Pectinases with Improved Thermostability

20190002864 ยท 2019-01-03

    Inventors

    Cpc classification

    International classification

    Abstract

    The invention is in the field of protein chemistry, in particular in the field of enzymology. It provides pectinases, i.e. polypeptides with pectin-degrading properties. In particular the invention provides polypeptides with pectate lyase activity (EC 4.2.2.2). Enzymes according to the invention have improved properties, such as improved thermostability and decreased calcium dependence.

    Claims

    1. A polypeptide with pectate lyase activity, the polypeptide comprising: an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, and a small, polar, non-charged amino acid residue at an amino acid position corresponding to position 235 in SEQ II) NO: 1, and wherein the polypeptide has an improved thermostability.

    2. The polypeptide claim 1, wherein the small, polar, non-charged amino acid residue is selected from the group consisting of amino acids Threonine, Serine, Asparagine and Cysteine.

    3. The polypeptide of claim 1, wherein the small, polar, non-charged amino acid residue is Threonine.

    4. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 75% identical to the amino acid according to SEQ ID NO: 1.

    5. The polypeptide of claim 1, wherein the polypeptide comprises a leucine residue at an amino acid position corresponding to position 231 in SEQ ID NO: 1.

    6. (canceled)

    7. A composition comprising the polypeptide of claim 1.

    8. A nucleic acid encoding the polypeptide of claim 1.

    9. A vector comprising the nucleic acid of claim 8.

    10. A composition comprising the nucleic acid of claim 8.

    11. A recombinant host cell comprising acid of claim 8.

    12. The recombinant host cell of claim 11, wherein the host cell is selected from the group consisting of Escherichia coli, Bacillus, Corynebacterium, Pseudomonas, Pichia pastoris, Saccharomyces cerevisiae, Yarrowia lipolytica, filamentous fungi, yeast and insect cells.

    13. A method for producing the polypeptide of claim 1, the method comprising: culturing the recombinant host cell of claim 11 under conditions suitable for the production of the polypeptide, and recovering the polypeptide obtained, and optionally purifying said polypeptide.

    14. (canceled)

    15. A method for improving the thermostability of a polypeptide with pectate lyase activity comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, the method comprising: altering the amino acid at a position corresponding to position 235 in SEQ ID NO: 1 to a small, polar, non-charged amino acid residue, and optionally altering the amino acid at a position corresponding to position 231 in SEQ ID NO: 1 to a leucine residue.

    16. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 80% identical to the amino acid according to SEQ ID NO: 1.

    17. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 85% identical to the amino acid according to SEQ ID NO: 1.

    18. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 90% identical to the amino acid according to SEQ ID NO: 1.

    19. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 95% identical to the amino acid according to SEQ ID NO: 1.

    20. The polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is identical to the amino acid according to SEQ ID NO: 1.

    21. A composition comprising the vector of claim 9.

    22. A recombinant host cell comprising the vector of claim 9.

    Description

    LEGEND TO THE FIGURES

    [0015] FIG. 1: Diagram showing the relative pectate lyase activity of polypeptides according to SEQ ID NO: 1 (WT) and its K235 variants SEQ ID NO: 2 (K235T), SEQ ID NO: 3 (K2355), SEQ ID NO: 4 (K235N), and SEQ ID NO: 5 (K235C). Pectate lyase activity was determined after a pre-incubation of 10 minutes at elevated temperatures. RT=Room Temperature, 70 C is 70 degrees Celsius.

    [0016] FIG. 2: Diagram showing the relative pectate lyase activity of polypeptides according to SEQ ID NO: 6 (93% identity with SEQ ID NO: 1), and its K235 variants SEQ ID NO: 7 (K235T), SEQ ID NO: 8 (K2355), SEQ ID NO: 9 (K235N), and SEQ ID NO: 10 (K235C). Pectate lyase activity was determined after a pre-incubation of 10 minutes at elevated temperatures. RT=Room Temperature, 70 C is 70 degrees Celsius.

    [0017] FIG. 3: Diagram showing the relative pectate lyase activity of polypeptides according to SEQ ID NO: 11 (89% identity with SEQ ID NO: 1), and its K235 variants SEQ ID NO: 12 (K235T), SEQ ID NO: 13 (K2355), SEQ ID NO: 14 (K235N), and SEQ ID NO: 15 (K235C). Pectate lyase activity was determined after a pre-incubation of 10 minutes at elevated temperatures. RT=Room Temperature, 70 C is 70 degrees Celsius.

    [0018] FIG. 4: Diagram showing the relative pectate lyase activity of polypeptides according to SEQ ID NO: 1 (WT) and its variants A231L, K2355, K235T, A231L+K235S and A231L+K235T. Pectate lyase activity was determined after a pre-incubation of 10 minutes at elevated temperatures. RT=Room Temperature, 70 C is 70 degrees Celsius.

    [0019] FIG. 5: Diagram showing the relative pectate lyase activity of polypeptides according to SEQ ID NO: 6 (93% identical with SEQ ID NO: 1) and its variants A231L, K235N and A231L+K235N. Pectate lyase activity was determined after a pre-incubation of 10 minutes at elevated temperatures. RT=Room Temperature, 70 C is 70 degrees Celsius.

    [0020] FIG. 6: Diagram showing the relative pectate lyase activity of polypeptides according to SEQ ID NO: 11 (89% identical with SEQ ID NO: 1) and its variants A231L, K235C and A231L+K235C. Pectate lyase activity was determined after a pre-incubation of 10 minutes at elevated temperatures, RT=Room Temperature, 70 C is 70 degrees Celsius.

    DETAILED DESCRIPTION OF THE INVENTION

    [0021] The present invention is based on our observation that a single amino acid substitution (K235 variant) in different pectate lyases improves their thermostability,

    [0022] The term amino acid substitution is used herein the same way as it is commonly used, i.e. the term refers to a replacement of one or more amino acids in a protein with one or more other amino acids. Such an amino acid substitution may also be referred to as a mutation, a variation or a variant.

    [0023] We observed the same phenomenon in pectate lyases that were homologous to the polypeptide with an amino acid sequence according to SEQ ID NO: 1. When the same amino acid variations were introduced at position 235 in polypeptides that were 93% and 89% identical to the polypeptide according to SEQ ID NO: 1, this also improved the thermostability of the homologous enzymes.

    [0024] The invention thus relates to a polypeptide with pectate lyase activity comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, wherein the polypeptide comprises a small, polar, non-charged amino acid residue at an amino acid position corresponding to position 235 in SEQ ID NO: 1.

    [0025] Polypeptides with pectate lyase activity are also referred herein as pectate lyases, or pectate lyase enzymes.

    [0026] The term pectate lyase activity is used herein to indicate the ability of a polypeptide to cleave pectin using an eliminative cleavage of (1->4)-alpha-D-galacturonan yielding oligosaccharides with 4-deoxy-alpha-D-galact-4-enuronosyl groups at their non-reducing ends.

    [0027] The term at least 70% is used herein to include at least 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 88%, 87%, 88%, 89%, 90% or more, such as 91%, 92%, 93%, 94%, 95%, 99%, 97%, 98%, 99%, or even 100%.

    [0028] As used herein, the degree of identity between two or more amino acid sequences is equivalent to a function of the number of identical positions shared by the sequences; i.e., % identity=number of identical positions divided by the total number of aligned positions100, excluding gaps, which need to be introduced for optimal alignment of the two sequences, and overhangs. The alignment of two sequences is to be performed over the full length of the polypeptides.

