Method of binding a CSE1L tumor marker in a tumor of an animal
10172963 ยท 2019-01-08
Assignee
Inventors
Cpc classification
G01N33/57484
PHYSICS
C07K16/28
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K39/395
HUMAN NECESSITIES
Abstract
Microvesicles play essential roles in disease progression. The present invention provides a microvesicle membrane protein and application thereof. Disclosed is a method comprising phosphorylated CSE1L (cellular apoptosis susceptibility protein)- or CSE1L-binding agents for microvesicle isolation, analysis, or binding for disease diagnosis.
Claims
1. An in vivo method of binding a chromosome segregation 1-like (CSE1L) tumor marker in a tumor in an animal, wherein the tumor expresses CSE1L protein, the method comprising: injecting into a vein of the animal a composition comprising an anti-CSE1L carrier-conjugated antibody for binding CSE1L protein in microvesicle membrane in and around tumor cells in the tumor.
2. The method of claim 1, wherein the carrier comprises a nanocrystal.
3. The method of claim 1, wherein the anti-CSE1L antibody is conjugated with a fluorescent agent for in vivo tumor imaging.
4. The method of claim 3, wherein the anti-CSE1L antibody is conjugated with a quantum dot.
5. The method of claim 1, further comprising assaying the CSE1L tumor marker by detecting anti-CSE1L carrier-conjugated antibodies bound to the tumor.
6. An in vivo method of binding an anti-chromosome segregation 1-like (CSE1L) carrier-conjugated antibody to a tumor in an animal, wherein the tumor expresses CSE1L protein, the method comprising: injecting into a vein of the animal a composition comprising an anti-CSE1L carrier-conjugated antibody for binding CSE1L protein in microvesicle membrane in and around tumor cells in the tumor.
7. The method of claim 6, wherein the carrier comprises a nanocrystal.
8. The method of claim 6, wherein the anti-CSE1L antibody is conjugated with a fluorescent agent for in vivo tumor imaging.
9. The method of claim 8, wherein the anti-CSE1L antibody is conjugated with a quantum dot.
10. The method of claim 6, further comprising detecting anti-CSE1L carrier-conjugated antibodies bound to the tumor.
11. An in vivo method of analyzing a chromosome segregation 1-like (CSE1L) tumor marker in a tumor in an animal, wherein the tumor expresses CSE1L protein, the method comprising: injecting into a vein of the animal a composition comprising an anti-CSE1L carrier-conjugated antibody for binding CSE1L protein in microvesicle membrane in and around tumor cells in the tumor.
12. The method of claim 11, wherein the carrier comprises a nanocrystal.
13. The method of claim 11, wherein the anti-CSE1L antibody is conjugated with a fluorescent agent for in vivo tumor imaging.
14. The method of claim 11, further comprising assaying the CSE1L tumor marker by detecting anti-CSE1L carrier-conjugated antibodies bound to the tumor.
15. An in vivo method of binding a phosphorylated chromosome segregation 1-like (CSE1L) tumor marker in a tumor in an animal, wherein the tumor expresses phosphorylated CSE1L protein, the method comprising: injecting into a vein of the animal a composition comprising an anti-phosphorylated CSE1L carrier-conjugated antibody, which recognizes phosphorylated CSE1L and does not recognize non-phosphorylated CSE1L, for binding phosphorylated CSE1L protein in microvesicle membrane in and around tumor cells in the tumor.
16. The method of claim 15, wherein the carrier comprises a nanocrystal.
17. The method of claim 15, wherein the anti-phosphorylated CSE1L antibody is conjugated with a fluorescent agent for in vivo tumor imaging.
18. The method of claim 17, wherein the anti-phosphorylated CSE1L antibody is conjugated with a quantum dot.
19. The method of claim 15, further comprising assaying the phosphorylated CSE1L tumor marker by detecting anti-phosphorylated CSE1L carrier-conjugated antibody bound to the tumor.
Description
BRIEF DESCRIPTION OF THE DRAWING
(1)
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12)
DETAILED DESCRIPTION OF THE INVENTION
(13) Microvesicles (sometimes called circulating microvesicles, microparticles, or exosomes) are fragments of plasma membrane shed from cells. Microvesicles can be found in body fluids and cell culture conditioned media. Microvesicles can be released into the body fluids or the cell culture conditioned media as the free microvesicles; microvesicles may also not be released and are associated with the membrane of a cell as the cell membrane-associated microvesicles (Simak et al. 2006; Cocucci et al. 2009; Muralidharan-Chari et al. 2010). The methods and compositions described herein are equally applicable to free microvesicles and cell membrane-associated microvesicles. Typically microvesicles are described as being 100 nm to 15 m, whilst exosomes are in the range 30-100 nm. The methods and compositions described herein are equally applicable to microvesicles of all sizes.
(14) Certain aspects of the present invention are based on the surprising finding that CSE1L mediates the generation of microvesicles, CSE1L is localized in microvesicle membrane, CSE1L is a serine/threonine and tyrosine phosphorylated protein, and phosphorylated CSE1L is present in the sera of cancer patients. Accumulated studies have shown that microvesicles are involved in cell-to-cell communication by transfer of bioactive molecules including proteases, mRNAs, microRNAs, membrane receptors, and organelles among cells thus play essential physiological/pathological roles including the progression of various diseases such as coagulation diseases, wound healing, atherosclerosis, coronary diseases, diabetes, hematologic diseases, infectious diseases, inflammatory diseases, neurologic diseases, and cancer (Simak et al. 2006; Cocucci et al. 2009; Muralidharan-Chari et al. 2010). Thus, microvesicle proteins especially microvesicle proteins that localized in microvesicle membrane are valuable biomarkers for disease diagnosis. Also, agents that can bind with microvesicle membrane protein can be used for medical imaging or disease treatment.
(15) Another surprising finding in the present invention is that CSE1L is linked to ERK signaling pathway, CSE1L is phosphorylated upon ERK activation, phosphorylated CSE1L is present in sera from cancer patients, and assay of serum phosphorylated CSE1L is superior to assay of serum CSE1L for cancer diagnosis (Example 14). Aberrant activation of the ERK pathway has been shown to be an essential feature common to many types of human tumors (Hoshino et al. 1999). Therefore, level of phosphorylated CSE1L definitely will be higher in sera from cancer patients than that from healthy individuals. Also, assay of serum phosphorylated CSE1L definitely will be more sensitive than assay of serum CSE1L for cancer diagnosis. Thus, phosphorylated CSE1L should have clinical utility in cancer diagnosis.
(16) Another surprising finding in the present invention is that CSE1L is linked to Ras-ERK signaling and cancer metastasis. The Ras-ERK pathway is a potential targets for development of molecularly-targeted drug for cancer (Roberts et al. 2007). CSE1L is linked to Ras-ERK signaling and cancer metastasis. And phosphorylated CSE1L is presence in the sera of cancer patients. Therefore, serum phosphorylated CSE1L may have clinical utility in conjunction with specific molecularly-targeted therapy for patient selection, monitoring, and management.
(17) The other surprising finding in the present invention is that CSE1L is localized in microvesicle membrane, and anti-CSE1L antibodies can target tumor. The shedding microvesicles are widespread on the membrane of tumor cells and the shed microvesicles may remain in the extracellular environment around tumor cells; hence, microvesicle membrane proteins may be the potential targets for cancer therapy. Therefore, the localization of CSE1L in microvesicle membrane indicates that CSE1L may be a therapeutic target for cancer. A significant limitation in molecularly-targeted therapy is that not all patients can receive targeted therapy since the patient's tumor may not express the target that the therapy is being directed to. Also, tumor-related mortality may still occur in targeted therapy due to the proliferation of the target-negative tumor cell population. Shedding microvesicles of specific composition may be loaded with drugs addressed with high precision to unique cellular targets (Cocucci et al. 2009). Microvesicles generation/shedding should be the common feature occurs in tumors (Simak et al. 2006; Cocucci et al. 2009; van Doormaal et al. 2009; Muralidharan-Chari et al. 2010). Therefore, CSE1L may be a potential target for the development of targeted therapy for most cancer patients.
(18) Certain aspects of the present invention are based on the finding that microvesicles are released from tumor cells and circulating in bodily fluids. The number of microvesicles increases as the tumor grows. The concentration of the microvesicles in bodily fluids is proportional to the corresponding tumor load. The bigger the tumor load, the higher the concentration of microvesicles in bodily fluids.
(19) Certain aspects of the present invention are based on another surprising finding that CSE1L and phosphorylated CSE1L are present in microvesicles. The other surprising finding in the present invention is that phosphorylated CSE1L are present in bodily fluid of a subject.
