0.02 and then supplemented with either 1-petanol, 1-hexanol, 1-heptanol, or 1-octanol at specified concentrations of 10 mg/L, 50 mg/L, 250 mg/L, 500 mg/L, or 1000 mg/L. OD.sub.600 readings were taken hourly up to 7 hours.
REFERENCES
[0131] 1. House, US White. National bioeconomy blueprint. Washington D.C., The White House, April (2012). [0132] 2. USDA, US. Bio-based products: market potential and projections through 2025. US Department of Agriculture (2008). [0133] 3. Zhang, K., Sawaya, M. R., Eisenberg, D. S., & Liao, J. C. Expanding metabolism for biosynthesis of non-natural alcohols. Proceedings of the National Academy of Sciences, 20653-20658 (2008). [0134] 4. Marcheschi, R. J., et al. A synthetic recursive+1 pathway for carbon chain elongation. ACS chemical biology 7.4, 689-697 (2012). [0135] 5. Erickson, B., and Winters P. Perspective on opportunities in industrial biotechnology in renewable chemicals. Biotechnology journal 7.2, 176-185 (2012). [0136] 6. Plaza, M., et al. Biochemical and molecular characterization of -ketoisovalerate decarboxylase, an enzyme involved in the formation of aldehydes from amino acids by Lactococcus lactis. FEMS microbiology letters 238.2, 367-374 (2004). [0137] 7. Felnagle, E. A., et al. Engineering synthetic recursive pathways to generate non-natural small molecules. Nature chemical biology 8.6, 518-526 (2012). [0138] 8. Bayer, Travis S., et al. Synthesis of methyl halides from biomass using engineered microbes. Journal of the American Chemical Society. 6508-6515 (2009). [0139] 9. Heins, Richard A., et al. Phylogenomically guided identification of industrially relevant GH1 -glucosidases through DNA synthesis and nanostructure-initiator mass spectrometry. ACS chemical biology. 2082-2091 (2014). [0140] 10. The National Academies. Industrialization of Biology: A Roadmap to Accelerate Advanced Manufacturing of Chemicals. The National Academis Press. (2015) [0141] 11. Richter, F., et al. De novo enzyme design using Rosetta3. PLoS One 6.5, e19230 (2011). [0142] 12. Finn, Robert D., et al. Pfam: the protein families database. Nucleic acids research (2013). [0143] 13. Finn, R. D., Clements J., and Eddy S. R. HMMER web server: interactive sequence similarity searching. Nucleic acids research, gkr367 (2011). [0144] 14. Song, Yifan, et al. High-resolution comparative modeling with RosettaCM. Structure 21.10 (2013): 1735-1742. [0145] 15. Huang, Y., et al. CD-HIT Suite: a web server for clustering and comparing biological sequences. Bioinformatics 26.5, 680-682 (2010). [0146] 16. Zhang, Y., and Skolnick J. TM-align: a protein structure alignment algorithm based on the TM-score. Nucleic acids research 33.7, 2302-2309 (2005). [0147] 17. Berthold, Catrine L., et al. Structure of the branched-chain keto acid decarboxylase (KdcA) from Lactococcus lactis provides insights into the structural basis for the chemoselective and enantioselective carboligation reaction. Acta Crystallographica Section D: Biological Crystallography. 1217-1224 (2007). [0148] 18. Bruning, M., et al. Structural and Kinetic Studies on Native Intermediates and an Intermediate Analogue in Benzoylformate Decarboxylase Reveal a Least Motion Mechanism with an Unprecedented Short-Lived Predecarboxylation Intermediate.sup.. Biochemistry 48.15, 3258-3268 (2009). [0149] 19. Shen, C. R., and Liao J. C. Metabolic engineering of Escherichia coli for 1-butanol and 1-propanol production via the ketoacid pathways. Metabolic engineering 10.6, 312-320 (2008). [0150] 20. Kell, Douglas B., et al. Membrane transporter engineering in industrial biotechnology and whole cell biocatalysis. Trends in biotechnology (2015). [0151] 21. Foo, Jee Loon, et al. Improving Microbial Biogasoline Production in Escherichia coli Using Tolerance Engineering. mBio 5.6, e01932-14 (2014). [0152] 22. Brennan, Timothy C R, et al. Alleviating monoterpene toxicity using a two-phase extractive fermentation for the bioproduction of j et fuel mixtures in Saccharomyces cerevisiae. Biotechnology and bioengineering 2513-2522 (2012). [0153] 23. Schnoes, Alexandra M., et al. Annotation error in public databases: misannotation of molecular function in enzyme superfamilies. PLoS computational biology 5.12 (2009). [0154] 24. Parekh S. Strain improvement. Desk encyclopedia of microbiology. Academic Press, Waltham, (2010). [0155] 25. Kearse, M., et al. Geneious Basic: an integrated and extendable desktop software platform for the organization and analysis of sequence data. Bioinformatics 28.12, 1647-1649 (2012). [0156] 26. Spartan '08, Wavefunction, Inc. Irvine, Calif. Y. Shao et al. Phys. Chem. Chem. Phys., 3172-3191 (2006). [0157] 27. OEChem, version 1.7.7, OpenEye Scientific Software, Inc., Santa Fe, N. Mex., USA, www.eyesopen.com, (2010). [0158] 28. Edgar, Robert C. MUSCLE: multiple sequence alignment with high accuracy and high throughput. Nucleic acids research 32.5, 1792-1797 (2004). [0159] 29. Letunic, Ivica, and Peer Bork. Interactive Tree Of Life (iTOL): an online tool for phylogenetic tree display and annotation., 127-128 Bioinformatics 23.1 (2007). [0160] 30. Letunic, Ivica, and Peer Bork. Interactive Tree Of Life v2: online annotation and display of phylogenetic trees made easy. Nucleic acids research (2011). [0161] 31. Gibson, G. D., et al. Enzymatic assembly of DNA molecules up to several hundred kilobases. Nature methods 6.5, 343-345 (2009). [0162] 32. Datsenko, A. K., and Wanner, B. L. One-step inactivation of chromosomal genes in Escherichia coli K-12 using PCR products. Proceedings of the National Academy of Sciences 97.12, 6640-6645 (2000). [0163] 33. Gasteiger E., et al. ExPASy: the proteomics server for in-depth protein knowledge and analysis. Nucleic Acids Res. 31:3784-3788 (2003). [0164] 34. The PyMOL Molecular Graphics System, Version 1.7.4 Schrdinger, LLC.