    [0029] The comparison (aligning) of sequences is a routine task for the skilled person and can be accomplished using standard methods known in the art. For example, a freeware conventionally used for this purpose is Align tool at NCBI recourse http://blast.ncbi.nlm.nih.gov/Blast.cgi?PAGE_TYPE=BlastSearch&BLAST_SPEC=blast2s eq&LINK_LOC=align2seq, Other commercial and open software such as Vector NTI are also suitable for this purpose.

    [0030] Introduction of a specific mutation in a recombinant gene is also among the routine skills of a molecular biologist. Specific guidance may be obtained from Methods in Molecular Biology Vol 182, In vitro mutagenesis protocols, Eds Jeff Braman, Humana Press 2002. There are commercially available kits for performing site-directed mutagenesis (for example, QuikChange II XL Site-Directed Mutagenesis kit Agilent Technologies cat No 200521).

    [0031] SEQ ID NO: 1 provides the amino acid sequence of a known polypeptide [Takao et al, Biosci. Biotechnol. Biochem. (2000) 64: 2360-2367, Takao et al., Biosci. Biotechnol. Biochem. (2001) 65: 322-329] with pectate lyase activity. We replaced the lysine residue at position 235 of SEQ ID NO: 1 with a small, polar, non-charged amino acid residue in order to obtain the K235 variants described herein. Exemplified herein are the variants K235T, K235C, K2355 and K235N. This annotation is used herein to indicate a replacement of the amino acid residue corresponding to position 235 of SEQ ID NO: 1 with either one of the residues T (threonine), C (cysteine), S (serine) or N (asparagine), thereby obtaining the polypeptides according to SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, respectively. We found that the thermostability of the enzyme was thereby remarkably improved.

    [0032] The term mutant protein or mutation is also used herein to refer to a polypeptide with pectate lyase activity as described herein, wherein the polypeptide comprises a small, polar, non-charged amino acid residue at an amino acid position corresponding to position 235 in SEQ ID NO: 1.

    [0033] The term wild type protein is also used herein to indicate a polypeptide identical to the mutant protein, with the exception that it does not comprise a small, polar, non-charged amino acid residue at an amino acid position corresponding to position 235 in SEQ ID NO: 1.

    [0034] The term improved thermostability in reference to a mutant polypeptide, as used herein, means that the mutant polypeptide has a higher residual pectate lyase activity than the corresponding wild type protein, after incubation for 10 minutes in 50 mM Tris-HCl pH 8.0 at a suitable temperature.

    [0035] The term suitable temperature as used in this context refers to a temperature at which the wild type protein loses part of its pectate lyase activity after 10 minutes of incubation in 50 mM Tris-HCl pH 8.0. In other words, the term suitable temperature refers to a temperature chosen from a temperature range between temperatures X and Y, wherein X is the lowest temperature at which a wild type polypeptide shows a detectable loss of activity after 10 minutes of incubation in 50 mM Tris-HCl pH 8.0 and wherein temperature Y is the lowest temperature at which a wild type polypeptide loses all activity after 10 minutes of incubation in 50 mM Tris-HCl pH 8.0.

    [0036] More specifically, in the thermostability assay, the polypeptides were heated to 70, 75 or 80 degrees Celsius for 10 minutes in 50 mM Tris-HCl at pH 8.0. The residual activity was measured at 60 degrees Celsius at pH 8.0 as described in example 5 and compared to the residual activity of the same polypeptides after preincubation at room temperature for 10 minutes. The results are shown in FIGS. 1-3.

    [0037] In more detail, we measured the residual relative pectate lyase activity after heat treatment of polypeptides with an amino acid sequence according to SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5 and compared this activity to that of a polypeptide with an amino acid sequence of SEQ ID NO: 1 after the same pre-treatment. We found that the introduction of the K235 mutation improved the thermostability of the pectate lyase enzyme.

    [0038] This phenomenon appeared not to be restricted to the polypeptide with an amino acid sequence according to SEQ ID NO: 1, but was also observed in polypeptides homologous to the polypeptide according to SEQ ID NO: 1. Accordingly, we found that this amino acid position 235 could be changed in polypeptides with an amino acid sequence homologous to the sequence according to SEQ ID NO: 1 with the same effect. We constructed two pectate lyases that were 93% (SEQ ID NO: 6) and 89% (SEQ ID NO: 11) identical with the amino acid sequence according to SEQ ID NO: 1 and found that these two homologous enzymes also had an improved thermostability when the amino acid corresponding to position 235 in SEQ ID NO: 1 was changed to small, polar, non-charged amino acid residue.

    [0039] Whereas the wild type sequence (SEQ ID NO: 1) only displayed 60% of its activity when pre-incubated at 70 degrees Celsius for 10 minutes, the variant polypeptides with the 235 mutation (K235T, K2355, K235N and K235C) were all at least as active as when pre-incubated at room temperature (table 1 and FIG. 1).

    TABLE-US-00001 TABLE 1 Thermostability of SEQ ID NO: 1 and its K235 variants (Residual relative pectate lyase activity after pre-incubation at elevated temperatures). Temp SEQ ID NO: 1 K235T K235S K235N K235C RT 100% 100% 100% 100% 100% 70 C. 60% 110% 110% 105% 100% 75 C. 1% 50% 50% 30% 30% 80 C. 1% 35% 35% 10% 10%

    [0040] Moreover, whereas the wild-type enzyme (WT, SEQ ID NO: 1) was not active anymore after pre-incubation at 75 degrees Celsius for 10 minutes, the K235 variants where active, even up to a level of 50% of the activity of the same enzyme, pre-incubated at room temperature for 10 minutes (FIG. 1).

    [0041] Even more surprisingly, we found that the K235 variants were all able to resist pre-incubation at 80 degrees Celsius for 10 minutes, even up to a level of 35% of the activity of the same enzyme, pre-incubated at room temperature for 10 minutes (FIG. 1).

    [0042] The expression the amino acid corresponding to position 235 in SEQ ID NO: 1 is to be understood as follows. If such a position is to be determined in a given amino acid sequence that is at least 70% identical with the amino acid sequence according to SEQ ID NO: 1, then the two sequences are first to be aligned. That may be done by routine methods and software available in the art. The amino acid in the given amino acid sequence corresponding to amino acid 235 in SEQ ID NO: 1 is then the amino acid aligning with the lysine residue at position 235 in SEQ ID NO: 1.

    [0043] We performed a homology search for proteins homologous to SEQ ID NO: 1 using SEQ ID NO: 1 as the query sequence in the Standard protein BLAST software, available at http://blast.ncbi.nlm.nih.gov/Blast.cgi?PROGRAM=blastp&PAGE_TYPE=BlastSearch&LI NK_LOC=blasthome. More information on the software and database versions is available at the National Center for Biotechnology Information at National library of Medicine at National institute of Health internet site www.ncbi.nlm.nih.gov. Therein, a number of molecular biology tools including BLAST (Basic Logical Alignment Search Tool) is to be found. BLAST makes use of the following databases: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects.

    [0044] There were no polypeptides found comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1.

    [0045] The term amino acid variant, variant, mutant or sequence variant or equivalent has a meaning well recognized in the art and is accordingly used herein to indicate an amino acid sequence that has at least one amino acid difference as compared to another amino acid sequence, such as the amino acid sequence from which it was derived.

    [0046] We also constructed homologous polypeptides, having 93% and 89% sequence identity to the wild type sequence according to SEQ ID NO: 1, These homologous polypeptides are referred to herein as polypeptides according to SEQ ID NO: 6 (93% identical) and SEQ ID NO: 11 (89% identical).