(20) Certain aspects of the present invention are based on another surprising finding that CSE1L and phosphorylated CSE1L are microvesicle membrane protein.
(21) Another aspect of the present invention relates to methods or kits for isolation or analysis of microvesicles from the body fluid. Based on the finding that CSE1L and phosphorylated CSE1L are microvesicle membrane protein. And microvesicles play essential physiological/pathological roles including the progression of many diseases. Methods or kits comprising CSE1L-binding agent or phosphorylated CSE1L-binding agent can be used for capture, purified, isolation, detection, or analysis the microvesicles from the body fluid or any biological samples such as culture conditioned media. Methods or kits comprising CSE1L-binding agent or phosphorylated CSE1L-binding agent for microvesicle isolation or analysis for which the inventions described herein are applicable include, but are not limited to, for example ultracentrifugation, immunoprecipitation, affinity purification, microfiltration, FACS (fluorescence activated cell sorter), ELISA (enzyme-linked immunosorbent assay), microarray, biochips, chromatography, Western blotting, microfluidic systems, microfluidic chip, and other techniques involving immunological binding.
(22) In another preferred embodiment of the invention, the detection or analysis of microvesicles is performed using an optical method. Any optical method may be used. Preferred optical methods comprise microscopy, confocal microscopy, fluorescence microscopy, internal reflection fluorescence microscopy, ellipsometry/reflectometry, light scattering or surface plasmon microscopy.
(23) Certain aspects of the present invention are based on the surprising finding that CSE1L and phosphorylated CSE1L are microvesicle membrane protein and CSE1L-binding agent or phosphorylated CSE1L-binding agent such as anti-CSE1L antibodies can target tumor as shown in Example 10. Methods or kits comprising CSE1L-binding agent or phosphorylated CSE1L-binding agent can be used for medical imaging of disease.
(24) Certain aspects of the present invention are based on the surprising finding that CSE1L and phosphorylated CSE1L are microvesicle membrane protein and CSE1L-binding agent or phosphorylated CSE1L-binding agent such as anti-CSE1L antibodies can target tumor as shown in Example 10. Methods or kits comprising CSE1L-binding agent or phosphorylated CSE1L-binding agent conjugated with a therapeutic agents or cytotoxic agent, as well as pharmaceutical compositions and kits comprising CSE1L-binding agent or phosphorylated CSE1L-binding agent can be used for disease treatment.
(25) One aspect of the present invention relates to methods and kits for diagnosing or monitoring a disease in a subject by determining the amount of CSE1L or phosphorylated CSE1L in microvesicles or in fluids obtained from a biological sample. The determination may be performed using the biological sample without first isolating the microvesicles or by isolating the microvesicles first.
(26) Another aspect of the present invention relates to methods or kits for diagnosing or monitoring a disease or other medical condition in a subject comprising the steps of isolating microvesicles from a bodily fluid of a subject, and analyzing CSE1L or phosphorylated CSE1L in the microvesicles. The CSE1L or phosphorylated CSE1L are analyzed qualitatively and/or quantitatively, and the results are compared to results expected or obtained for one or more other subjects who have or do not have the disease or other medical condition as the controls. The presence of a difference in microvesicular CSE1L or microvesicular phosphorylated CSE1L content of the subject, as compared to that of the controls, can indicate the presence or absence of, the progression of (e.g., changes of tumor size and tumor malignancy), or the susceptibility to a disease or other medical condition in the subject.
(27) Another aspect of the present invention relates to methods or kits for diagnosing or monitoring a disease or other medical condition in a subject comprising the steps of collecting biological fluids of a subject, and analyzing phosphorylated CSE1L in the biological fluids. The phosphorylated CSE1L are analyzed qualitatively and/or quantitatively, and the results are compared to results expected or obtained for one or more other subjects who have or do not have the disease or other medical condition as the controls. The presence of a difference in phosphorylated CSE1L content of the subject, as compared to that of the controls, can indicate the presence or absence of, the progression of (e.g., changes of tumor size and tumor malignancy), or the susceptibility to a disease or other medical condition in the subject.
(28) Microvesicles play essential pathological roles in the progression of various diseases. Diseases or other medical conditions for which the inventions described herein are applicable include, but are not limited to, coagulation diseases, atherosclerosis, coronary diseases, diabetes, hematologic diseases, inflammatory diseases, neurologic diseases, autoimmune diseases, infectious diseases, and cancer. The elevation of circulating microvesicles has been demonstrated in plasma of patients with exacerbated multiple sclerosis (MS). In these patients, microvesicles defined as of endothelial origin were significantly increased when compared with healthy control subjects (Simak et al. 2006). Elevation of circulating microvesicles was also documented in acute cerebrovascular syndromes. An increase of platelet microvesicles was shown in patients with transient ischemic attacks and lacunar infarcts (Simak et al. 2006). In coagulation diseases, endothelial cell membrane microparticles (microvesicles) were found elevated in patients with coronary artery disease when compared with healthy control subjects (Simak et al. 2006). The association of MPs in blood with high blood pressure or postprandial triglyceridemia was also studied. Both endothelial CD31-positive/CD42-negative microvesicles and platelet CD41-positive microvesicles were significantly elevated in patients with severe hypertension (Simak et al. 2006). A role of microvesicles-facilitated intercellular transport of CD81, a co-receptor in B- and T-cell activation and a candidate receptor for hepatitis C virus infection, has been indicated in immunomodulation of hepatitis C virus infection (Simak et al. 2006). Microparticles may influence sensitivity of cells to pathogens such as HIV-1 by facilitating intercellular transfer of specific receptors. The chemokine receptor CCR5, the principal coreceptor for macrophage-tropic HIV-1, can be released through (microvesicles) from the surface of CCR5-positive peripheral blood mononuclear cells. Microparticles containing CCR5 can transfer this receptor to CCR5-negative cells and render them CCR5-positive. The CCR5 transfer to CCR5 peripheral blood mononuclear cells enabled infection of these cells with macrophage-tropic HIV-1 (Simak et al. 2006). Platelet microvesicles were elevated in patients with type 2 diabetes mellitus (Simak et al. 2006). Especially, monocyte microvesicles were highly elevated in patients with diabetic nephropathy and could be an indication of vascular complications in diabetes (Simak et al. 2006). Sustained elevated amounts of circulating procoagulant platelet microvesicles after acute myocardial infarction in diabetic patients, which were higher than in myocardial infarction nondiabetic patients (Simak et al. 2006). Microvesicles in blood have been extensively studied in thrombotic thrombocytopenic purpura, a hematologic disease. Elevated platelet microvesicles associated with calpain activity have been documented in plasma of patients with thrombotic thrombocytopenic purpura (Simak et al. 2006). Indeed, endothelial microvesicles in blood from patients with acute thrombotic thrombocytopenic purpura showed counts markedly elevated compared with healthy control subjects, but values returned to normal in remission (Simak et al. 2006). Also, it was shown that red blood cells from patients with paroxysmal nocturnal hemoglobinuria released significantly fewer microvesicles in vitro upon stimulation with a calcium ionophore when compared with healthy control subjects (Simak et al. 2006). In patients with stage IV gastric cancer, platelet microvesicles were significantly elevated when compared with patients with stage I or II/III. Platelet microvesicles count had also more than 90% sensitivity and specificity in the prediction of distant metastasis in these patients (Simak et al. 2006). In inflammatory diseases and autoimmune diseases, a possible use of endothelial microvesicle for the diagnosis and monitoring of activity in the systemic vasculitis was found (Simak et al. 2006). Another example is rheumatoid arthritis where elevated levels of platelet microvesicle in blood were associated with the rheumatoid arthritis disease activity (Simak et al. 2006). Elevated microvesicle of endothelial origin, were found in patients with lupus anticoagulant (Simak et al. 2006).
(29) The present invention also discloses methods for cancer diagnosis and treatment. A cancer in an animal refers to the presence of cells possessing characteristics typical of cancer-causing cells, such as uncontrolled proliferation, immortality, metastatic potential, rapid growth and proliferation rate, and certain characteristic morphological features and cellular markers. In some circumstances, cancer cells are in the form of a tumor, but they may also exist alone within an animal, or circulate in the blood stream as independent cells, such as leukemic cells. Cancer can be any kind of cancer. Examples of different types of cancer include, but are not limited to, lung cancer (e.g., non-small cell lung cancer); digestive and gastrointestinal cancers such as colorectal cancer, gastrointestinal stromal tumors, gastrointestinal carcinoid tumors, colon cancer, rectal cancer, anal cancer, bile duct cancer, small intestine cancer, and stomach (gastric) cancer; esophageal cancer; gallbladder cancer; liver cancer; pancreatic cancer; appendix cancer; breast cancer; ovarian cancer; renal cancer (e.g., renal cell carcinoma); cancer of the central nervous system; skin cancer; lymphomas; choriocarcinomas; head and neck cancers; osteogenic sarcomas; and blood cancers. As used herein, a tumor comprises one or more cancerous cells.