TABLE-US-00004 INFORMALSEQUENCELISTING >SEQIDNO:1KIVD MYTVGDYLLDRLHELGIEEIFGVPGDYNLQFLDQIISRKDMKWVGNANELNASYMADGYARTKKAAAFLT TFGVGELSAVNGLAGSYAENLPVVEIVGSPTSKVQNEGKFVHHTLADGDFKHFMKMHEPVTAARTLLTAE NATVEIDRVLSALLKERKPVYINLPVDVAAAKAEKPSLPLKKENSTSNTSDQEILNKIQESLKNAKKPIV ITGHEIISFGLEKTVSQFISKTKLPITTLNFGKSSVDEALPSFLGIYNGKLSEPNLKEFVESADFILMLG VKLTDSSTGAFTHHLNENKMISLNIDEGKIFNESIQNFDFESLISSLLDLSEIEYKGKYIDKKQEDFVPS NALLSQDRLWQAVENLTQSNETIVAEQGTSFFGASSIFLKPKSHFIGQPLWGSIGYTFPAALGSQIADKE SRHLLFIGDGSLQLTVQELGLAIREKINPICFIINNDGYTVEREIHGPNQSYNDIPMWNYSKLPESFGAT EERVVSKIVRTENEFVSVMKEAQADPNRMYWIELILAKEDAPKVLKKMGKLFAEQNKS >SEQIDNO:2GEO175 MRTVRESALDVLRARGMTTVFGNPGSTELPMLKQFPDDFRYVLGLQEAVVVGMADGFALASGTTGLVNLH TGPGTGNAMGAILNARANRTPMVVTAGQQVRAMLTMEALLTNPQSTLLPQPAVKWAYEPPRAADVAPALA RAVQVAETPPQGPVFVSLPMDDFDVVLGEDEDRAAQRAAARTVTHAAAPSAEVVRRLAARLSGARSAVLV AGNDVDASGAWDAVVELAERTGLPVWSAPTEGRVAFPKSHPQYRGMLPPAIAPLSRCLEGHDLVLVIGAP VFCYYPYVPGAHLPENTELVHLTRDADEAARAPVGDAVVADLALTVRALLAELPAREAAAPAARTARAES TAEVDGVLTPLAAMTAIAQGAPANTLWVNESPSNLGQFHDATRIDTPGSFLFTAGGGLGFGLAAAVGAQL GAPDRPVVCVIGDGSTHYAVQALWTAAAYKVPVTFVVLSNQRYAILQWFAQVEGAQGAPGLDIPGLDIAA VATGYGVRAHRATGFGELSKLVRESALQQDGPVLIDVPVTTELPTL >SEQIDNO:3KIVD_VLV MYTVGDYLLDRLHELGIEEIFGVPGDYNLQFLDQIISRKDMKWVGNANELNASYMADGYARIKKAAAFLT TFGVGELSAVNGLAGSYAENLPVVEIVGSPTSKVQNEGKFVHHTLADGDFKHFMKMHEPVTAARTLLTAE NATVEIDRVLSALLKERKPVYINLPVDVAAAKAEKPSLPLKKENSTSNTSDQEILNKIQESLKNAKKPIV ITGHEIISFGLEKTVSQFISKTKLPITTLNFGKSSVDEALPSFLGIYNGKLSEPNLKEFVESADFILMLG VKLTDSSTGAFTHHLNENKMISLNIDEGKIFNESIQNFDFESLISSLLDLSEIEYKGKYIDKKQEDFVPS NALLSQDRLWQAVENLTQSNETIVAEQGTSFFGASSIFLKPKSHFIGQPLWVSIGYTFPAALGSQIADKE SRHLLFIGDGSLQLTVQELGLAIREKINPICFIINNDGYTVEREIHGPNQSYNDIPMWNYSKLPESFGAT EERVVSKIVRTENEFVSVMKEAQADPNRMYWIELILAKEDAPKVLKKLGKLVAEQNKS >SEQIDNO:4GEO249,NP_594083 MSSEKVLVGEYLFTRLLQLGIKSILGVPGDFNLALLDLIEKVGDETFRWVGNENELNGAYAADAYARVKG ISAIVTTFGVGELSALNGFAGAYSERIPVVHIVGVPNTKAQATRPLLHHTLGNGDFKVFQRMSSELSADV AFLDSGDSAGRLIDNLLETCVRTSRPVYLAVPSDAGYFYTDASPLKTPLVFPVPENNKEIEHEVVSEILE LIEKSKNPSILVDACVSRFHIQQETQDFIDATHEPTYVTPMGKTAINESSPYFDGVYIGSLTEPSIKERA ESTDLLLIIGGLRSDFNSGTFTYATPASQTIEFHSDYTKIRSGVYEGISMKHLLPKLTAAIDKKSVQAKA RPVHFEPPKAVAAEGYAEGTITHKWFWPTFASFLRESDVVTTETGTSNEGILDCIFPKGCQNLSQVLWGS IGWSVGAMFGATLGIKDSDAPHRRSILIVGDGSLHLTVQEISATIRNGLIPIIFVINNKGYTIERLIHGL HAVYNDINTEWDYQNLLKGYGAKNSRSYNIHSEKELLDLFKDEEFGKADVIQLVEVHMPVLDAPRVLIEQ AKLTASLNKQ >SEQIDNO:5GEO243,WP_002115026 MELLSGGEMLVRALADEGVEHVFGYPGGAVLHIYDALFQQDKINHYLVRHEQAAGHMADAYSRATGKTGV VLVTSGPGATNTVTPIATAYMDSIPMVILSGQVASHLIGEDAFQETDMVGISRPIVKHSFQVRHASEIPA IIKKAFYIAASGRPGPVVVDIPKDATNPAEKFAYEYPEKVKMRSYQPPSRGHSGQIRKAIDELLSAKRPV IYTGGGVVQGNASALLTELAHLLGYPVTNTLMGLGGFPGDDPQFVGMLGMHGTYEANMAMHNADVILAIG ARFDDRVTNNPAKFCVNAKVIHIDIDPASISKTIMAHIPIVGAVEPVLQEMLTQLKQLNVSKPNPEAIAA WWDQINEWRKVHGLKFETPTDGTMKPQQVVEALYKATNGDAIITSDVGQHQMFGALYYKYKRPRQWINSG GLGTMGVGLPYAMAAKLAFPDQQVVCITGEASIQMCIQELSTCKQYGMNVKILCLNNRALGMVKQWQDMN