    [0047] We found that K235 variants of these polypeptides also had an improved thermostability (tables 2 and 3 and FIGS. 2 and 3).

    TABLE-US-00002 TABLE 2 Thermostability of SEQ ID NO: 6 and its K235 variants (Residual relative pectate lyase activity after pre-incubation at elevated temperatures) Temp SEQ ID NO: 6 K235T K235S K235N K235C RT 100% 100% 100% 100% 100% 70 C. 70% 100% 105% 100% 105% 75 C. 5% 60% 40% 30% 20% 80 C. 1% 40% 35% 20% 10%

    TABLE-US-00003 TABLE 3 Thermostability of SEQ ID NO: 11 and its K235 variants (Residual relative pectate lyase activity after pre-incubation at elevated temperatures). Temp SEQ ID NO: 11 K235T K235S K235N K235C RT 100% 100% 100% 100% 100% 70 C. 50% 120% 100% 105% 105% 75 C. 1% 45% 40% 25% 35% 80 C. 1% 40% 30% 15% 10%

    [0048] The term improved thermostability as used herein means that the K235 variant polypeptides exhibited more pectate lysase activity after preincubation at elevated temperatures as compared to the activity of the same polypeptides without the mutation at position 235, such as the wild type sequence (SEQ ID NO: 1) or the two homologous polypeptides according to SEQ ID NO: 6 and SEQ ID NO: 11 as described herein.

    [0049] Thermostable pectate lyases have been described to be produced by bacteria of the genus Bacillus [Takao et al, Biosci. Biotechnol. Biochem. (2000) 64: 2360-2367, Takao et al., Biosci. Biotechnol. Biochem. (2001) 65: 322-329, Swarupa Rani Chiliveri et al., Carbohydrate Polymers (2014), 111: 264-272, Zhou et al., Appl Environ Microbiol (2015) 81: 5714-5723], hence in a preferred embodiment the invention relates to a polypeptide as described herein wherein the polypeptide is capable of being expressed in a bacterium, such as a Bacillus species, more preferably Bacillus subtilis.

    [0050] We have shown that several polypeptides may be produced that are homologous to the wild-type sequence and still retain their pectate lyase activity. A BLAST search revealed that pectate lyases are available from bacterial origin, in particular from Bacillus species, with an identity as low as 52% or less as compared to SEQ ID NO: 1. The skilled person will therefore have no difficulty in constructing a polypeptide with pectate lyase activity that is at least 70% identical to the sequence of SEQ ID NO: 1 following the procedures and guidance provided herein. He will also be able to make the K235 variants as described herein, thereby obtaining a pectate lyase with an improved thermostability.

    [0051] In a preferred embodiment, the invention relates to a polypeptide as described herein comprising an amino acid sequence that is at least 75% identical to the amino acid according to SEQ ID NO: 1, such as 80%, 85%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or even 100%.

    [0052] Recovery of a polypeptide according to the invention as produced by a host cell may be performed by any technique known to those skilled in the art. Possible techniques include, but are not limited to secretion of the protein into the expression medium, and purification of the protein from cellular biomass. The production method may further comprise a step of purifying the polypeptide obtained. For thermostable polypeptides, non-limiting examples of such methods include heating of the disintegrated cells and removing coagulated thereto labile proteins from the solution. For secreted proteins, non-limiting examples of such methods include ion exchange chromatography, and ultra-filtration of the expression medium. It is preferred that the purification method of choice is such that the purified protein retains its activity.

    [0053] Accordingly, in a further preferred embodiment, the invention relates to a polypeptide as described herein wherein the polypeptide is an isolated polypeptide.

    [0054] We have shown herein that the K235 variants as described herein have an improved thermostability.

    [0055] The polypeptides as described herein may be used in compositions containing several additional components, such as stabilizers, fillers, cell debris, culture medium etcetera. Hence, the invention provides a composition comprising a polypeptide as described herein.

    [0056] Polypeptides as described herein may be obtained by expressing a recombinant DNA in a heterologous expression system. The term heterologous expression system or equivalent means a system for expressing a DNA sequence from one host organism in a recipient organism from a different species or genus than the host organism. The most prevalent recipients, known as heterologous expression systems, are chosen usually because they are easy to transfer DNA into or because they allow for a simpler assessment of the protein's function. Heterologous expression systems are also preferably used because they allow the upscaling of the production of a protein encoded by the DNA sequence in an industrial process. Preferred recipient organisms for use as heterologous expression systems include bacterial, fungal and yeast organisms, such as for example Escherichia coli, Bacillus, Corynebacterium, Pseudomonas, Pichia pastoris, Saccharomyces cerevisiae, Yarrowia lipolytica, filamentous fungi and many more systems well known in the art.

    [0057] The presently disclosed polypeptides or proteins may be fused to additional sequences, by attaching or inserting, including , but not limited to, affinity tags, facilitating protein purification (S-tag, maltose binding domain, chitin binding domain), domains or sequences assisting folding (such as thioredoxin domain, SUMO protein), sequences affecting protein localization (periplasmic localization signals etc), proteins bearing additional function, such as green fluorescent protein (GFP), or sequences representing another enzymatic activity. Other suitable fusion partners for the presently disclosed polypeptides are known to those skilled in the art.

    [0058] The present invention also relates to polynucleotides encoding any of the pectate lyase variants disclosed herein. Means and methods for cloning and isolating such polynucleotides are well known in the art.

    [0059] Furthermore, the present invention relates to a vector comprising a polynucleotide according to the invention, optionally operably linked to one or more control sequences. Suitable control sequences are readily available in the art and include, but are not limited to, promoter, leader, polyadenylation, and signal sequences.

    [0060] Pectate lyase variants according to various embodiments of the present invention may be obtained by standard recombinant methods known in the art. Briefly, such a method may comprise the steps of: culturing a recombinant host cell as described above under conditions suitable for the production of the polypeptide, and recovering the polypeptide obtained. The polypeptide may then optionally be further purified.

    [0061] A large number of vector-host systems known in the art may be used for recombinant production of the pectate lyases as described herein. Possible vectors include, but are not limited to, plasmids or modified viruses which are maintained in the host cell as autonomous DNA molecule or integrated in genomic DNA. The vector system must be compatible with the host cell used as is well known in the art. Non-limiting examples of suitable host cells include bacteria (e.g. E. coli, bacilli), yeast (e.g. Pichia Pastoris, Saccharomyces Cerevisiae), fungi (e.g. filamentous fungi) insect cells (e.g. Sf9).

    [0062] In yet other terms, the invention relates to a method for improving the thermostability of a polypeptide with pectate lyase activity comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, the method comprising the step of altering the amino acid at a position corresponding to position 235 in SEQ ID NO: 1 to a small, polar, non-charged amino acid residue.

    [0063] Surprisingly, we found that the thermostability of the above described K235 variant polypeptides could be even further improved if another variation was introduced in addition to the K235 variation. We introduced an A231L variant into SEQ ID NO: 1 and found that this variation on its own improved the thermostability of the polypeptide (table 4, FIG. 4).

    [0064] As used herein, the term A231L variant indicates that the amino acid corresponding to the residue at position 231 of SEQ ID NO: 1 (alanine) is replaced by a leucine residue.