(30) The present invention also discloses detection of phosphorylated CSE1L by binding of an antibody that specifically recognizes phosphorylated CSE1L protein. The phosphorylated CSE1L can be serine phosphorylated CSE1L, threonine phosphorylated CSE1L, or tyrosine phosphorylated CSE1L. The antibodies can be chimeric, humanized, or fully human antibodies. The antibodies can be monoclonal antibodies, polyclonal antibodies, a single-chain antibody, a single chain Fv antibody, an Fab antibody, an Fab antibody, an (Fab).sub.2 antibody, or a fully human antibody.
(31) The microvesicles in biological fluid samples. As used herein, biological fluid samples refers to a sample of fluid isolated from anywhere in the body of the subject, including but not limited to, for example, blood, serum, plasma, urine, lymph fluid, spinal fluid, sputum, pleural fluid, fine needle aspirate, nipple aspirates, fluid of the respiratory, intestinal, and genitourinary tracts, breast milk, tear fluid, saliva, fluid from the lymphatic system, semen, intra-organ system fluid, cerebrospinal fluid, ascitic fluid, amniotic fluid, and tumor cyst fluid. Biological fluid samples also refers to culture conditioned media and cells in the culture conditioned media. Particularly preferred biological samples are blood, urine, and conditioned media. Microvesicles in biological fluid sample also refer to microvesicles that are associated with the membrane of a cell that is presented in the biological fluid sample. Conditioned media is media that cells have been cultured in for a period of time as opposed to media fresh out of the bottle.
(32) The term subject refers to all animals shown to or expected to have microvesicles. The animal includes a mammal, and preferably a human.
(33) The term normal subject refers to the subject that is free of cancer or other diseases.
(34) A test subject is a subject being tested.
(35) The term medical condition refers to the condition of a disease in the body of an organism.
(36) The term immunological techniques refers to any assay involving antibody-based detection techniques including, without limitation, dot blot, Western blotting, immunoprecipitation, and direct and competitive ELISA and RIA techniques.
(37) As used herein, dot blot refers to an analytical procedure in which a sample are attached to and immobilized in single-stranded form on the surface of a paper, glass fiber, or plastic sheet and the presence of the protein is determined by various methods which may create visible signals, including hybridization to a directly or indirectly labeled antibody.
(38) The term tumor targeting refers to the ability of a compound to preferentially associate with tumors (e.g., cancerous, pre-cancerous, and/or benign). A tumor targeting pharmaceutical composition is pharmaceutical composition which preferentially binds to or associates with tumor tissues, as compared to non-tumor tissues.
(39) The term medical imaging refers to the technique and process used to create images of the human body for clinical purposes (medical procedures seeking to reveal, diagnose, or examine disease) or medical science (including the study of normal anatomy and physiology in animal models of research).
(40) A therapeutic agent is an agent that exerts a cytotoxic, cytostatic, or immunosuppressive effect on cancer cells.
(41) A cytotoxic effect refers to the depletion, elimination and/or the killing of a target cell. A cytotoxic agent refers to an agent that has a cytotoxic effect on a cell.
(42) The term antibody as used herein refers to (a) immunoglobulin polypeptides and immunologically active portions of immunoglobulin polypeptides (i.e., polypeptides of the immunoglobulin family, or fragments thereof, that contain an antigen binding site that immunospecifically binds to a specific antigen (e.g., CSE1L), or (b) conservatively substituted derivatives of such immunoglobulin polypeptides or fragments that immunospecifically bind to the antigen (e.g., CSE1L).
(43) The antibodies can be generated by methods known in the art. For example, monoclonal antibodies can be prepared using a wide variety of techniques including, e.g., the use of hybridoma, recombinant, and phage display technologies, or a combination thereof.
(44) Cancer therapy refers to the technique, process, or substance that can control the growth, invasion, metastasis, or mortality of cancer.
(45) The binding reaction between microvesicles and the CSE1L antibodies or phosphorylated CSE1L antibodies can be detected using immunoassay principles. In typical immunoassays, either protein or antibody is immobilized and detection is achieved after separating un-reacted components. Methods for immobilizing cells or antibodies are known. For example, they can be immobilized directly onto solid phase by chemical linking or physical adsorption. Alternatively, when an antibody of the present invention is biotinylated, it is also possible to indirectly immobilize the antibody onto a solid phase which has adsorbed avidin, streptavidin, or the like. When an antibody is bound to magnetic particles, not only the antibody but also cells bound to the antibody can be quickly and conveniently detected and isolated using a magnet. Alternatively, when using an antibody that recognizes multiple antigens, such as a multispecific antibody, the antibody is bound to CSE1L or phosphorylated CSE1L on microvesicles, and then other antigens can be bound to the antibody. Alternatively, antibodies can be immobilized onto a solid phase via protein A or G or the like.
(46) The timing of antibody immobilization is not particularly limited and an antibody may be immobilized before, after, or simultaneously upon contact with a sample. An arbitrary solid phase may be used to immobilize the antibodies. Such solid phases include membranous, particulate, or fibrous carriers, which are made of glass; organic polymers such as polystyrene; and inorganic materials such as silica gel, alumina, and activated carbon. For example, the antibodies of the present invention may be immobilized onto the inner wall of a reaction container such as a plate, dish, and test tube, or to a bead.
(47) Immunological methods for detecting or quantifying microvesicles using the antibodies of the present invention for detecting microvesicles include, but not limited to, for example, fluorescence antibody methods (see Monoclonal Antibodies: Principle and Practice, 3rd ed. (1996) Academic Press), ELISAs, RIAs, immunohistochemical staining such as immunocytological staining and immunohistological staining, (see, for example, the ABC method and CSA method; Monoclonal Antibodies: Principle and Practice, 3rd ed. (1996) Academic Press), Western blotting, and immunoprecipitation.
(48) The term average amount as used herein is calculated by determining the levels or concentrations of CSE1L or phosphorylated CSE1L present in one or more samples and then calculates the average value of the levels. An average may be determined by summing a plurality of individual values and dividing by the number of values. The term average amount of CSE1L in micorvesicles used herein refers to an average amount of CSE1L protein in micorvesicles in one or more control biological fluid samples. The term average amount of phosphorylated CSE1L in micorvesicles used herein refers to an average amount of phosphorylated CSE1L protein in micorvesicles in one or more control biological fluid samples. The term average amount of phosphorylated CSE1L in the control biological fluid samples used herein refers to an average amount of phosphorylated CSE1L protein in one or more control biological fluid samples. An increased amount as used herein refers to a positive change in amount from the control samples. An increase is typically at least 10%, or at least 20%, or 50%, or 100%, or at least 2-fold, or at least 5-fold, and can be as high as at least 10-fold or even 20-fold.
(49) As used herein, the term cutoff value or cut-off value refers to a threshold value which distinguishes subjects suffering from a disease or condition from subjects who are not suffering from the disease or condition. Cutoff value is a statistically derived optimal number for using as a diagnostic tool wherein a mean and standard deviation (SD) of test values are calculated from a group of read-out values from a category of patients. When a patient's test value is less than this cutoff value the patient may be considered negative (i.e. without cancer) and when a value is greater than or equal to cutoff value then the patient is considered positive (i.e. with cancer).
(50) A pharmaceutical composition as used herein, refers to the combination of one or more drug substances and one or more excipients.
(51) As used herein, the term pharmaceutical excipient, diluent or carrier includes any of the standard pharmaceutical excipient, diluent or carrier, such as a phosphate buffered saline solution, water, emulsions such as an oil/water or water/oil emulsion, and various types of wetting agents. The term also encompasses any of the agents approved by a regulatory agency of the US Federal government or listed in the US Pharmacopeia for use in animals, including humans.
(52) The term treating may be taken to mean prophylaxis of a specific disorder, disease or condition, alleviation of the symptoms associated with a specific disorder, disease or condition and/or prevention of the symptoms associated with a specific disorder, disease or condition.
(53) As used herein, a kit refers to one or more items, including, but not limited to, compounds, compositions, combinations, instruments and devices, suitably packaged for use. Kits provided herein optionally contain instructions for use.
(54) In addition, the kit may include instructional materials containing directions (i.e., protocols) for the practice of the methods of this invention. While the instructional materials typically comprise written or printed materials, they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to, electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. Such media may include links to Internet sites that provide such instructional materials.