YEGRHSSSYVESLPDFGKLMEAYGHVGIQIDHADELESKLAEAMAINDKCVFINVMVDRTEHVYPMLIAG QSMKDMWLGKGERT >SEQIDNO:6GEO250,WP_003075272 MPANTAPNAQAAEVFTVRHAVINMLRELGMTRIFGNPGSTELPLFRDYPEDFSYILGLQETVVVGMADGY AQATRNASFVNLHSAAGVGHAMANIFTAFKNRTPMVITAGQQTRSLLQFDPFLHSNQAAELPKPYVKWSC EPARAEDVPQALARAYYIAMQEPRGPVFVSIPADDWDVPCEPITLRKVGFETRPDPRLLDSIGQALEGAR APAFVVGAAVDRSQAFEAVQALAERHQARVYVAPMSGRCGFPEDHALFGGFLPAMRERIVDRLSGHDVVF VIGAPAFTYHVEGHGPFIAEGTQLFQLIEDPAIAAWAPVGDAAVGNIRMGVQELLARPLTHPRPALQPRP AIPAPAAPEPGRLMTDAFLMHTLAQVRSRDSIIVEEAPGSRSIIQAHLPIYAAETFFTMCSGGLGHSLPA SVGIALARPDKKVIGVIGDGSAMYAIQALWSAAHLKLPVTYIIVKNRRYAALQDFSRVFGYREGEKVEGT DLPDIDFVALAKGQGCDGVRVTDAAQLSQVLRDALRSPRATLVEVEVA >SEQIDNO:7GEO242,WP_010764607 MYTVADYLLDRLKELGIDEVFGVPGDYNLQFLDHITARKDLEWIGNANELNAAYMADGYARTKGISALVT TFGVGELSAINGLAGSYAESIPVIEIVGSPTTTVQQNKKLVHHTLGDGDFLRFERIHEEVSAAIAHLSTE NAPSEIDRVLTVAMTEKRPVYINLPIDIAEMKASAPTTPLNHTTDQLTIVETAILTKVEDALKQSKNPVV IAGHEILSYHIENQLEQFIQKFNLPITVLPFGKGAFNEEDAHYLGTYTGSTTDESMKNRVDHADLVLLLG AKLTDSATSGFSFGFTEKQMISIGSTEVLFYGEKQETVQLDRFVSALSTLSFSRFTDEMPSVKRLATPKV RDEKLTQKQFWQMVESFLLQGDTVVGEQGTSFFGLTNVPLKKDMHFIGQPLWGSIGYTFPSALGSQIANK ESRHLLFIGDGSLQLTVQELGTAIREKLTPIVFVINNNGYTVEREIHGATEQYNDIPMWDYQKLPFVFGG TDQTVATYKVSTEIELDNAMTRARTDVDRLQWIEVVMDQNDAPVLLKKLAKIFAKQNS >SEQIDNO:8GEO245,WP_018535238 MVSRPARVAILEQLRADGVRYMEGNPGTVEQGFLDELRNFPDIEYILALQEAGVVGLADGYARATRTPAV LQLHTGVGVGNAVGMLYQAKRGHAPLVAIAGEAGLRYDAMEAQMAVDLVAMAEPVTKWATRVVDPESTLR VLRRAMKVAATPPYGPVLVVLPADVMDRDTSEAAVPTSYVDFAATPDPQVLDRAAELLAGAERPIVIAGD GVHFAGAQEELGRLAQTWGAEVWGADWAEVNLSVEHPAYAGQLGHMFGDSSRRVTGAADAVLLVGTYALP EVYPALDGVFADGAPVVHIDLDTDAIAKNFPVDLGLAADPRRALDGLARALERRMSPESRARAGEWFTGR SAQRSYEIAAAREQDEAALAPDALPVTAFLQELARQLPEDAVVFDEALTASPDVTRHLPPTRPGHWHQTR GGSLGVGIPGAIAAQLAHPDRTVVGFTGDGGSLYTIQALWTAARYDIGATFVICNNSSYKLLELNIEEYW KSVDVAAHEQPEMFDLARPAIDFVALSRSLGVPAVRVEKPDQAKAAVEQALGTPGPFLIDLVTGRGRED >SEQIDNO:9GEO251,WP_020634527 MNVAELVGRTLAELGVGAAFGVVGSGNFVVTNGLRAGGVRFVAARHEGGAASMADAYARMSGRVSVLSLH QGCGLTNALTGITEAAKSRTPMIVLTGDTAASAVLSNFRIGQDALATAVGAVPERVHSAPTAVADTVRAY RTAVQQRRTVLLNLPLDVQAQEAPEAVEIPKVRGPAPIRPDAGMVAKLADLLAEARRPVFIAGRGARASA VPLRELAEISGALLATSAVAHGLFHDDPFSLGISGGFSSPRTADLIVDADLVIGWGCALNMWTTRHGTLL GPAARLVQVDVEQAALGAHRPIDLGVVGDVAGTAVDVHAELDKRGHQRSREAPTGTRWNDVPYNDLSGDG RIDPRTLSRRLDEILPAERMVSIDSGNFMGYPSAYLSVPDENGFCFTQAFQSIGLGLGTAIGAALARPDR LPVLGVGDGGFHMAVSELETAVRLRIPLVIVVYNDAAYGAEIHHFGDADMTTVRFPDTDIAAIGRGFGCD GVTVRSVGDLAAVKEWLGGPRDAPLVIDAKIADDGGSWWLAEAFRH >SEQIDNO:10GEO247,YP_005461458 MIDLDGTVTVAEYLGLRLRHAGVEHLFGVPGDFNLNLLDGLAFVEGLRWVGSPNELGAGYAADAYARRRG LSALFTTYGVGELSAINAVAGSAAEDSPVVHVVGSPRTTTVAGGALVHHTIADGDFRHFARAYAEVTVAQ AMVTATDAGAQIDRVLLAALTHRKPVYLSIPQDLALHRIPAAPLREPLTPASDPAAVERFRTAVRDLLTP AVRPIMLVGQLVSRYGLSTLVTDMTTRSGIPVAAQLSAKGVIDESVEGNLGLYAGSMLDGPAASLIDSAD VVLHLGTALTAELTGFFTHRRPDARTVQLLSTAALVGTTRFDNVLFPDAMTTLAEVLTTFPAPARLAAPT TRAEPTGLAASITPPAPSAVDLTASTATDLTAPTAGDISEMSRVLTQDAFWAGMQAWLPAGHALVADTGT