    TABLE-US-00004 TABLE 4 Thermostability of a polypeptide according to SEQ ID NO 1 and its variants (Residual relative pectate lyase activity after pre-incubation at elevated temperatures). SEQ ID A231L + A231L + Temp NO: 1 A231L K235T K235S K235T K235S RT 100% 100% 100% 100% 100% 100% 70 C. 60% 105% 110% 110% 120% 130% 75 C. 1% 20% 50% 50% 90% 100% 80 C. 1% 1% 35% 35% 80% 70%

    [0065] Surprisingly, the polypeptides carrying both the A231L variation and the K235 variations were more thermostable than each of the variant polypeptides alone. The effect was even found to be synergistic. Whereas the polypeptide according to SEQ ID NO: 1 did not have any significant residual activity after pre-incubation at 75 degrees C., the A231L variant as well as the K235T and K2355 variants retained 20%, 50% and 50% of their activity relative to the activity after pre-incubation at room temperature (relative activity, table 4 and FIG. 4). When both the A231L and K235T mutations were introduced into SEQ ID NO: 1, the relative activity of this double mutant (after pre-incubation at 75 C) improved to 90%. The same effect was found for the A231L and K235S double mutant of the polypeptide according to SEQ ID NO: 1. Therein the activity of the double mutant remained at 100% after pre-incubation at 75 degrees Celsius for 10 minutes.

    [0066] Most remarkably, the double mutants were exceptionally active after pre-incubation at 80 degrees Celsius. Whereas the A231L variant of SEQ ID NO: 1 was no longer active after pre-incubation at 80 degrees Celsius, in combination with the K235 variants, it improved the thermostability from K235T variant from 35% to 80% and the thermostability of the K2355 variant from 35 to 70% (table 4, FIG. 4)

    [0067] We further investigated if this phenomenon also occurred with polypeptides that were homologous to the polypeptide according to SEQ ID NO: 1. For that purpose we introduced the A231L single and double mutations in polypeptides according to SEQ ID NO: 6 and 11 (93% and 89% identical with SEQ ID NO: 1 respectively).

    [0068] We observed that the thermostability of these polypeptides could also be improved in the same manner as described above for the polypeptide according to SEQ D NO: 1.

    [0069] The single mutation A231L in SEQ ID NO: 6 improved the thermostability as shown in table 5. The double mutant A231L plus K235N improved the thermostability synergistically, i.e. more than the sum of the contributions of each of the mutations separately. After pre-incubation at 75 degrees Celsius, the relative activity of the A231L and K235N variants still was 25% and 30% respectively, whereas the combination of both mutations resulted in 80% relative activity.

    [0070] Most remarkably, the double mutants were exceptionally active after pre-incubation at 80 degrees Celsius. The A231L variant of SEQ ID NO: 1 was not significantly active after pre-incubation at 80 degrees Celsius. However, in combination with the K235N variant, it improved the thermostability of the double mutant from 20% to 70% (table 5, FIG. 5).

    TABLE-US-00005 TABLE 5 Thermostability of a polypeptide according to SEQ ID NO 6 and its variants (Residual relative pectate lyase activity after pre-incubation at elevated temperatures). Temp SEQ ID NO: 6 A231L K235N A231L + K235N RT 100% 100% 100% 100% 70 C. 70% 110% 100% 110% 75 C. 5% 25% 30% 80% 80 C. 1% 1% 20% 70%

    [0071] The single mutation A231L in SEQ ID NO: 11 improved the thermostability as shown in table 6. The double mutant A231L plus K235C improved the thermostability synergistically, i.e. more than the sum of the contributions of each of the mutations separately. After pre-incubation at 75 degrees Celsius, the A231L and K235C variants still had 18% and 35% relative activity respectively, whereas the combination of both mutations resulted in 90% relative activity.

    [0072] Most remarkably, the double mutants were exceptionally active after pre-incubation at 80 degrees Celsius. The A231L variant of SEQ ID NO: 11 was not significantly active after pre-incubation at 80 degrees Celsius. However, in combination with the K235C variant, it improved the thermostability of the double mutant from 10% to 80% (table 6, FIG. 6).

    TABLE-US-00006 TABLE 6 Thermostability of a polypeptide according to SEQ ID NO 11 and its variants (Residual relative pectate lyase activity after pre-incubation at elevated temperatures). Temp SEQ ID NO: 11 A231L K235C A231 + K235C RT 100% 100% 100% 100% 70 C. 50% 100% 105% 100% 75 C. 1% 18% 35% 90% 80 C. 1% 1% 10% 80%

    [0073] Hence, the invention also relates to a K235 variant polypeptide as described above additionally comprising a leucine residue at an amino acid position corresponding to position 231 in SEQ ID NO: 1.

    [0074] The invention also relates to a method for improving the themostability of a polypeptide with pectate lyase activity comprising an amino acid sequence that is at least 70% identical to the amino acid according to SEQ ID NO: 1, the method comprising the step of altering the amino acid at a position corresponding to position 235 in SEQ ID NO: 1 to a small, polar, non-charged amino acid residue and altering the amino acid at a position corresponding to position 231 in SEQ ID NO: 1 to a leucine residue.

    [0075] In a further preferred embodiment, the invention relates to any of the methods as described above, wherein the polypeptide with pectate lyase activity is capable of being expressed in a bacterium, such as a Bacillus species, more preferably Bacillus subtilis.

    [0076] The polypeptides with pectate lyase activity according to the present invention may be used in a wide range of different industrial processes and applications, such as cellulose recovery from lignocellulosic biomass, decreasing the energy required for the refining of wood and production of a sugar from a lignocellulosic material. They may also be used in wood pulp preparation, in pulp delignification, textile dye bleaching, wastewater detoxification, xenobiotic detoxification, degrading or decreasing the structural integrity of lignocellulosic material and detergent manufacturing.

    EXAMPLES

    Example 1: Preparation of a Polypeptide According to SEQ ID NO: 1

    [0077] The DNA construct disclosed in Takao et al., Biosci. Biotechnol. Biochem. (2001) 65: 322-329 encoding the polypeptide according to SEQ ID NO: 1 was optimized for expression in E. coli and commercially synthesized and cloned into a standard plasmid vector pET28a+under the control of T7-RNA-polymerase promoter for expression in Escherichia coli BL21(DE3). The nucleotide sequence of the construct is provided herein as SEQ ID NO: 16.

    Example 2: Preparation of Variants of a Polypeptide According to SEQ ID NO: 1 with Pectate Lyase Activity

    [0078] Homologous protein sequences (according to SEQ ID NO: 6 and SEQ ID NO: 11) were generated by random mutagenesis of SEQ ID NO:s 16 and SEQ ID NO: 21 using error-prone PCR essentially as described (Curr Protoc Mol Biol. 2001 May; Chapter 8: Unit 8.3. doi: 10.1002/0471142727.mb0803s51, Random mutagenesis by PCR. Wilson DS1, Keefe AD) using a commercial random PCR mutagenesis kit (QuikChange II XL Site-Directed Mutagenesis kit by Agilent Technologies). More in particular, the DNA sequence of SEQ ID NO: 21 was obtained from SEQ ID NO: 16 encoding the polypeptide according to SEQ ID NO: 1. The DNA sequence of SEQ ID NO: 26 was obtained by random mutagenesis of SEQ ID NO: 21 encoding the polypeptide according to SEQ ID NO: 6. SEQ ID NO: 26 is the DNA sequence encoding the polypeptide according to SEQ ID NO: 11.

    [0079] PCR fragments resulting from error-prone PCR were cloned to the plasmid vector pET28a+under the control of T7-RNA-polymerase promoter for expression in Escherichia coli BL21(DE3), and screened for pectate lyase activity of the recombinant proteins.

    [0080] Active clones were subjected to further rounds of randomization using the same protocol. The polypeptide according to SEQ ID NO: 6 exhibited pectate lyase activity and was found to be 93% identical with SEQ ID NO: 1. The polypeptide according to SEQ ID NO: 11 also exhibited pectate lyase activity and was found to be 89% identical with SEQ ID NO: 1.