(55) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are described herein. As used herein, each of the terms has the meaning associated with it in this section.
(56) It should be understood that this invention is not limited to the particular methodologies, protocols and reagents, described herein and as such may vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which is defined solely by the claims.
(57) The CSE1L protein and its gene are known in the art. The DNA sequences of CSE1L gene (GenBank accession no. U33286) are shown below:
(58) TABLE-US-00001 SEQIDNO:1 1 gtcgcgccattttgccggggtttgaatgtgaggcggagcggcggcaggagcggatagtgc 61 cagctacggtccgcggctggggttccctcctccgtttctgtatccccacgagatcctata 121 gcaatggaactcagcgatgcaaatctgcaaacactaacagaatatttaaagaaaacactt 181 gatcctgatcctgccatccgacgtccagctgagaaatttcttgaatctgttgaaggaaat 241 cagaattatccactgttgcttttgacattactggagaagtcccaggataatgttatcaaa 301 gtatgtgcttcagtaacattcaaaaactatattaaaaggaactggagaattgttgaagat 361 gaaccaaacaaaatttgtgaagccgatcgagtggccattaaagccaacatagtgcacttg 421 atgcttagcagcccagagcaaattcagaagcagttaagtgatgcaattagcattattggc 481 agagaagattttccacagaaatggcctgacttgctgacagaaatggtgaatcgctttcag 541 agtggagatttccatgttattaatggagtcctccgtacagcacattcattatttaaaaga 601 taccgtcatgaatttaagtcaaacgagttatggactgaaattaagcttgttctggatgcc 661 tttgctttgcctttgactaatctttttaaggccactattgaactctgcagtacccatgca 721 aatgatgcctctgccctgaggattctgttttcttccctgatcctgatctcaaaattgttc 781 tatagtttaaactttcaggatctccctgaattttgggaaggtaatatggaaacttggatg 841 aataatttccatactctcttaacattggataataagcttttacaaactgatgatgaagag 901 gaagccggcttattggagctcttaaaatcccagatttgtgataatgccgcactctatgca 961 caaaagtacgatgaagaattccagcgatacctgcctcgttttgttacagccatctggaat 1021 ttactagttacaacgggtcaagaggttaaatatgatttgttggtaagtaatgcaattcaa 1081 tttctggcttcagtttgtgagagacctcattataagaatctatttgaggaccagaacacg 1141 ctgacaagtatctgtgaaaaggttattgtgcctaacatggaatttagagctgctgatgaa 1201 gaagcatttgaagataattctgaggagtacataaggagagatttggaaggatctgatatt 1261 gatactagacgcagggctgcttgtgatctggtacgaggattatgcaagttttttgaggga 1321 cctgtgacaggaatcttctctggttatgttaattccatgctgcaggaatacgcaaaaaat 1381 ccatctgtcaactggaaacacaaagatgcagccatctacctagtgacatctttggcatca 1441 aaagcccaaacacagaagcatggaattacacaagcaaatgaacttgtaaacctaactgag 1501 ttctttgtgaatcacatcctccctgatttaaaatcagctaatgtgaatgaatttcctgtc 1561 cttaaagctgacggtatcaaatatattatgatttttagaaatcaagtgccaaaagaacat 1621 cttttagtctcgattcctctcttgattaatcatcttcaagctggaagtattgttgttcat 1681 acttacgcagctcatgctcttgaacggctctttactatgcgagggcctaacaatgccact 1741 ctctttacagctgcagaaatcgcaccgtttgttgagattctgctaacaaaccttttcaaa 1801 gctctcacacttcctggctcttcagaaaatgaatatattatgaaagctatcatgagaagt 1861 ttttctctcctacaagaagccataatcccctacatccctactctcatcactcagcttaca 1921 cagaagctattagctgttagtaagaacccaagcaaacctcactttaatcactacatgttt 1981 gaagcaatatgtttatccataagaataacttgcaaagctaaccctgctgctgttgtaaat 2041 tttgaggaggctttgtttttggtgtttactgaaatcttacaaaatgatgtgcaagaattt 2101 attccatacgtctttcaagtgatgtctttgcttctggaaacacacaaaaatgacatcccg 2161 tcttcctatatggccttatttcctcatctccttcagccagtgctttgggaaagaacagga 2221 aatattcctgctctagtgaggcttcttcaagcattcttagaacgcggttcaaacacaata 2281 gcaagtgctgcagctgacaaaattcctgggttactaggtgtctttcagaagctgattgca 2341 tccaaagcaaatgaccaccaaggtttttatcttctaaacagtataatagagcacatgcct 2401 cctgaatcagttgaccaatataggaaacaaatcttcattctgctattccagagacttcag 2461 aattccaaaacaaccaagtttatcaagagttttttagtctttattaatttgtattgcata 2521 aaatatggggcactagcactacaagaaatatttgatggtatacaaccaaaaatgtttgga 2581 atggttttggaaaaaattattattcctgaaattcagaaggtatctggaaatgtagagaaa 2641 aagatctgtgcggttggcataaccaacttactaacagaatgtcccccaatgatggacact 2701 gagtataccaaactgtggactccattattacagtctttgattggtctttttgagttaccc 2761 gaagatgataccattcctgatgaggaacattttattgacatagaagatacaccaggatat 2821 cagactgccttctcacagttggcatttgctgggaaaaaagagcatgatcctgtaggtcaa 2881 atggtgaataaccccaaaattcacctggcacagtcacttcacatgttgtctaccgcctgt 2941 ccaggaagggttccatcaatggtgagcaccagcctgaatgcagaagcgctccagtatctc 3001 caagggtaccttcaggcagccagtgtgacactgctttaaactgcatttttctaatgggct 3061 aaacccagatggtttcctaggaaatcacaggcttctgagcacagctgcattaaaacaaag 3121 gaagttttccttttgaacttgtcacga
(59) The amino acid sequences of the CSE1L protein (Protein ID Accession No. AAC50367.1) are shown below:
(60) TABLE-US-00002 SEQIDNO:2 MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQNYPL LLLTLLEKSQDNVIKVCASVTFKNYIKRNWRIVEDEPNKICEADRVAIKA NIVHLMLSSPEQIQKQLSDAISIIGREDFPQKWPDLLTEMVNRFQSGDFH VINGVLRTAHSLFKRYRHEFKSNELWTEIKLVLDAFALPLTNLFKATIEL CSTHANDASALRILFSSLILISKLFYSLNFQDLPEFWEGNMETWMNNFHT LLTLDNKLLQTDDEEEAGLLELLKSQICDNAALYAQKYDEEFQRYLPRFV TAIWNLLVTTGQEVKYDLLVSNAIQFLASVCERPHYKNLFEDQNTLTSIC EKVIVPNMEFRAADEEAFEDNSEEYIRRDLEGSDIDTRRRAACDLVRGLC KFFEGPVTGIFSGYVNSMLQEYAKNPSVNWKHKDAAIYLVTSLASKAQTQ KHGITQANELVNLTEFFVNHILPDLKSANVNEFPVLKADGIKYIMIFRNQ VPKEHLLVSIPLLINHLQAGSIVVHTYAAHALERLFTMRGPNNATLFTAA EIAPFVEILLTNLFKALTLPGSSENEYIMKAIMRSFSLLQEAIIPYIPTL ITQLTQKLLAVSKNPSKPHFNHYMFEAICLSIRITCKANPAAVVNFEEAL FLVFTEILQNDVQEFIPYVFQVMSLLLETHKNDIPSSYMALFPHLLQPVL WERTGNIPALVRLLQAFLERGSNTIASAAADKIPGLLGVFQKLIASKAND HQGFYLLNSIIEHMPPESVDQYRKQIFILLFQRLQNSKTTKFIKSFLVFI NLYCIKYGALALQEIFDGIQPKMFGMVLEKIIIPEIQKVSGNVEKKICAV GITNLLTECPPMMDTEYTKLWTPLLQSLIGLFELPEDDTIPDEEHFIDIE DTPGYQTAFSQLAFAGKKEHDPVGQMVNNPKIHLAQSLHMLSTACPGRVP SMVSTSLNAEALQYLQGYLQAASVTLL
(61) The amino acid sequence of the phosphopeptide used to produce antibodies specific to phosphorylated CSE1L (Protein ID Accession No. AAC50367.1) are shown below:
(62) SEQ ID NO: 3, LTpEYpLKKTLDPDPAC (Tp denotes phosphothreonine and Yp denotes phosphotyrosine)
(63) SEQ ID NO: 4, LTEYLKKTLDPDPAC.