SYWGALALRLPGDTVFLGQPIWNSIGWALPAVLGQGLADPDRRPVLVIGDGAAQMTIQELSTIVAAGLRP IILLLNNRGYTIERALQSPNAGYNDVADWNWRAVVAAFAGPDTDYHHAATGTELAKALTAASESNRPVFI EVELDAFDTPPLLRRLAERATAPS >SEQIDNO:11GEO244,YP_005756646 MKQRIGAYLIDAIHRAGVDKIFGVPGDFNLAFLDDIISNPNVDWVGNTNELNASYAADGYARLNGLAALV TTFGVGELSAVNGIAGSYAERIPVIAITGAPTRAVEHAGKYVHHSLGEGTEDDYRKMFAHITVAQGYITP ENATTEIPRLINTAIAERRPVHLHLPIDVAISEIEIPTPFEVTAAKDTDASTYIELLTSKLHQSKQPIII TGHEINSFHLHQELEDFVNQTQIPVAQLSLGKGAFNEENPYYMGIYDGKIAEDKIRDYVDNSDLILNIGA KLTDSATAGFSYQFNIDDVVMLNHHNIKIDDVTNDEISLPSLLKQLSNISHTNNATFPAYHRPTSPDYTV GTEPLTQQTYFKMMQNFLKPNDVIIADQGTSFFGAYDLALYKNNTFIGQPLWGSIGYTLPATLGSQLADK DRRNLLLIGDGSLQLTVQAISTMIRQHIKPVLFVINNDGYTVERLIHGMYEPYNEIHMWDYKALPAVFGG KNVEIHDVESSKDLQDTFNAINGHPDVMHFVEVKMSVEDAPKKLIDIAKAFSQQNK >SEQIDNO:12GEO246,YP_006485164 MKTVHSASYEILRRHGLTTVFGNPGSNELPFLKDFPEDFRYILGLHEGAVVGMADGFALASGRPAFVNLH AAAGTGNGMGALTNAWYSHSPLVITAGQQVRSMIGVEAMLANVDAGQLPKPLVKWSHEPACAQDVPRALS QAIQTASLPPRAPVYLSIPYDDWAQPAPAGVEHLAARQVSGAALPAPALLAELGERLSRSRNPVLVLGPD VDGANANGLAVELAEKLRMPAWGAPSASRCPEPTRHACFRGVLPAAIAGISRLLDGHDLILVVGAPVFRY HQFAPGDYLPAGAELVQVTCDPGEAARAPMGDALVGDIALTLEALLEQVRPSARPLPEALPRPPALAEEG GPLRPETVFDVIDALAPRDAIFVKESTSTVTAFWQRVEMREPGSYFFPAAGGLGFGLPAAVGAQLAQPRR QVIGIIGDGSANYGITALWSAAQYRVPAVFIILKNGTYGALRWFAGVLEVPDAPGLDVPGLDFCAIARGY GVEALHAATREELEGALKHALAADRPVLIEVPTQTIEP >SEQIDNO:13GEO248,YP_006991301 MYTVGNYLLDRLTELGIRDIFGVPGDYNLKFLDHVMTHKELNWIGNANELNAAYAADGYARTKGIAALVT TFGVGELSAANGTAGSYAEKVPVVQIVGTPTTAVQNSHKLVHHTLGDGRFDHFEKMQTEINGAIAHLTAD NALAEIDRVLRIAVTERCPVYINLAIDVAEVVAEKPLKPLMEESKKVEEETTLVLNKIEKALQDSKNPVV LIGNEIASFHLESALADFVKKFNLPVTVLPFGKGGFDEEDAHFIGVYTGAPTAESIKERVEKADLILIIG AKLTDSATAGFSYDFEDRQVISVGSDEVSFYGEIMKPVAFAQFVNGLNSLNYLGYTGEIKQVERVADIEA KASNLTQNNFWKFVEKYLSNGDTLVAEQGTSFFGASLVPLKSKMKFIGQPLWGSIGYTFPAMLGSQIANP ASRHLLFIGDGSLQLTIQELGMTFREKLTPIVFVINNDGYTVEREIHGPNELYNDIPMWDYQNLPYVFGG NKGNVATYKVTTEEELVAAMSQARQDTTRLQWIEVVMGKQDSPDLLVQLGKVFAKQNS >SEQIDNO:14GEO179,ZP_06547677 MKTIHSAAYALLRRHGMTTIFGNPGSNELPFLKSFPEDFQYVLGLHEGAVVGMADGYALASGKPAFVNLH AAAGTGNGMGALTNSWYSHSPLVITAGQQVRPMIGVEAMLANVDATQLPKPLVKWSYEPANAQDVPRALS QAIHYANTTPKAPVYLSIPYDDWDQPSGPGVEHLIERDVQTAGTPDARQLQVLVQQVQDARNPVLVLGPD VDATLSNDHAVALADKLRMPVWIAPSASRCPFPTRHPSFRGVLPAAIAGISKTLQGHDLIIVVGAPVFRY HQFAPGDYLPVGAQLLHITSDPLEATRAPMGHALVGDIRETLRVLAEEVVQQSRPYPEALAAPECVTDEP HHLHPETLFDVLDAVAPHDAIYVKESTSTTTAFWQRMNLRHPGSYYFPAAGGLGFGLPAAVGVQLAQPQR RVVALIGDGSANYGITALWTAAQYRIPVVFIILKNGTYGALRWFAGVLKAEDSPGLDVPGLDFCAIAKGY GVKAVHTDTRDSFEAALRTALDANEPTVIEVPTLTIQPH >SEQIDNO:15GEO240ZP_06549025 MSNAITKVQNANARRGGDVLLEVLESEGVEYVFGNPGTTELPFMDALLRKPSIQYVLALQEASAVAMADG YAQAAKKPGFLNLHTAGGLGHGMGNLLNAKCSQTPLVVTAGQQDSRHTTTDPLLLGDLVGMGKTFAKWSQ EVTHVDQLPVLVRRAFHDSDAAPKGSVFLSLPMDVMEAMSAIGIGAPSTIDRNAVAGSLPLLASKLAAFT PGNVALIAGDEIYQSEAANEVVALAEMLAADVYGSTWPNRIPYPTAHPLWRGNLSTKATEINRALSQYDA IFALGGKSLITILYTEGQAVPEQCKVFQLSADAGDLGRTYSSELSVVGDIKSSLKVLLPELEKATANHRR DYQRRFEKAINEFKLSKESLLGQVQEQQSATVITPLVAAFEAARAIGPDVAIVDEATATSGSLRKSLNSH