    Example 3: Preparation of A231L and K235 Variant Polypeptides

    [0081] In order to prepare polypeptide according to SEQ ID NO:s 2 5, mutations were inserted into the DNA coding for polypeptide according to SEQ ID NO: 1 at position 235. As a result, the lysine residue from that position in SEQ ID NO: 1 was replaced with either one of the residues T (threonine), C (cysteine), S (serine) or N (asparagine), thereby resulting in the polypeptides according to SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4 and SEQ ID NO: 5, respectively.

    [0082] These variants are referred to herein as K235T, K2355, K235N and K235C respectively.

    [0083] This was achieved by standard site-directed mutagenesis essentially as described in WO 2013/038062. In more detail: To introduce mutation A231L into the genes encoding SEQ ID NO: 1, SEQ ID NO: 6 and SEQ ID NO: 11, we carried out two separate PCR reactions: [0084] (1) with primers Primer 1 gaaattaatacgactcactatagg (SEQ ID NO: 31) and Primer 2(A231L) GCCATCATGCTGCTGAAACGGACGACCAAAATAGGTG (SEQ ID NO: 38). [0085] (2) with Primer3(A231L) GGTCGTCCGTTTCAGCAGCATGATGGCctgCTGGATATC (SEQ ID NO: 39) and Primer 4 ggttatgctagttattgctcagcggtg (SEQ ID NO: 32).

    [0086] In both reactions, recombinant gene without the mutation was used as the template. Primers 1 and 4 bind inside the vector sequence and are not specific to the recombinant gene. Primers 2 and 3 bind inside the recombinant gene and their binding sites overlap. Primer 3 binding site contains the mutation site. Primer 3 represents the mutated (desired) sequence, which is not 100% matching the template (lower case type font in the primer sequence indicates the mismatched nucleotides). However, the primer has enough affinity and specificity to the binding site to produce the desired PCR product. Purified PCR products from reactions (1) and (2) were combined and used as template for PCR reaction with Primer 1 and Primer 4. The products of this reaction, containing the A231L variant sequence of the genes encoding the polypeptides according to SEQ ID NO:s 48-50 was cloned in a plasmid vector for expression in E. coli.

    [0087] The same protocol and the same primers 1 and 4 were used for introducing the K235 mutations into the genes encoding the polypeptide according to SEQ ID NO: 1, SEQ ID NO: 6 and SEQ ID NO: 11. Primer 3 used for introducing the K235 mutations was AATAGCAGCGATTTTATCACCATCAGCTACAACGTGTTTA (SEQ ID NO: 37). The specific Primers 2 used for the mutations K235T, K235S, K235N and K235C are listed in table 7.

    TABLE-US-00007 TABLE7 primersusedforintroducingthe231and235mutations. SEQIDNO: Primername Sequence(5-3) 31 Primer1 GAAATTAATACGACTCACTATAGG 32 Primer4 GGTTATGCTAGTTATTGCTCAGCGGTG 33 Primer2K235T GCTGATGGTGATAAAATCGCTGCTATTggTGATATCCAG 34 Primer2K235S GCTGATGGTGATAAAATCGCTGCTATTgcTGATATCCAG 35 Primer2K235N GCTGATGGTGATAAAATCGCTGCTATTgTTGATATCCAG 36 Primer2K235C GCTGATGGTGATAAAATCGCTGCTATTgcaGATATCCAG 37 Primer3K235 AATAGCAGCGATTTTATCACCATCAGCTACAACGTGTTTA 38 Primer2A231 GCCATCATGCTGCTGAAACGGACGACCAAAATAGGTG 39 Primer3A231L GGTCGTCCGTTTCAGCAGCATGATGGCctgCTGGATATCA

    [0088] Double mutants were prepared by introducing the mutation into the DNA encoding a polypeptide carrying a single mutation.

    Example 4: Heterologous Expression of Polypeptides with Pectate Lyase Activity

    [0089] For recombinant expression in E. coli, recombinant genes were cloned into pET-28 commercial expression vector under the control of T7 bacteriophage promoter.

    [0090] Protein production was carried out in E. coli BL21(DE3) strain according to the plasmid manufacturer protocol available at http://richsingiser.com/4402/Novagen%20pET%20system%20manual.pdf. The incubation temperature for protein production was 30 degrees C., which was found optimal for maximum yield of the active protein. Cells were lysed using lysis buffer (50 mM Tris-HCl pH7.4, 1% Triton X100, 0.5 mM CaCl) and heated at 60 degrees C. for 20 min. Coagulated cell debris was removed by centrifugation. The thermostable recombinant pectate lyases were detected in the soluble fraction only, consistent with the notion that they were thermostable enzymes.

    Example 5: Pectate Lyase Activity Assay

    [0091] Pectate lyase activity assay was carried out essentially as described in Takao M, Nakaniwa T, Yoshikawa K, Terashita T, Sakai T., Purification and characterization of thermostable pectate lyase with protopectinase activity from thermophilic Bacillus sp. TS 47. Biosci Biotechnol Biochem. 2000 64:2360-7. In more detail, pectate lyase activity was assayed by measuring the increase in absorbance at 235 nm of the reaction mixture, Polygalacturonic acid (PGA) sodium salt from de-methylated citrus pectin (purchased from MegaZyme) was used as substrate. A reaction mixture containing 1 ml of 0.1% PGA in 10 mM Tris-HCl buffer, pH 8.0 and 0.5 mM CaCl.sub.2, and an appropriate amount of enzyme solution was incubated for 30 min at 60 C.

    [0092] The reaction was stopped by placing the mixture in 100 degrees C. (boiling water bath) for 5 min. Relative pectate lyase activity was calculated from the difference in absorption of the reaction mixture at 235 nm at the start and at the end of the reaction.

    Example 6: Thermostability of Polypeptides with Pectate Lyase Activity

    [0093] Thermostability of the polypeptides with pectate lyase activity was determined by pre-incubation for 10 minutes in 50 mM Tris-HCl pH 8.0, either at room temperature (control) or at 70 degrees C., 75 degrees C. and 80 degrees C. before measuring their activity according to example 5.

    [0094] After pre-incubation, the samples were brought to 60 degrees C., substrate (PGA) was added and samples were assayed for activity as described in Example 5 at 60 degrees C. pH 8.0. Residual activities for each sample were calculated as % of the activity of the corresponding sample pre-incubated at room temperature (control sample).

    Example 7: Sequences Provided Herein

    [0095] Amino acid sequence and nucleotide sequences are provided herewith in the WIPO ST_25 standard. For convenience the sequences are also provided in table 8.

    [0096] SEQ ID NO: 1 is derived from the prior art and has been disclosed in Takao et al, Biosci. Biotechnol. Biochem. (2000) 64: 2360-2367 and in Takao et al., Biosci. Biotechnol. Biochem. (2001) 65: 322-329.

    [0097] Amino acids corresponding to positions 231 and 235 in SEQ ID NO: 1 are shown in bold and underlined type face.

    [0098] SEQ ID NO: 6 was obtained by random mutagenesis of the DNA encoding SEQ ID NO: 1 (shown herein as SEQ ID NO: 16) as described in example 2.

    [0099] SEQ ID NO: 11 was obtained by random mutagenesis of the DNA encoding SEQ ID NO: 6 (shown herein as SEQ ID NO: 21).

    [0100] The DNA encoding the polypeptide according to SEQ ID NO: 11 is shown herein as SEQ ID NO: 26.