EXAMPLE
(64) Testing Materials and Methods
(65) Antibodies
(66) The antibodies used in the experiment were anti-p21/ras (EP1125Y) (Epitomics, Burlingame, Calif., USA); anti-CSE1L (3D8) and anti-MAPK1/MAPK3 (phospho T202/204, G15-B) (Abnova, Taipei, Taiwan); anti-CSE1L (24), anti-phosphotyrosine (PY20), and anti-phosphoserine/threonine (22A/pSer/Thr) (BD Pharmingen, San Diego, Calif., USA); anti--tubulin (D66) (Sigma, St. Louis, Mo., USA); anti--actin (Ab-5) and anti-GFP (Ab-1) (Lab Vision, Fremont, Calif., USA); anti-MMP-2 (H-76) and anti-phosphothreonine (H2) (Santa Cruz Biotechnology, Santa Cruz, Calif., USA); goat anti-mouse IgG (Jackson ImmunoResearch Laboratories, West Grove, Pa., USA); and goat anti-mouse (or anti-rabbit) IgG secondary antibodies coupled to Alexa Fluor 488 (or 568) (Molecular Probes, Eugene, Oreg., USA).
(67) Plasmids
(68) v-H-Ras (pZIP-v-H-ras) expression vector carrying a neomycin selectable marker was kindly provided by Dr. Channing J Der. Mammalian CSE1L expression vector, pcDNA-CSE1L, carrying a neomycin selectable marker was generated by inserting CSE1L cDNA (as an Apa I and Not I fragment from pGEM-CSE1L vector) into the Apa I and Not I sites of the pcDNA3.1 vector. The CSE1L shRNA plasmids (sc-29909-SH) designed to knockdown CSE1L expression, and the control shRNA plasmids (sc-108060) encode of a scrambled shRNA sequence that will not lead to the specific degradation of any cellular message were ordered from Santa Cruz Biotechnology (Santa Cruz). The CSE1L shRNA plasmids and the control shRNA plasmids carry the puromycin selectable marker.
(69) Cells and DNA Transfections
(70) B16F10 melanoma cells were obtained from the American Type Culture Collection (Manassas, Va., USA). Cells were cultured in Dulbecco's modified Eagle's medium supplemented with 10% heat-inactivated fetal bovine serum, 100 units/ml of penicillin, 100 mg/ml of streptomycin, and 2 mmol/L of glutamate at 37 C. under a humidified 5% CO.sub.2 atmosphere. B16F10 cells were transfected with the control pZIP-NeoSV(X)1 empty vector plus control shRNA plasmids, pZIP-v-H-ras plus control shRNA plasmids, pcDNA-CSE1L plus control shRNA plasmids, and pZIP-v-H-ras plus CSE1L shRNA plasmids to obtain B16-dEV, B16-Ras, B16-CSE1L, and B16-Ras/anti-CSE 1L cells, respectively, by using the Lipofectamine plus reagent (Invitrogen, Carlsbad, Calif., USA) according to the manufacturer's instructions. Transfected cells were selected with 1 mg/ml G418 for 3 weeks then with 1 g/ml puromycin for 3 weeks. Multiple drug-resistant colonies (>50) were pooled together and amplified in mass culture. The transfected cells were maintained in media containing 200 g/ml G418 and 0.2 g/ml puromycin; for the experiments, cells were cultured in medium without G418 and puromycin.
(71) Immunoblotting
(72) Cells were washed with phosphate-buffered saline (PBS) and lysed in ice-cold radioimmunoprecipitation assay (RIPA) buffer [25 Mm Tris-HCl (pH 7.2), 0.1% SDS, 0.1% Triton X-100, 1% sodium deoxycholate, 150 mM NaCl, 1 mM EDTA, 1 mM sodium orthovanadate, 1 mM phenylmethylsulfonyl fluoride, 10 g/ml aprotinin, 5 g/ml leupeptin, 25 mM -glycerophosphate, 5 mM sodium orthovanadate, and 5 mM sodium fluoride]. The protein concentrations were determined with a BCA protein assay kit (Pierce, Rockford, Ill., USA). Fifty micrograms of each protein sample was loaded onto SDS-polyacrylamide gel. Proteins were transferred to nitrocellulose membranes (Amersham Pharmacia, Buckinghamshire, UK). The membrane was blocked in blocking buffer [1% bovine serum albumin (BSA), 50 mM Tris-HCl (pH 7.6), 150 mM NaCl, and 0.1% Tween-20] at room temperature for 1 h. The blots were then incubated with primary antibodies at 4 C. overnight followed by incubation with secondary antibodies conjugated to horseradish peroxidase for 1 h. The levels of protein were detected by Forte Western HRP Substrate (Millipore Corp., Billerica, Mass., USA) according to the manufacturer's instructions.
(73) For Immunoblotting with biotin-conjugated antibodies, the biotin-conjugated antibody was prepared by biotinylating anti-CSE1L antibodies using the Biotin Labeling Kit-NH2 kit according to the manufacturer's protocol (Dojindo Laboratories, Kumamoto, Japan). The Immunoblot was then reacted with horseradish peroxidase (HRP)-conjugated streptavidin and the levels of protein were detected by Forte Western HRP Substrate.
(74) Immunofluorescence and Microvesicle Scoring
(75) Cells grown on glass cover slides (1212 mm) for 4 days were cytospun at 1000 rpm for 10 min. Cells were washed with PBS, fixed with 4% paraformaldehyde, permeabilized with methanol, and blocked with PBS containing 0.1% BSA. Samples were incubated with primary antibodies for 1 h. Samples were then washed three times with PBS and followed by incubating with secondary antibodies coupled to Alexa Fluor 488 (or 568) and examined with a inverted fluorescence microscope. For each experimental condition, cells that showed microvesicles at the surface were scored. Three hundred cells were observed for each experiment, and the data from three independent experiments are plotted. Standard deviation bars are shown.
(76) Cell Proliferation Assay
(77) Equal numbers of cells (110.sup.4 cells/dish) were seed on 100 mm culture dishes. The media were refreshed every three days. The cell numbers were countered every 24 h by trypan blue exclusion assays after cell seeding. For each time point, three plates of cells were counted, and each plate was only counted once.
(78) Conditioned Medium
(79) Cells were grown to subconfluence, washed with PBS, and changed to medium without fetal bovine serum. After incubation for 48 h, the conditioned medium was collected and the cell numbers were counted. To remove possible suspended cells or cell debris, medium was centrifuged at 10,000 rpm for 10 minutes, after which supernatant was harvested.
(80) Preparation of Microvesicles
(81) Microvesicles were prepared from conditioned media or sera by size exclusion chromatography and ultracentrifugation. Briefly, conditioned media or sera were applied to a Sepharose 2B column (Amersham Biosciences, NJ, USA) equilibrated with PBS. Fractions (1 ml) were collected, and the protein content was monitored by measuring absorbance at 280 nm. The void volume peak material, containing proteins of >50 million kDa, was then centrifuged at 105,000 g for 1 h at 4 C. The pellet contains microvesicles and was resuspended with 50 l of PBS.
(82) Immunoprecipitation
(83) Cells grown on plastic dishes were washed with PBS and incubated in immunoprecipitation lysis buffer [10 mM Tris-HCl (pH 7.4), 10 mM EDTA, 0.4% deoxycholic acid, 0.5% Triton X-100, 1 mM phenylmethylsulfonyl fluoride, 10 g/ml aprotinin, 5 g/ml leupeptin, 25 mM -glycerophosphate, 5 mM sodium orthovanadate, and 5 mM sodium fluoride] at 4 C. for 20 min. Cells were scraped and disrupted by pipetting. The cell lysate was cleared of insoluble materials by centrifugation at 12,000 g for 10 min at 4 C., and the protein concentrations were determined with a BCA protein assay kit (Pierce). Cell lysate (500 g) were incubated with primary antibodies in immunoprecipitation buffer [50 mM Tris-HCl (pH 7.5) and 150 mM NaCl] at 4 C. for 3 h followed by a slurry of protein A/G plus agarose beads (Santa Cruz) and incubated for additional 2 h. The immunoprecipitates were washed with lysis buffer three times and then subjected to SDS-PAGE and immunoblotting with antibodies. Mouse anti-GFP antibodies were used in the control reactions.
(84) For immunoprecipitation with serum samples, sera were incubated in PBS containing agarose-conjugated anti-phosphothreonine antibodies (H2) (Santa Cruz) at 4 C. overnight with slow rotation. The immunoprecipitates were washed with immunoprecipitation lysis buffer three times and then subjected to SDS-PAGE and immunoblotting with anti-CSE1L antibodies. Control immunoprecipitation was performed using agarose-conjugated normal mouse IgG (Santa Cruz).