RADQYAFLRGGGLGWGMPAAVGYSLGLGKAPVVCFVGDGAAMYSPQALWTAAHEKLPVTFIVMNNTEYNV LKNFMRSQADYTSAQTDRFIAMDLVNPSVDYQALGASMGLETRKVIRAGDIAPAVEAALASGKPNVIEII ISKS >SEQIDNO:16GEOP195,ZP_06846103 MTSRSSFSPPSASEQRGADIFAEVLQCEGVRYIFGNPGTTELPLLDALTDITGIHYVLGLHEASVVAMAD GYAQASGKPGFVNLHTAGGLGNAMGAILNAKMANTPLVVTAGQQDTRHGVTDPLLHGDLTGIARPNVKWA EEIHHPEHIPMLLRRALQDCRTGPAGPVFLSLPIDTMERCTSVGAGEASRIERASVANMLHALATALAEV TAGHIALVAGEEVFTANASVEAVALAEALGAPVFGASWPGHIPFPTAHPQWQGTLPPKASDIRETLGPFD AVLILGGHSLISYPYSEGPAIPPHCRLFQLTGDGHQIGRVHETTLGLVGDLQLSLRALLPLLARKLQPQN GAVARLRQVAILKRDARRTEAAERSAREFDASATTPFVAAFETIRAIGPDVPIVDEAPVTIPHVRACLDS ASARQYLFTRSAILGWGMPAAVGVSLGLDRSPVVCLVGDGSAMYSPQALWTAAHERLPVTFVVFNNGEYN ILKNYARAQTNYRSARANRFIGLDISDPAIDEPALASSLGVPARRVERAGDIAIAVEDGIRSGRPNLIDV LISSSS >SEQIDNO:17GEO241,ZP_07033476 MNIAYETRENKVASGRECLLEILRDEGVTHVFGNPGTTELALIDALAGDDDFHFILGLQEAAVVGMADGY AQATGRPSFVNLHTTAGLGNGMGNLTNAFATNVPMVVTAGQQDIRHLAYDPLLSGDLVGLARATVKWAHE VRSLQELPIILRRAFRDANTEPRGPVFVSLPMNIIDEIGTVSIPPRSTIVQAESGDISQLVRLLVESAGN LCLVVGDEVGRYGATEAAVRVAELLGAPVYGSPFHSNVPFPTDHPLWRFTLPPNTGEMRKVLGGYDRILL IGDRAFMSYTYSDELPLSPKTQLLQIAVDRHSLGRCHAVELGLYGDPLSLLAAVGDALSQERALAPSRDS RLAIARDWRASWEQDLKDECERLAPSRPLYPLVAADAVLRGVPPGTVIVDECLATNKYVRQLYPVRKPGE YYYFRGAGLGWGMPAAVGVSLGLERQQRVVCLLGDGAAMYSPQALMSAAHESLPITFVVENNSEYNILKN FMRSRPGYNAQSGRFVGMEINQPSIDFCALARSMGVDAVRLTEPDDITAYMIAAGDREGPSLLEIPIAAT AS
Program Code and Input
[0165] Described herein are various program codes and input that can be utilized in the methods of the present invention for identifying, designing, scoring, and/or characterizing 2-ketoacid decarboxylases of the present invention.
Ligand.pdb
[0166] The following exemplary ligand.pdb file contents can be used for calculating Rosetta energy units for ligand:enzyme interactions. The ligand.pdb file can also be used to calculate a ligand binding pocket (e.g., active site) solvent accessible surface area.
TABLE-US-00005 HETATM17213 C11 X00 X 1 20.201 113.106 7.257 1.00 0.00 HETATM17214 N4 X00 X 1 19.791 111.778 7.282 1.00 0.00 HETATM17215 C6 X00 X 1 20.602 110.614 6.899 1.00 0.00 HETATM17216 C8 X00 X 1 20.906 109.687 8.079 1.00 0.00 HETATM17217 C7 X00 X 1 19.941 108.811 8.567 1.00 0.00 HETATM17218 N3 X00 X 1 20.229 107.980 9.634 1.00 0.00 HETATM17219 C10 X00 X 1 21.458 108.021 10.258 1.00 0.00 HETATM17220 N2 X00 X 1 22.411 108.875 9.787 1.00 0.00 HETATM17221 C9 X00 X 1 22.160 109.704 8.707 1.00 0.00 HETATM17222 N1 X00 X 1 23.154 110.476 8.289 1.00 0.00 HETATM17223 C2 X00 X 1 21.726 107.127 11.428 1.00 0.00 HETATM17224 C12 X00 X 1 18.500 111.725 7.696 1.00 0.00 HETATM17225 C4 X00 X 1 17.701 110.455 7.838 1.00 0.00 HETATM17226 C13 X00 X 1 18.045 113.015 7.978 1.00 0.00 HETATM17227 C14 X00 X 1 16.677 113.426 8.453 1.00 0.00 HETATM17228 C15 X00 X 1 16.683 114.488 9.549 1.00 0.00 HETATM17229 O7 X00 X 1 15.322 114.843 9.716 1.00 0.00 HETATM17230 P1 X00 X 1 14.842 115.976 10.759 1.00 0.00 HETATM17231 