    [0101] The amino acids deviating from the wild type sequence of SEQ ID NO: 1 are shown in capital letters.

    [0102] The polypeptide according to SEQ ID NO: 6 is a homologue of the polypeptide according to SEQ ID NO: 1. These two polypeptides have 385 of the 416 amino acids in common, in other words they are 93% identical.

    [0103] The polypeptide according to SEQ ID NO: 11 is also a homologue of the polypeptide according to SEQ ID NO: 1. These two polypeptides have 369 of the 416 amino acids in common, in other words they are 89% identical.

    [0104] The polypeptides according to SEQ ID NO:s 2 - 5 correspond to the polypeptide according to SEQ ID NO: 1 with variations K235T, K235S, K235N and K235C respectively.

    [0105] The polypeptides according to SEQ ID NO:s 7-10 correspond to the polypeptide according to SEQ ID NO: 6 with variations K235T, K235S, K235N and K235C respectively.

    [0106] The polypeptides according to SEQ ID NO:s 12-15 correspond to the polypeptide according to SEQ ID NO: 11 with variations K235T, K235S, K235N and K235C respectively.

    [0107] The nucleotide sequences according to SEQ ID NO:s 16-30 encode the polypeptides with amino acid sequences according to SEQ ID NO:s 1-15 respectively.

    [0108] SEQ ID NO:s 31-39 correspond to the primers used for producing the variant polypeptides as detailed in example 3.

    [0109] Polypeptides carrying the double mutations A231L with K235T, K2355, K235N and K235C double mutations are shown in SEQ ID NO: 40-43 respectively.

    [0110] DNA encoding the polypeptides according to SEQ ID NO: 40-43 are shown in SEQ ID NO: 44-47.

    [0111] SEQ ID NO:s 48, 49 and 50 correspond to variants A231L in polypeptides according to SEQ ID NO: 1, 6 and 11 respectively. SEQ ID NO:s 51-53 are the DNA sequences encoding the polypeptides according to SEQ ID NO:s 48-50