(85) Production of GST-CSE1L Fusion Protein
(86) GST-CSE1L fusion protein was produced using wheat germ cell-free protein synthesis system according to the method described by ENDEXT technology protocol (CellFree Sciences, Yokohama, Japan). Briefly, the open reading frame of CSE1L in pcDNA-CSE1L vector was cut with restriction enzymes and was subcloned into the wheat germ expression vector pPEU-E01-MCS (CellFree Sciences). Transcription of CSE1L mRNA was performed by adding 2 micrograms of the subcloned plasmid to a tube containing the transcription premix solution (CellFree Sciences). The mixture was incubated at 37 C. for 6 h for transcription reaction. Ten microliters of the mRNA mixture was added into 10 L of wheat germ extract solution (WEPRO 3240, CellFree Sciences) for translation reaction. The translation mixture (20 l) was transferred to the bottom of the well containing SUB-AMIX (CellFree Sciences) to form bilayer with the translation mixture in the lower layer. After incubated at 26 C. for 16 h, the mixture is used for purify of GST-CSE1L fusion protein. GST-CSE1L fusion proteins were purified using glutathione-Sepharose 4B beads and Bulk GST Purification Modules (Amersham Pharmacia). The purified GST-CSE1L fusion protein was cleaved with thrombin and GST was removed by using Amicon Ultra-4 Centrifugal Filter Units (Millipore, Billerica, Mass., USA).
(87) Tissue Microarrays and Immunohistochemistry
(88) Tissue cores from cancer tissue and tissue core from non-cancer tissues in each paraffin block was longitudinally cut and arranged into new paraffin blocks using a manual method of BiosynMatric Handmade Kit (Formosa Transcrip, Kaohsiung, Taiwan) to generate tissue microarrays. Tissue sections (4-m) were stained with hematoxylin and eosin to confirm the presence of morphologically representative areas of the original cancers. Immunohistochemistry was performed by using a 50-fold dilution of anti-CSE1L antibodies (clone 3D8) or anti-MAPK1/MAPK3 (phospho T202/204) antibodies. Immunohistochemical detection was carried out by using a labeled streptavidin-biotin method with the Histostain kit (Zymed, San Francisco, Calif., USA) according to the manufacturer's instructions. Sections were developed with diaminobenzidine, washed with distilled water, and counterstained with Mayer's hematoxylin.
(89) Matrigel-Based Invasion Assay
(90) The Matrigel-based invasion assay was done by using Matrigel (BD Biosciences) and 8 m pore-sized polyvinylpyrrolidone-free polycarbonate filters (Costar, Cambridge, Mass., USA). The filters were coated with Matrigel (1:10 in DMEM) at 4 C. for overnight and 37 C. for additional 2 h. The filters were washed 3 times with DMEM and were placed in the microchemotaxis chambers. The cells were treated with 0.1% trypsin-EDTA, re-suspended in DMEM media containing 10% FBS and then washed with serum-free DMEM media. Cells (310.sup.5) were suspended in DMEM (200 l) and placed in the upper compartment of the chemotaxis chambers. Culture medium (300 l) containing 20% FBS was placed in the lower compartment of the chemotaxis chamber to serve as a source of chemoattractants. After being incubated in the culture incubator for 12 h, the cells on the upper surface of the filter were completely wiped away with a cotton swab. The cells on the lower surface of the filter were fixed in methanol, stained with Liu's A and Liu's B reagents, and then counted under a microscope. Cells invaded to the microchemotaxis chambers were also counted. The assays were repeated three times, and each assay consisted of four replicate of filters for each cell line. For each replicate, the tumor cells in 10 randomly selected fields were determined, and the counts were averaged.
(91) Immunogold Electron Microscopy
(92) Cells were washed with PBS and fixed in a mixture of 0.5% glutaraldehyde and 2% paraformaldehyde in Hepes buffer (pH 6.8) for 15 min and then in 2% paraformaldehyde in Hepes buffer (pH 6.8) at 4 C. for 14 days. Samples were dehydrated with 80% ethanol and infiltrated with increasing concentrations of Lowicryl HM20 resin (Polysciences, Tokyo, Japan). Polymerization of Lowicryl HM20 was performed by UV irradiation (wave-length peak at 360 nm) for 24 h. Ultrathin sections were cut and then mounted on nickel grids coated with 2% Neoprene (Ohken, Tokyo, Japan). After being sunk in 100% ethanol for 3 min, samples were immersed in 0.01 M EDTA (pH 7.2) at 65 C. for 24 h. The samples were washed with PBS three times (5 min/wash) and blocked with PBS containing 1% BSA and 0.1% Tween-20 for 15 min. The samples were incubated with a mixtures of primary antibodies diluted in PBS (1:30) for 1 h, washed with PBS three times (5 min/wash), reacted with 18-nm (or 12-nm) gold-labeled secondary antibodies, followed by washing with PBS three times (5 min/wash). The samples were stained with uranyl acetate and were examined on a Hitachi H-7000 transmission electron microscope (Hitachi, Tokyo, Japan).
(93) Gelatin Zymography Assay
(94) Microvesicles harvested from cell number-standardized conditioned media were resolved using 10% SDS-PAGE containing 1 mg/ml gelatin. The gel was washed twice with 2.5% Triton X-100 for 30 min to remove SDS, and subsequently incubated in buffer containing 50 mM Tris-HCl (pH 7.6), 200 mM NaCl, and 10 mM CaCl.sub.2 at 37 C. for 24 h. The gel was stained with Comassie blue R-250 (0.125% Comassie blue R-250, 50% methanol, 10% acetic acid) for 30 min and destained with destaining solution (20% methanol, 10% acetic acid, 70% ddH.sub.2O) until the clear bands were visualized.
(95) Animal Metastasis Experiment
(96) Male C57BL/6 mice ages between 6-7 (N=18) and 14-15 (N=26) weeks old (National Laboratory Animal Center, Taipei, Taiwan) were housed in an animal holding room under standard conditions (22 C.; 50% humidity; 12-hours light/dark cycle). The experiments included 4 groups (i.e. mice injected with B16-dEV, B16-CSE1L, B16-Ras, and B16-Ras/anti-CSE1L cells), and mice with different age were evenly distributed in the four groups. Each mouse was injected with viable cells (310.sup.4 cells in 100 l PBS/mouse) in the tail vein. The experiment included eleven, fourteen, eight, and eleven mice injected with B16-dEV, B16-CSE1L, B16-Ras, and B16-Ras/anti-CSE1L cells, respectively. Three weeks after injection, the mice were sacrificed and necropsied. The numbers of tumors in lungs were counted by macrography and micrography. Mouse care and experimental procedures were performed following the guideline of the Animal Care Committee of Academia Sinica, Taiwan. There were 3, 10, 4, and 1 mice died three weeks after injected with B16-dEV, B16-CSE1L, B16-Ras, and B16-Ras/anti-CSE1L cells, respectively, and thus were excluded from the statistics. There were 1, 1, 0, and 3 mice injected with B16-dEV, B16-CSE1L, B16-Ras, and B16-Ras/anti-CSE1L cells, respectively, that did not grow tumor in the lungs, and thus were also excluded from the statistics.
(97) Patients and Tumor Samples
(98) Colorectal cancer samples were obtained from 115 consecutive patients who had recently been given a diagnosis at Changhua Christian Hospital, Taiwan at the time of diagnosis with informed consent using IRB-approved guidelines and had not yet been treated. All participants had the study explained to them and gave informed consent by using institutional review board-approved guidelines before any participation. The tumors were graded and categorized according to the sixth edition of the American Joint Committee on Cancer, Cancer Staging Manual. Control health donor serum samples were obtained from 60 healthy individuals (mean age, 61.08.7 years; range, 22-71 years). Serum samples were collected by allowing blood to sit at room temperature for a minimum of 30 min to allow clots to form. To remove any possible suspended cells or cell debris in serum, samples were centrifuged at 10,000 rpm for 10 min, after which supernatants were harvested and stored at 80 C. Baseline characteristics of the patients are shown in Table (Tables 1).