O1 X00 X 1 15.535 115.665 12.077 1.00 0.00 HETATM17232 O3 X00 X 1 13.339 115.886 10.849 1.00 0.00 HETATM17233 MG1 X00 X 1 11.877 117.206 10.165 1.00 0.00 HETATM17234 O6 X00 X 1 13.320 117.904 8.896 1.00 0.00 HETATM17235 P2 X00 X 1 14.706 118.411 9.193 1.00 0.00 HETATM17236 O2 X00 X 1 15.588 118.497 7.985 1.00 0.00 HETATM17237 O4 X00 X 1 14.642 119.707 9.942 1.00 0.00 HETATM17238 O5 X00 X 1 15.431 117.343 10.179 1.00 0.00 HETATM17239 S1 X00 X 1 19.109 114.205 7.732 1.00 0.00 HETATM17240 C17 X00 X 1 21.225 113.527 6.136 1.00 0.00 HETATM17241 C16 X00 X 1 20.888 112.379 5.024 1.00 0.00 HETATM17242 O8 X00 X 1 21.804 111.560 4.740 1.00 0.00 HETATM17243 O9 X00 X 1 19.772 112.545 4.414 1.00 0.00 HETATM17244 C18 X00 X 1 20.969 114.995 5.653 1.00 0.00 HETATM17245 C1 X00 X 1 22.079 116.060 5.757 1.00 0.00 HETATM17246 C19 X00 X 1 23.348 115.563 5.034 1.00 0.00 HETATM17247 C20 X00 X 1 24.602 116.384 5.305 1.00 0.00 HETATM17248 C3 X00 X 1 24.784 116.577 6.823 1.00 0.00 HETATM17249 C5 X00 X 1 24.614 115.223 7.536 1.00 0.00 HETATM17250 O10 X00 X 1 22.455 113.469 6.632 1.00 0.00 HETATM17251 H10 X00 X 1 20.062 110.047 6.141 1.00 0.00 HETATM17252 H24 X00 X 1 21.553 110.989 6.523 1.00 0.00 HETATM17253 H11 X00 X 1 18.954 108.779 8.106 1.00 0.00 HETATM17254 H8 X00 X 1 23.019 111.090 7.498 1.00 0.00 HETATM17255 H22 X00 X 1 24.047 110.452 8.762 1.00 0.00 HETATM17256 H7 X00 X 1 21.522 106.093 11.149 1.00 0.00 HETATM17257 H21 X00 X 1 22.769 107.223 11.729 1.00 0.00 HETATM17258 H28 X00 X 1 21.081 107.412 12.258 1.00 0.00 HETATM17259 H9 X00 X 1 17.647 110.175 8.891 1.00 0.00 HETATM17260 H23 X00 X 1 16.694 110.613 7.452 1.00 0.00 HETATM17261 H27 X00 X 1 18.183 109.657 7.274 1.00 0.00 HETATM17262 H12 X00 X 1 16.170 112.540 8.838 1.00 0.00 HETATM17263 H25 X00 X 1 16.170 113.867 7.596 1.00 0.00 HETATM17264 H13 X00 X 1 17.272 115.352 9.244 1.00 0.00 HETATM17265 H26 X00 X 1 17.130 114.121 10.474 1.00 0.00 HETATM17266 H1 X00 X 1 20.115 115.397 6.223 1.00 0.00 HETATM17267 H2 X00 X 1 20.635 114.977 4.607 1.00 0.00 HETATM17268 H6 X00 X 1 22.309 116.243 6.807 1.00 0.00 HETATM17269 H14 X00 X 1 21.738 116.983 5.289 1.00 0.00 HETATM17270 H4 X00 X 1 23.163 115.581 3.953 1.00 0.00 HETATM17271 H5 X00 X 1 23.539 114.517 5.305 1.00 0.00 HETATM17272 H3 X00 X 1 24.539 117.378 4.856 1.00 0.00 HETATM17273 H17 X00 X 1 25.493 115.880 4.920 1.00 0.00 HETATM17274 H15 X00 X 1 24.036 117.279 7.193 1.00 0.00 HETATM17275 H16 X00 X 1 25.781 116.969 7.022 1.00 0.00 HETATM17276 H18 X00 X 1 24.733 115.360 8.611 1.00 0.00 HETATM17277 H19 X00 X 1 25.366 114.523 7.173 1.00 0.00 HETATM17278 H20 X00 X 1 23.620 114.826 7.329 1.00 0.00
Ligand.params
[0167] The following exemplary ligand.params file contents can be used for calculating Rosetta energy units for ligand:enzyme interactions. The ligand.pdb file can also be used to calculate a ligand binding pocket (e.g., active site) solvent accessible surface area.