    TABLE-US-00008 TABLE8 Aminoacidandnucleotidesequencesdisclosedherein. SEQIDNO: Sequence 1 1kelghevlkpydgwaaygegttggamaspqnvfvvtnrteliqalggnnhtnqynsvpki 61iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk 121kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg 181tlgewnseydsisiegsshiwidhntftdgdhpdrslgtyfgrpfqqhdgaldiknssdf 241itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd 361lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh 2 1kelghevklpydgwaaygegttggamaspqnvgvvtnrteliqalggnnhtnqynsvpki 61iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk 121kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg 181tlgewnseydsisiegsshiwidhntftdgdhpdrslgtyfgrpfqqhdgalditnssdf 241itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd 361lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh 3 1kelghevlkpydgwaaygegttggamaspqnvfvvtnrteliqalggnnhtnqynsvpki 61iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk 121kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg 181tlgewnseydsisiegsshiwidhntftdgdhpdrslgtyfgrpfqqhdgaldisnssdf 241itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd 361lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvaplvkakagagnlh 4 1kelghevlkpydgwaaygegttggamaspqnvfvvtnrteliqalggnnhtnqynsvpki 61iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk 121kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg 181tlgewnseydsisiegsshiwidhntftdgdhpdrslgtyfgrpgqqhdgaldinnssdf 241itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd 361lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh 5 1kelghevlkpydgwaaygegttggamaspqnvgvvtnrteliqalggnnhtnqynsvpki 61iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk 121kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg 181tlgewnsydsisisegsshiwidhntftdgdhpdrslgtyfgrpfqqhdgaldicnssdf 241itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd 361lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh 6 1kelghDvlkpydgwaSygegttggSmaspqnvYTvtnKtelVqalggnnhtnqynsvpki 61iyvkgtiElnvddnnqpvgpEfykdphYdfeaylKeydkKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdyfpewdptdg 181tlgewnseydsiTiegsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgaldiknssdf 241itisynvfKDhdkvtligasdsrmadEghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvswkneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 7 1kelghDvlkpydgwaSygegttggSmaspqnvYTvtnKtelVqalggnnhtnqynsvpki 61yyvkgtiElnvddnnqpvgpEfykdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdyfpewdptdg 181tlgewnseydsiTiegsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgalditnssdf 241itisynvfKDhdkvtligasdsrmadEghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 8 1kelghDvlkpydgwaSygegttggSmaspqnvYTvtnKtelVqalggnnhtnqynsvpki 61iyvkgtiElnvddnnqpvgpEfykdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdyfpewdptdg 181tlgewnseydsiTiegsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgaldisnssdf 241itisynvfKDhdkvtligasdsrmadEghlrvtlhhhyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 9 1kelghDvlkpydgwaSygegttggSmaspqnvYTvtnKtelVqalggnnhtnqynsvpki 61iyvkgtiElnvddnnqpvgpEfykdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdyfpewdptdg 181tlgewnseydsiTiegsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgaldinnssdf 241itisynvfKDhdkvtligasdsrmadEghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvapavkakagagnlh 10 1kelghDvlkpydgwaSygegttggSmaspqnvYTvtnKtelVqalggnnhtnqynsvpki 61iyvkgtiElnvddnnqpvgpEfykdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdyfpewdptdf 181tlgewnseydsiTiegsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgaldicnssdf 241itisynvfKDhdkvtligasdsrmadEghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 11 1kelghDvlkpNdgwaSygegttggSEaspDnvYTvtnKSelVqalggnnhtnqynsTpki 61iyvkgtiElnvddnnqpvgpEYyDdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdFfpewdptdg 181EYgewnseydsiTieSsHhiwidhntftdgdhpdKslgtygfrpfqqhdgaldiknssdf 241itisynvfKDhdkvSligSsdsrKTdEghlKvtlhhnyyknvtqrlprvrfgqvhiynny 301yetsnladydfqyawgvgvEsKiyaqnnytstdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 12 1kelghDvlkpNdgwaSygegttggSEaspDnvYTvtnKSelVqalggnnhtnqynsTpki 61iyvkgtiElnvddnnqpvgpEYyDdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdFfpewdptdg 181EYgewnseydsiTieSsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgalditnssdf 241itisynvfKDhdkvSligSsdsrKTdEghlKvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvswkneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 13 1kelghDvlkpNdgwaSygegttggSEaspDnvYTvtnKSelVqalggnnhtnqynsTpki 61iyvkgtiElnvddnnqpvgpEYyDdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdFfpewdptdg 181EYgewnseydsiTieSsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgaldisnssdf 241itisynvfKDhdkvSligSsdsrKTdEghlKvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 14 1kelghDvlkpNdgwaSygegttggSEaspDnvYTvtnKSelVqalggnnhtnqynsTpki 61iyvkgtiElnvddnnqpvgpEYyDdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdEfpewdptdg 181EYgewnseydsiTieSsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgaldinnssdf 241itisynvfKDhdkvSligSsdsrKTdEghlKvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 15 1kelghDvlkpNdgwaSygegttggSEaspDnvYTvtnKSelVqalggnnhtnqynsTpki 61iyvkgtiElnvddnnqpvgpEYyDdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdFfpewdptdg 181EYgewnseydsiTieSsHhiwidhntftdgdhpdKslgtyfgrpfqqhdgaldicnssdf 241itisynvfKDhdkvSligSssdrKTdEghlEvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 16 aaagaactgggtcatgaagttctgaaaccgtatgatggttgggcagcgtatggtgaaggt60 acaaccggtggtgcaatggcaagtccgcagaatgtttttgttgttaccaatcgtaccgaa120 ctgattcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgatctgaacgtggatgataataatcagccggttggtccg240 gatttctataaagatccgcattttgattttgaggcctatctgcgtgaatatgatccggca300 acctggggtaaaaaagaagttgaaggtccgctggaagaagcacgcgttcgtagccagaaa360 aaacagaaagatcgtatcatggtttatgtgggtagcaacaccagcattattggtgttggt420 aaagacgcgaaaatcaaaggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccgctggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattagcattgaaggcagcagccatatt600 tggattgatcacaatacctttaccgatggcgatcatccggatcgtagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaaaaatagcagcgatttt720 atcaccatcagctacaacgtgtttaccaaccacgataaagttaccctgattggtgcaagc780 gatagccgtatggcagatagcggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgattttcagtatgcatggggtgttggtgtgttt960 agccagatttatgcacagaacaactatttcagcttcgattgggatattgatccgagcctg1020 attatcaaagtttggagcaaaaatgaagaaagcatgtatgaaaccggcaccatcgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttacctggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 17 aaagaactgggtcatgaagttctgaaaccgtatgatggttgggcagcgtatggtgaaggt60 acaaccggtggtgcaatggcaagtccgcagaatgtttttgttgttaccaatcgtaccgaa120 ctgattcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgatctgaacgtggatgataataatcagccggttggtccg240 gatttctataaagatccgcattttgattttgaggcctatctgcgtgaatatgatccggca300 acctggggtaaaaaagaagttgaaggtccgctggaagaagcacgcgttcgtagccagaaa360 aaacagaaagatcgtatcatggtttatgtgggtagcaacaccagcattattggtgttggt420 aaagacgcgaaaatcaaaggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccgctggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattagcattgaaggcagcagccatatt600 tggattgatcacaatacctttaccgatggcgatcatccggatcgtagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaccaatagcagcgatttt720 atcaccatcagctacaacgtgtttaccaaccacgataaagttaccctgattggtgcaagc780 gatagccgtatggcagatagcggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgattttcagtatgcatggggtgttggtgtgttt960 agccagatttatgcacagaacaactatttcagcttcgattgggatattgatccgagcctg1020 attatcaaagtttggagcaaaaatgaagaaagcatgtatgaaaccggcaccatcgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttacctggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 18 aaagaactgggtcatgaagttctgaaaccgtatgatggttgggcagcgtatggtgaaggt60 acaaccggtggtgcaatggcaagtccgcagaatgtttttgttgttaccaatcgtaccgaa120 ctgattcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgatctgaacgtggatgataataatcagccggttggtccg240 gatttctataaagatccgcattttgattttgaggcctatctgcgtgaatatgatccggca300 acctggggtaaaaaagaagttgaaggtccgctggaagaagcacgcgttcgtagccagaaa360 aaacagaaagatcgtatcatggtttatgtgggtagcaacaccagcattattggtgttggt420 aaagacgcgaaaatcaaaggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccgctggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattagcattgaaggcagcagccatatt600 tggattgatcacaatacctttaccgatggcgatcatccggatcgtagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcagcaatagcagcgatttt720 atcaccatcagctacaacgtgtttaccaaccacgataaagttaccctgattggtgcaagc780 gatagccgtatggcagatagcggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgattttcagtatgcatggggtgttggtgtgttt960 agccagatttatgcacagaacaactatttcagcttcgattgggatattgatccgagcctg1020 attatcaaagtttggagcaaaaatgaagaaagcatgtatgaaaccggcaccatcgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttacctggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 19 aaagaactgggtcatgaagttctgaaaccgtatgatggttgggcagcgtatggtgaaggt60 acaaccggtggtgcaatggcaagtccgcagaatgtttttgttgttaccaatcgtaccgaa120 ctgattcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgatctgaacgtggatgataataatcagccggttggtccg240 gatttctataaagatccgcattttgattttgaggcctatctgcgtgaatatgatccggca300 acctggggtaaaaaagaagttgaaggtccgctggaagaagcacgcgttcgtagccagaaa360 aaacagaaagatcgtatcatggtttatgtgggtagcaacaccagcattattggtgttggt420 aaagacgcgaaaatcaaaggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccgctggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattagcattgaaggcagcagccatatt600 tggattgatcacaatacctttaccgatggcgatcatccggatcgtagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaacaatagcagcgatttt720 atcaccatcagctacaacgtgtttaccaaccacgataaagttaccctgattggtgcaagc780 gatagccgtatggcagatagcggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgattttcagtatgcatggggtgttggtgtgttt960 agccagatttatgcacagaacaactatttcagcttcgattgggatattgatccgagcctg1020 attatcaaagtttggagcaaaaatgaagaaagcatgtatgaaaccggcaccatcgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttacctggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 20 aaagaactgggtcatgaagttctgaaaccgtatgatggttgggcagcgtatggtgaaggt60 acaaccggtggtgcaatggcaagtccgcagaatgtttttgttgttaccaatcgtaccgaa120 ctgattcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgatctgaacgtggatgataataatcagccggttggtccg240 gatttctataaagatccgcattttgattttgaggcctatctgcgtgaatatgatccggca300 acctggggtaaaaaagaagttgaaggtccgctggaagaagcacgcgttcgtagccagaaa360 aaacagaaagatcgtatcatggtttatgtgggtagcaacaccagcattattggtgttggt420 aaagacgcgaaaatcaaaggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccgctggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattagcattgaaggcagcagccatatt600 tggattgatcacaatacctttaccgatggcgatcatccggatcgtagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatctgcaatagcagcgatttt720 atcaccatcagctacaacgtgtttaccaaccacgataaagttaccctgattggtgcaagc780 gatagccgtatggcagatagcggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgattttcagtatgcatggggtgttggtgtgttt960 agccagatttatgcacagaacaactatttcagcttcgattgggatattgatccgagcctg1020 attatcaaagtttggagcaaaaatgaagaaagcatgtatgaaaccggcaccatcgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttacctggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 