(99) TABLE-US-00003 TABLE 1 Baseline characteristics of the colorectal cancer patients Clinico- pathological Stage I Stage II Stage III Stage IV parameter (n = 13) (n = 43) (n = 43) (n = 16) Mean age 66.0 11.5, 65.4 10.0, 60.3 15.2, 71.1 11.2, (range), year.sup.a 42-84 40-93 28-92 46-87 Sex Male 7 27 27 7 Female 6 16 16 9 Tumor grade.sup.b Grade 1 0 0 2 2 Grade 2 13 41 39 14 Grade 3 0 1 3 0 Lymph node (N.sup.c) and distant metastasis (M.sup.d) N0M0 13 43 0 0 N1M0 0 0 23 0 N2M0 0 0 20 0 N0M1 0 0 0 1 N1M1 0 0 0 15 N2M1 0 0 0 0 .sup.aMean SD. .sup.bGrade 1: well differentiation, Grade 2: moderate differentiation, Grade 3: poor differentiation. .sup.cN0: no regional lymph node metastasis, N1: metastasis in 1-3 regional lymph nodes, N2: metastasis in 4 regional lymph nodes, .sup.dM0: no distant metastasis, M1: distant metastasis.
(100) In Vivo Tumor Imaging
(101) Anti-CSE1L antibodies (clone 24) and anti-mouse IgG were conjugated with quantum dots by using a Qdot 800 Antibody Conjugation Kit (Invitrogen) according to the manufacturer's instructions. Briefly, Qdots are activated with N-Succinimidyl 4-(N-maleimidomethyl) cyclohexane-1-carboxylate (SMCC) and the antibodies were reduced by dithiothreitol. The reduced antibodies were covalently coupled with activated Qdots and the conjugation reactions were quenched with -mercaptoethanol. Conjugates are concentrated by ultrafiltration and purified by size exclusion chromatography. The concentrations of conjugates were determined with a spectrofluorometer.
(102) Male C57BL/6 mice ages between 6-7 weeks were injected with viable B16-CSE1L cells (310.sup.4 cells in 100 l PBS/mouse) in the dorsal skin. Three weeks after tumor inoculation, mice bearing tumor were injected with quantum dots-conjugated anti-CSE1L antibodies or quantum dots-conjugated anti-mouse IgG (500 pmole in 100 l PBS/mouse) into the tail vein. Mice were imaged using a Xenogen IVIS 200 imaging system (Excitation: 525/50 nm; Emission: 832/65 nm) at 0, 1 and 4 h post-injection. The NIR fluorescence images were acquired on a camera.
(103) Production of Antibodies Specific to Phospho-CSE1L
(104) Phosphopeptide, LT.sup.pEY.sup.pLKKTLDPDPAC (T.sup.p denotes phosphothreonine and Y.sup.p denotes phosphotyrosine) (SEQ ID NO: 3), and nonphosphopeptide, LTEYLKKTLDPDPAC (SEQ ID NO: 4), were synthesized using the solid phase method. The phosphorylated peptides were conjugated through the N-terminal cysteine thiol to keyhole limpet haemocyanin (KLH). New Zealand rabbit was immunized five times with the peptides. The immune serum was collected a week after the last immunization. The IgG fractions were purified using a protein G column (Amersham Pharmacia Biotech, Uppsala, Sweden). The antibodies are purified by the phosphorylated peptide affinity column and then with non-phosphopeptide cross-adsorption to remove non-phospho-specific antibodies. The titer and the specificity of the antibodies were tested by ELISA and immunoblotting.
(105) Dot Blots
(106) Equal amount of purified microvesicle suspension (5 l) were applied to nitrocellulose membranes (Amersham Pharmacia) with a 96-well dot-blot manifold apparatus (BRL, Bethesda, Md., USA). The membrane was blocked in blocking buffer [1% bovine serum albumin (BSA), 50 mM Tris-HCl (pH 7.6), 150 mM NaCl, and 0.1% Tween-20] at room temperature for 1 h. The blots were then incubated with primary antibodies at 4 C. overnight followed by incubation with secondary antibodies conjugated to horseradish peroxidase for 1 h. The levels of protein were detected by Forte Western HRP Substrate (Millipore) according to the manufacturer's instructions.
(107) ELISA
(108) Serum samples were plated in duplicates using 96-well Nunc Immunoplate MaxiSorb plates (Nunc, Roskilde, Denmark) at 4 C. overnight. Samples were aspirated and blocked in PBS containing 1% BSA. The blocking buffer was removed and then washed with PBST (0.05% Tween-20 in PBS). Wells were incubated with biotin-conjugated anti-phspho-CSE1L antibodies or biotin-conjugated anti-CSE1L antibodies for 1 h. The biotin-conjugated antibodies were prepared by biotinylating the antibodies using the Biotin Labeling Kit-NH.sub.2 (Dojindo Laboratories, Kumamoto, Japan). Wells were then washed with PBST and reacted with streptavidin-conjugated horseradish peroxidase (R&D Systems, Minneapolis, Minn., USA), followed by incubation with substrate reagent (R&D Systems). For calibration, three blank wells containing PBS were used as the background value, and three blank wells containing PBS but did react with all other ELISA reagents were used as control wells. The absorbance at 450 nm was measured within 30 min with a Thermo Multiskan EX Microplate Photometer (Thermo Fisher Scientific, Waltham, Mass., USA). OD values of sample wells that were higher than the highest OD value of the control wells were considered CSE1L-positive or phospho-CSE1-positive.
(109) Statistical Analysis
(110) Data were analyzed by using the SPSS 14.0 statistic software. Statistical differences were analyzed by two-tailed Fisher's exact test. An -level of 0.01 was considered statistically significant.
EXAMPLES
Example 1. Establishment of Cells Stably Transfected with v-H-ras, CSE1L, and v-H-ras Plus CSE1L shRNA Expressing Plasmids
(111) B16F10 melanoma cells were stably transfected with pZIP-v-H-ras, a retroviral expression vector carrying the v-H-ras coding region to established B16-Ras cells; pcDNA-CSE1L, a viral expression vector carrying the human CSE1L coding region to obtain B16-CSE1L cells; pZIP-v-H-ras plus CSE1L shRNA plasmids to obtain B16-Ras/anti-CSE1L cells. For control, B16-Ras cells and B16-CSE1L cells were also stably transfected with the control shRNA plasmids (pshEV) encode of a scrambled shRNA sequence that will not lead to the specific degradation of any cellular message; B16F10 cells were also stably transfected with the control vectors pshEV and pZIP-NeoSV(X)1 to obtain B16-dEV cells. The results of immunoblotting showed Ras levels were increased in B16-Ras and B16-Ras/anti-CSE1L cells; CSE1L levels were increased in B16-CSE1L cells and were decreased in B16-Ras/anti-CSE1L cells (
(112)
Example 2. v-H-ras Induces Microvesicle Generation of Tumor Cells
(113) The ras oncogene is a key mediator of cell transformation and is present in a wide variety of human cancer; ERK is activated in response to a variety of extracellular stimuli and oncogenic products such as Ras and the ErbB proto-oncogene family, the important targets for molecularly-targeted therapy (Roberts et al. 2007). Microscopic examination showed the surfaces B16-Ras cells were decorated with many bubble-like microvesicles and this was not observed in the surfaces of B16F10 cells and B16-dEV control cells (
(114)
Example 3. v-H-ras Transfection Increases CSE1L Secretion
(115) The results of immunoblotting showed v-H-ras transfection increased CSE1L secretion, and PD98059 treatment attenuated v-H-ras-induced increase in CSE1L secretion of B16F10 cells (
(116)
Example 4. CSE1L is a Serine/Threonine and Tyrosine Phosphorylated Protein
(117) GST-CSE1L fusion protein was synthesized with the wheat germ cell-free protein synthesis system. Immunoblotting showed synthesized CSE1L protein reacted with anti-phosphoserine/threonine and anti-phosphotyrosine antibodies (
(118)
Example 5. v-H-ras Transfection Increased CSE1L Phosphorylation and Phosphorylated CSE1L is Present in Cancer Sera
(119) CSE1L proteins in cell lysates purified from B16-dEV cells, B16-Ras cells, and PD98059-treated B16-Ras cells were immunoprecipitated with anti-CSE1L antibodies. The immunoprecipitates were immunoblotted with HRP (horseradish peroxidase)-conjugated anti-phosphothreonine antibodies. The results showed that v-H-ras transfection in B16F10 cells resulted in increased threonine phosphorylation of CSE1L, and PD98059 treatment inhibited v-H-ras-increased threonine phosphorylation in CSE1L (
(120) The level of threonine phosphorylated CSE1L in the sera of patients with colorectal cancer and healthy donors were analyzed. Serum threonine phosphorylated protein in sera harvested from the colorectal cancer patients (N=36) or healthy donors (N=36) were immunoprecipitated with agarose-conjugated anti-phosphothreonine antibodies. The immunoprecipitates were immunoblotted with anti-CSE1L antibodies. The results showed the presence of threonine phosphorylated CSE1L in the immunoprecipitates from cancer sera samples but not from normal sera samples (
(121)
Example 6. High Expression of Phospho-ERK and CSE1L in Colorectal Cancer and Coincidence in the Relative Staining Intensity of Phospho-ERK with CSE1L in Tumors
(122) The results of tissue microarray immunohistochemistry consists of 115 colorectal cancer specimens showed heavy staining of phospho-ERK (100%, 115/115) and CSE1L (99.1%, 114/115) in the colorectal cancer specimens (
(123)
Example 7. CSE1L Mediates v-H-ras-Induced Microvesicle Biogenesis in Cells
(124) Microscopic examination showed there was no microvesicle present in the surfaces of B16-Ras/anti-CSE1L cells, the CSE1L shRNA plasmid-transfected B16-Ras cells (
(125)
Example 8. CSE1L Mediates the In Vitro Invasion of Tumor Cells Induced by v-H-ras
(126) The results of gelatin zymography assay with microvesicles harvested form the cell number-standardized conditioned media of serum-starved B16-dEV, B16-Ras, B16-CSE1L, and B16-Ras/anti-CSE1L cells treated with or without DMSO or 50 M PD98059 showed that v-H-ras transfection increased the zymographic activity of microvesicular MMP-2, and PD98059 treatment attenuated the v-H-ras-induced increase in the zymographic activity of microvesicular MMP-2 (
(127)
Example 9. CSE1L Mediates v-H-ras-Induced Cancer Cell Metastasis
(128) MMP-2 plays an essential role in tumor invasion (Taraboletti et al. 2002). Immunofluorescence showed CSE1L was colocalized with MMP-2 in microvesicles in the cell surfaces of B16-Ras and B16-CSE1L cells (
(129)
Example 10. CSE1L is Localized in Microvesicle Membrane and Anti-CSE1L Antibodies can Target Tumor
(130) The results of immunofluorescence showed CSE1L was located in microvesicle membrane (
(131)
Example 11. Anti-Phospho-CSE1L Antibody Reacts with Phosphorylated CSE1L
(132) Antibodies specific to phospho-CSE1L was produced by immunizing New-Zealand rabbits with synthetic phosphopeptides designed to correspond to the putative phosphorylation domain of CSE1L. The titer of the affinity purified anti-phospho-CSE1L antibodies were determined by indirect ELISA (Table 2). The results of immunoblotting showed the anti-phospho-CSE1L antibodies react with phosphorylated CSE1L (
(133) Table 2 shows the titer of the affinity purified anti-phospho-CSE1L antibodies determined by indirect ELISA.