TABLE-US-00006 NAME X00 IO_STRING X00 Z TYPE LIGAND AA UNK ATOM C11 CNH2 X 0.54 ATOM N4 Npro X 0.38 ATOM C6 CH2 X 0.19 ATOM C8 aroC X 0.13 ATOM C7 aroC X 0.13 ATOM N3 Nhis X 0.54 ATOM C10 aroC X 0.13 ATOM N2 Nhis X 0.54 ATOM C9 aroC X 0.13 ATOM N1 NH2O X 0.48 ATOM H8 Hpol X 0.42 ATOM H22 Hpol X 0.42 ATOM C2 CH3 X 0.28 ATOM H7 Hapo X 0.08 ATOM H21 Hapo X 0.08 ATOM H28 Hapo X 0.08 ATOM H11 Haro X 0.10 ATOM H10 Hapo X 0.08 ATOM H24 Hapo X 0.08 ATOM C12 COO X 0.61 ATOM C4 CH3 X 0.28 ATOM H9 Hapo X 0.08 ATOM H23 Hapo X 0.08 ATOM H27 Hapo X 0.08 ATOM C13 COO X 0.61 ATOM C14 CH2 X 0.19 ATOM C15 CH2 X 0.19 ATOM O7 OH X 0.67 ATOM P1 Phos X 1.49 ATOM O1 OOC X 0.77 ATOM O3 Oaro X 0.67 ATOM MG1 Mg2p X 1.99 ATOM O6 Oaro X 0.67 ATOM P2 Phos X 1.49 ATOM O2 OOC X 0.77 ATOM O4 OOC X 0.77 ATOM O5 Oaro X 0.67 ATOM H13 Hapo X 0.08 ATOM H26 Hapo X 0.08 ATOM H12 Hapo X 0.08 ATOM H25 Hapo X 0.08 ATOM S1 S X 0.17 ATOM C17 CH1 X 0.10 ATOM C16 COO X 0.61 ATOM O8 OOC X 0.77 ATOM O9 OOC X 0.77 ATOM C18 CH2 X 0.19 ATOM C1 CH2 X 0.19 ATOM C19 CH2 X 0.19 ATOM C20 CH2 X 0.19 ATOM C3 CH2 X 0.19 ATOM C5 CH3 X 0.28 ATOM H18 Hapo X 0.08 ATOM H19 Hapo X 0.08 ATOM H20 Hapo X 0.08 ATOM H15 Hapo X 0.08 ATOM H16 Hapo X 0.08 ATOM H3 Hapo X 0.08 ATOM H17 Hapo X 0.08 ATOM H4 Hapo X 0.08 ATOM H5 Hapo X 0.08 ATOM H6 Hapo X 0.08 ATOM H14 Hapo X 0.08 ATOM H1 Hapo X 0.08 ATOM H2 Hapo X 0.08 ATOM O10 OOC X 0.77 BOND N1 H8 BOND N1 H22 BOND N2 C9 BOND N3 C10 BOND N4 C6 BOND N4 C11 BOND C1 C19 BOND C1 H6 BOND C1 H14 BOND C2 H7 BOND C2 H21 BOND C2 H28 BOND C3 C5 BOND C3 H15 BOND C3 H16 BOND C4 H9 BOND C4 H23 BOND C4 H27 BOND C5 H18 BOND C5 H19 BOND C5 H20 BOND C6 C8 BOND C6 H10 BOND C6 H24 BOND C7 N3 BOND C7 H11 BOND C8 C7 BOND C8 C9 BOND C9 N1 BOND C10 N2 BOND C10 C2 BOND C11 C17 BOND C11 S1 BOND C12 N4 BOND C12 C4 BOND C13 C12 BOND C13 C14 BOND C13 S1 BOND C14 C15 BOND C14 H12 BOND C14 H25 BOND C15 O7 BOND C15 H13 BOND C15 H26 BOND C16 O8 BOND C16 O9 BOND C17 C16 BOND C17 C18 BOND C17 O10 BOND C18 C1 BOND C18 H1 BOND C18 H2 BOND C19 C20 BOND C19 H4 BOND C19 H5 BOND C20 C3 BOND C20 H3 BOND C20 H17 BOND O3 MG1 BOND O6 P2 BOND O6 MG1 BOND O7 P1 BOND P1 O1 BOND P1 O3 BOND P1 O5 BOND P2 O2 BOND P2 O4 BOND P2 O5 CHI 1 C11 N4 C6 C8 CHI 2 C18 C1 C19 C20 CHI 3 N4 C6 C8 C7 CHI 4 N4 C11 C17 C16 CHI 5 C12 C13 C14 C15 CHI 6 C13 C14 C15 O7 CHI 7 C14 C15 O7 P1 CHI 8 C11 C17 C16 O8 CHI 9 C11 C17 C18 C1 CHI 10 C17 C18 C1 C19 CHI 11 C1 C19 C20 C3 CHI 12 C19 C20 C3 C5 CHI 13 C15 O7 P1 O1 NBR_ATOM C11 NBR_RADIUS 12.161170 ICOOR_INTERNAL C11 0.000000 0.000000 0.000000 C11 N4 C6 ICOOR_INTERNAL N4 0.000000 180.000000 1.391812 C11 N4 C6 ICOOR_INTERNAL C6 0.000000 53.916539 1.468135 N4 C11 C6 ICOOR_INTERNAL C8 96.000197 67.116300 1.531771 C6 N4 C11 ICOOR_INTERNAL C7 111.300524 59.137106 1.391982 C8 C6 N4 ICOOR_INTERNAL N3 179.917537 59.736377 1.382921 C7 C8 C6 ICOOR_INTERNAL C10 1.618450 58.841090 1.378822 N3 C7 C8 ICOOR_INTERNAL N2 1.665903 61.021480 1.364563 C10 N3 C7 ICOOR_INTERNAL C9 0.593863 58.813216 1.384115 N2 C10 N3 ICOOR_INTERNAL N1 178.163678 62.733766 1.326764 C9 N2 C10 ICOOR_INTERNAL H8 179.365571 60.001398 1.010016 N1 C9 N2 ICOOR_INTERNAL H22 179.989152 59.997284 1.009957 N1 C9 H8 ICOOR_INTERNAL C2 179.539104 60.287405 1.495790 C10 N3 N2 ICOOR_INTERNAL H7 54.439218 70.499071 1.089994 C2 C10 N3 ICOOR_INTERNAL H21 120.082237 70.494917 1.090006 C2 C10 H7 ICOOR_INTERNAL H28 119.957562 70.562820 1.089996 C2 C10 H21 ICOOR_INTERNAL H11 179.993306 60.133454 1.089916 C7 C8 N3 ICOOR_INTERNAL H10 120.583822 71.350394 1.089994 C6 N4 C8 ICOOR_INTERNAL H24 121.121616 72.544242 1.090009 C6 N4 H10 ICOOR_INTERNAL C12 178.860538 71.160846 1.356234 N4 C11 C6 ICOOR_INTERNAL C4 179.432481 55.532238 1.507704 C12 N4 C11 ICOOR_INTERNAL H9 102.069181 70.493434 1.089997 C4 C12 N4 ICOOR_INTERNAL H23 120.080362 70.495628 1.090075 C4 C12 H9 ICOOR_INTERNAL H27 119.957609 70.556165 1.090015 C4 C12 H23 ICOOR_INTERNAL C13 179.339904 70.347924 1.397384 C12 N4 C4 ICOOR_INTERNAL C14 179.451180 52.280217 1.504307 C13 C12 N4 ICOOR_INTERNAL C15 117.854883 65.606771 1.526234 C14 C13 C12 ICOOR_INTERNAL O7 175.865383 75.197950 1.417354 C15 C14 C13 ICOOR_INTERNAL P1 164.747946 57.441505 1.612898 O7 C15 C14 ICOOR_INTERNAL O1 43.185207 73.683638 1.520783 P1 O7 C15 ICOOR_INTERNAL O3 121.006572 72.974924 1.508629 P1 O7 O1 ICOOR_INTERNAL MG1 110.188590 50.123302 2.084810 O3 P1 O7 ICOOR_INTERNAL O6 21.371051 94.278939 2.043304 MG1 O3 P1 ICOOR_INTERNAL P2 54.013740 50.009149 1.505128 O6 MG1 O3 ICOOR_INTERNAL O2 164.799552 66.240624 1.498838 P2 O6 MG1 