(134) TABLE-US-00004 TABLE 2 The titer of the affinity purified anti-phospho- CSE1L antibodies determined by indirect ELISA. Coating peptides Antibody concentration Phosphopeptide Non-phosphopeptide 80 ng/ml 2.129* 0.064 40 ng/ml 0.624 0.054 20 ng/ml 0.201 0.050 10 ng/ml 0.081 0.041 5 ng/ml 0.053 0.041 2.5 ng/ml 0.046 0.037 1.25 ng/ml.sup. 0.043 0.032 PBS 0.035 0.032 *O.D (optical density).
(135)
Example 12. Phosphorylated CSE1L is Localized in Microvesicles
(136) Whether phosphorylated CSE1L was localized in microvesicles was analyzed. The results of immunofluorescence with anti-phospho-CSE1L antibodies showed phosphorylated CSE1L were localized in microvesicles (arrowheads) (
(137)
Example 13. Presence of CSE1L in Microvesicles Isolated from Cancer Sera
(138) Microvesicles were isolated from the sera of colorectal cancer patients and healthy donors. The isolated microvesicles were applied to a 96-well dot-blot manifold (BRL, Bethesda, Md., USA) and the presence of CSE1L in serum microvesicles were assayed with by dot blots with anti-CSE1L antibodies and anti-phospho-CSE1L antibodies. The intensities of the blots were quantified by using an IS-1000 Digital Imaging System (Kaiser Alpha Innotech, USA). The results showed higher prevalence of phosphorylated CSE1L in microvesicles isolated from cancer sera samples than that isolated from normal sera samples. The results also showed higher prevalence of CSE1L in microvesicles isolated from the cancer sera samples than that isolated from normal sera samples. CSE1L was detected in 96.5% ( 111/115) of sera microvesicles from cancer patients and was detected in 6.6% ( 4/60) of serum microvesicles from healthy donors. The P-values were <0.01 between the cancer group and healthy group. With the use of the synthesized CSE1L as a standard, the cut-off value of CSE1L in the serum microvesicles from cancer patients was determined to be 21 ng/ml. The phosphorylated CSE1L was detected in 98.2% ( 113/115) of sera microvesicles from the cancer patients and was detected in 3.3% (2/60) of serum microvesicles from healthy donors. The P-values were <0.01 between the cancer group and healthy group. With the use of the phosphorylated CSE1L peptides as a standard, the cut-off value of phosphorylated CSE1L in the serum microvesicles from cancer patients was determined to be 15 ng/ml.
Example 14. Higher Prevalence of Phosphorylated CSE1L in Sera of Cancer Patients and Assay of Phosphorylated CSE1L in Sera is Superior to Assay of CSE1L for Cancer Diagnosis
(139) The results showed the presence of phosphorylated CSE1L in microvesicles isolated from cancer sera (Example 13). The results of immunoprecipitations also showed the presence of phosphorylated CSE1L in the immunoprecipitates from cancer sera samples but not from normal sera samples (
REFERENCE
(140) 1. Bianco F, Pravettoni E, Colombo A, Schenk U, Mller T, Matteoli M, Verderio C. Astrocyte-derived ATP induces vesicle shedding and IL-1 beta release from microglia. J Immunol 2005; 174:7268-7277. 2. Brinkmann U, Brinkmann E, Gallo M, Pastan I. Cloning and characterization of a cellular apoptosis susceptibility gene, the human homologue to the yeast chromosome segregation gene CSE1. Proc Natl Acad Sci USA 1995; 92:10427-10431. 3. Cocucci E, Racchetti G, Meldolesi J. Shedding microvesicles: artefacts no more. Trends Cell Biol 2009; 19:43-51. 4. Hoshino R, Chatani Y, Yamori T, Tsuruo T, Oka H, Yoshida O, Shimada Y, Ari-i S, Wada H, Fujimoto J, Kohno M. Constitutive activation of the 41-/43-kDa mitogen-activated protein kinase signaling pathway in human tumors. Oncogene 1999; 18:813-822. 5. Muralidharan-Chari V, Clancy J, Plou C, Romao M, Chavrier P, Raposo G, D'Souza-Schorey C. ARF6-regulated shedding of tumor cell-derived plasma membrane microvesicles. Curr Biol 2009; 19:1875-1885. 6. Muralidharan-Chari V, Clancy J W, Sedgwick A, D'Souza-Schorey C. Microvesicles: mediators of extracellular communication during cancer progression. J Cell Sci 2010; 123:1603-1611. 7. Roberts P J, Der C J. Targeting the Raf-MEK-ERK mitogen-activated protein kinase cascade for the treatment of cancer. Oncogene 2007; 26:3291-3310. 8. Scherf U, Kalab P, Dasso M, Pastan I, Brinkmann U. The hCSE1/CAS protein is phosphorylated by HeLa extracts and MEK-1: MEK-1 phosphorylation may modulate the intracellular localization of CAS. Biochem Biophys Res Commun 1998; 250:623-628. 9. Simak J, Gelderman M P. Cell membrane microparticles in blood and blood products: potentially pathogenic agents and diagnostic markers. Transfus Med Rev 2006; 20:1-26. 10. Tai C J, Hsu C H, Shen S C, Lee W R, Jiang M C. Cellular apoptosis susceptibility (CSE1L/CAS) protein in cancer metastasis and chemotherapeutic drug-induced apoptosis. J Exp Clin Cancer Res 2010; 29:110. 11. Taraboletti G, D'Ascenzo S, Borsotti P, Giavazzi R, Pavan A, Dolo V. Shedding of the matrix metalloproteinases MMP-2, MMP-9, and MT1-MMP as membrane vesicle-associated components by endothelial cells. Am J Pathol 2002; 160:673-680. 12. Tung M C, Tsai C S, Tung J N, Tsao T Y, Chen H C, Yeh K T, Liao C F, Jiang M C. Higher prevalence of secretory CSE1L/CAS in sera of patients with metastatic cancer. Cancer Epidemiol Biomarkers Prey 2009; 18:1570-1577. 13. van Doormaal F F, Kleinjan A, Di Nisio M, Bller H R, Nieuwland R. Cell-derived microvesicles and cancer. Neth J Med 2009; 67:266-273.