ICOOR_INTERNAL O4 127.318605 69.476366 1.498457 P2 O6 O2 ICOOR_INTERNAL O5 116.143547 71.979188 1.624755 P2 O6 O4 ICOOR_INTERNAL H13 119.330756 69.335680 1.090084 C15 C14 O7 ICOOR_INTERNAL H26 118.726623 67.835020 1.089992 C15 C14 H13 ICOOR_INTERNAL H12 120.796185 71.737001 1.089999 C14 C13 C15 ICOOR_INTERNAL H25 121.711373 73.431344 1.089949 C14 C13 H12 ICOOR_INTERNAL S1 178.555063 64.242905 1.615075 C13 C12 C14 ICOOR_INTERNAL C17 32.779163 62.660465 1.575235 C11 N4 C6 ICOOR_INTERNAL C16 73.771627 80.628634 1.632675 C17 C11 N4 ICOOR_INTERNAL O8 125.893768 62.597308 1.261160 C16 C17 C11 ICOOR_INTERNAL O9 170.771560 65.639200 1.283554 C16 C17 O8 ICOOR_INTERNAL C18 121.091764 68.746111 1.567025 C17 C11 C16 ICOOR_INTERNAL C1 159.715274 59.432661 1.541992 C18 C17 C11 ICOOR_INTERNAL C19 179.885210 70.242962 1.542018 C1 C18 C17 ICOOR_INTERNAL C20 179.671288 65.188952 1.523201 C19 C1 C18 ICOOR_INTERNAL C3 179.189402 70.082610 1.540108 C20 C19 C1 ICOOR_INTERNAL C5 179.841491 70.561809 1.540037 C3 C20 C19 ICOOR_INTERNAL H18 179.464013 70.502707 1.090032 C5 C3 C20 ICOOR_INTERNAL H19 120.076286 70.498233 1.089998 C5 C3 H18 ICOOR_INTERNAL H20 119.965258 70.557224 1.089971 C5 C3 H19 ICOOR_INTERNAL H15 119.950407 70.509198 1.090018 C3 C20 C5 ICOOR_INTERNAL H16 120.079178 70.498264 1.089841 C3 C20 H15 ICOOR_INTERNAL H3 119.086173 68.309294 1.093502 C20 C19 C3 ICOOR_INTERNAL H17 121.483665 68.933404 1.094687 C20 C19 H3 ICOOR_INTERNAL H4 120.658650 71.441727 1.096942 C19 C1 C20 ICOOR_INTERNAL H5 116.222819 70.419964 1.097278 C19 C1 H4 ICOOR_INTERNAL H6 120.110603 70.565925 1.090080 C1 C18 C19 ICOOR_INTERNAL H14 120.044272 70.701604 1.089923 C1 C18 H6 ICOOR_INTERNAL H1 121.585119 71.959730 1.101515 C18 C17 C1 ICOOR_INTERNAL H2 113.963932 70.907736 1.098815 C18 C17 H1 ICOOR_INTERNAL O10 118.803514 71.041960 1.327227 C17 C11 C18
SASA.xml
[0168] The following exemplary SASA.xml file contents can be used to calculate solvent accessible surface area (SASA) of a 2-ketoacid decarboxylase active site.
TABLE-US-00007 <ROSETTASCRIPTS> <SCOREFXNS> </SCOREFXNS> <FILTERS> <Sasa name=sasa_filter jump=1/> </FILTERS> <MOVERS> </MOVERS> <APPLY_TO_POSE> </APPLY_TO_POSE> <PROTOCOLS> <Add filter_name=sasa_filter/> </PROTOCOLS> </ROSETTASCRIPTS>
Ligand Energies
[0169] Ligand binding energies described herein refer to the transition state substrate that is docked into the active site of a 2-ketoacid decarboxylase in a catalytically relevant conformation and calculated using Rosetta Enzyme Design style constraints. The base energy function is the talaris2013_csts.wts file which contains the following terms: fa_atr fa_rep fa_sol fa_intra_rep fa_elec pro_close hbond_sr_bb hbond_lr_bb hbond_bb_sc hbond_sc dslf_fa13 rama omega fa_dun p_aa_pp ref
[0170] This base score function can be invoked with the flag:-score:weights Rosetta/main/database/scoring/weights/talaris2013_cst.wts
[0171] The flag-ligand::old_estat turns the fa_elec term into the hack_elec term.
[0172] The flag-enzdes::favor_native_res 2 turns on the res_type_constraint term with a weight of 2.
[0173] This results in the final score function of: fa_atr fa_rep fa_sol fa_intra_rep hack_elec pro_close hbond_sr_bb hbond_lr_bb hbond_bb_sc hbond_sc dslf_fa13 rama omega fa_dun p_aa_pp ref res_type_constraint with weights of 0.8 0.44 0.75 0.004 0.7 1 1.17 1.17 1.17 1.1 1 0.2 0.5 0.56 0.32 1 2
[0174] The ligand score is weighted sum of this modified talaris 2013 score function.
Solvent Accessible Surface Area (SASA) Calculation
[0175] The SASA can be calculated using Rosetta with an input PDB file (the protein structure to score that has a ligand bound in it). The ligand and associated params file in the Rosetta format can be used to instruct the Rosetta program in how to treat and score the ligand. The binding pocket is auto detected. RosettaScripts can be used to run the SASA filter on the input PDB. The score is output in the log file/trace.
[0176] In an exemplary embodiment, SASA values are calculated using Rosetta version c2b18f674e7b416b5b756630d7ccd5d64c57512c 2015-05-04 14:47:46-0700 from git@github.com:RosettaCommons/main.git. This version can be used for any of the Rosetta functions described herein (e.g., enzyme design, homology modeling, docking, energy function evaluation, etc.).
[0177] The SASA score can be calculated using the following command line input: /Rosetta/main/source/bin/rosetta_scripts.default.macosclangrelease-database /Rosetta/main/database-parser:protocol sasa.xml-s input.pdb-extra_res_fa ligand.params.