21 aaagaactgggtcatgatgtgctgaaaccgtatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcatggcaagtccgcagaatgtttataccgttaccaataaaaccgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaattctataaagatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggtggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattaccattgaaggcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaccaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgaccctgattggtgcaagc780 gatagccgtatggcagatgaaggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 22 aaagaactgggtcatgatgtgctgaaaccgtatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcatggcaagtccgcagaatgtttataccgttaccaataaaaccgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaattctataaagatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggtggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattaccattgaaggcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaccaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgaccctgattggtgcaagc780 gatagccgtatggcagatgaaggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 23 aaagaactgggtcatgatgtgctgaaaccgtatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcatggcaagtccgcagaatgtttataccgttaccaataaaaccgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaattctataaagatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggtggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattaccattgaaggcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcagcaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgaccctgattggtgcaagc780 gatagccgtatggcagatgaaggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 24 aaagaactgggtcatgatgtgctgaaaccgtatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcatggcaagtccgcagaatgtttataccgttaccaataaaaccgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaattctataaagatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggtggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattaccattgaaggcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaacaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgaccctgattggtgcaagc780 gatagccgtatggcagatgaaggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgga960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 25 aaagaactgggtcatgatgtgctgaaaccgtatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcatggcaagtccgcagaatgtttataccgttaccaataaaaccgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaattctataaagatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggtggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattaccattgaaggcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatctgcaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgaccctgattggtgcaagc780 gatagccgtatggcagatgaaggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 26 aaagaactgggtcatgatgtgctgaaaccgaatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcgaagcaagtccggataatgtttataccgttaccaataaaagcgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccaccccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaatattatgatgatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggttgatttttttccggaatgggatccgaccgatggt540 gaatatggcgaatggaatagcgaatatgatagcattaccatcgaaagcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaaaaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgagcctgattggttcaagc780 gatagccgtaaaaccgatgaaggtcatctgaaagttaccctgcatcacaactattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttatcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 27 aaagaactgggtcatgatgtgctgaaaccgaatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcgaagcaagtccggataatgtttataccgttaccaataaaagcgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccaccccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaatattatgatgatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggttgatttttttccggaatgggatccgaccgatggt540 gaatatggcgaatggaatagcgaatatgatagcattaccatcgaaagcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaccaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgagcctgattggttcaagc780 gatagccgtaaaaccgatgaaggtcatctgaaagttaccctgcatcacaactattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 28 aaagaactgggtcatgatgtgctgaaaccgaatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcgaagcaagtccggataatgtttataccgttaccaataaaagcgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccaccccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaatattatgatgatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggttgatttttttccggaatgggatccgaccgatggt540 gaatatggcgaatggaatagcgaatatgatagcattaccatcgaaagcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcagcaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgagcctgattggttcaagc780 gatagccgtaaaaccgatgaaggtcatctgaaagttaccctgcatcacaactattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 29 aaagaactgggtcatgatgtgctgaaaccgaatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcgaagcaagtccggataatgtttataccgttaccaataaaagcgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccaccccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaatattatgatgatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggttgatttttttccggaatgggatccgaccgatggt540 gaatatggcgaatggaatagcgaatatgatagcattaccatcgaaagcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaacaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgagcctgattggttcaagc780 gatagccgtaaaaccgatgaaggtcatctgaaagttaccctgcatcacaactattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 30 aaagaactgggtcatgatgtgctgaaaccgaatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcgaagcaagtccggataatgtttataccgttaccaataaaagcgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccaccccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaatattatgatgatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggttgatttttttccggaatgggatccgaccgatggt540 gaatatggcgaatggaatagcgaatatgatagcattaccatcgaaagcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatctgcaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgagcctgattggttcaagc780 gatagccgtaaaaccgatgaaggtcatctgaaagttaccctgcatcacaactattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 31 GAAATTAATACGACTCACTATAGG 32 GGTTATGCTAGTTATTGCTCAGCGGTG 33 GCTGATGGTGATAAAATCGCTGCTATTggTGATATCCAG 34 GCTGATGGTGATAAAATCGCTGCTATTgcTGATATCCAG 35 GCTGATGGTGATAAAATCGCTGCTATTgTTGATATCCAG 36 GCTGATGGTGATAAAATCGCTGCTATTgcaGATATCCAG 37 AATAGCAGCGATTTTATCACCATCAGCTACAACGTGTTTA 38 GCCATCATGCTGCTGAAACGGACGACCAAAATAGGTG 39 GGTCGTCCGTTTCAGCAGCATGATGGCctgCTGGATATCA 40 1kelghevlkpydgwaaygegttggamaspqnvfvvtnrteliqalggnnhtnqynsvpki 61iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk 121kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdf 181tlgewnseydsisiegsshiwidhntftdgdhpdrslgtyfgrpfqqhdgllditnssdf 241itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd 361lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh 41 1kelghevlpkydgawwygegttggamaspqnvfvvtnrteliqalggnnhtnqynsvpki 61iyvkgtidlnvddnnqpvgpdfykdphfdfeaylreydpatwgkkevegpleearvrsqk 121kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg 181tlgewnseydsisiegsshiwidhntftdgdhpdrslgytrgrpfqqhdglldisnssdf 241itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd 361lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh 42 1kelghDvlkpydgwaSygegttggSmaspqnvYTvtnKtelVqalggnnhtngynsvpki 61iyvkgtiElnvddnnqpvgpEfykdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdyfpewdptdg 181tlgewnseydsiTiegsHhiwidhntftdfdhpdKslgtyfgrpfqqhdglldinnssdf 241itisynvfKDhdkvtligassdrmadEghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 43 1kelghDvlkpNdgwaSygegttggSEaspDnvYTvtnKSelVqalggnnhtnqynsTpki 61iyvkgtiElnvddnnqpvgpEYyDdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdFfpewdptdg 181EYgewnseydsiTieSsHhiwidhntftdgdhpdKslgtyfgrpfqqhdglldicnssdf 241itisynvfKDhdkvSligSsdsrKTdEghlKvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 44 aaagaactgggtcatgaagttctgaaaccgtatgatggttgggcagcgtatggtgaaggt60 acaaccggtggtgcaatggcaagtccgcagaatgtttttgttgttaccaatcgtaccgaa120 ctgattcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgatctgaacgtggatgataataatcagccggttggtccg240 gatttctataaagatccgcattttgattttgaggcctatctgcgtgaatatgatccggca300 acctggggtaaaaaagaagttgaaggtccgctggaagaagcacgcgttcgtagccagaaa360 aaacagaaagatcgtatcatggtttatgtgggtagcaacaccagcattattggtgttggt420 aaagacgcgaaaatcaaaggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccgctggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattagcattgaaggcagcagccatatt600 tggattgatcacaatacctttaccgatggcgatcatccggatcgtagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcctgctggatatcaccaatagcagcgatttt720 atcaccatcagctacaacgtgtttaccaaccacgataaagttaccctgattggtgcaagc780 gatagccgtatggcagatagcggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgattttcagtatgcatggggtgttggtgtgttt960 agccagatttatgcacagaacaactatttcagcttcgattgggatattgatccgagcctg1020 attatcaaagtttggagcaaaaatgaagaaagcatgtatgaaaccggcaccatcgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttacctggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 45 aaagaactgggtcatgaagttctgaaaccgtatgatggttgggcagcgtatggtgaaggt60 acaaccggtggtgcaatggcaagtccgcagaatgtttttgttgttaccaatcgtaccgaa120 ctgattcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgatctgaacgtggatgataataatcagccggttggtccg240 gatttctataaagatccgcattttgattttgaggcctatctgcgtgaatatgatccggca300 acctggggtaaaaaagaagttgaaggtccgctggaagaagcacgcgttcgtagccagaaa360 aaacagaaagatcgtatcatggtttatgtgggtagcaacaccagcattattggtgttggt420 aaagacgcgaaaatcaaaggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccgctggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattagcattgaaggcagcagccatatt600 tggattgatcacaatacctttaccgatggcgatcatccggatcgtagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcctgctggatatcagcaatagcagcgatttt720 atcaccatcagctacaacgtgtttaccaaccacgataaagttaccctgattggtgcaagc780 gatagccgtatggcagatagcggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgattttcagtatgcatggggtgttggtgtgttt960 agccagatttatgcacagaacaactatttcagcttcgattgggatattgatccgagcctg1020 attatcaaagtttggagcaaaaatgaagaaagcatgtatgaaaccggcaccatcgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttacctggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 46 aaagaactgggtcatgatgtgctgaaaccgtatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcatggcaagtccgcagaatgtttataccgttaccaataaaaccgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaattctataaagatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggtggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattaccattgaaggcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcctgctggatatcaacaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgaccctgattggtgcaagc780 gatagccgtatggcagatgaaggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 47 aaagaactgggtcatgatgtgctgaaaccgaatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcgaagcaagtccggataatgtttataccgttaccaataaaagcgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccaccccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaatattatgatgatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggttgatttttttccggaatgggatccgaccgatggt540 gaatatggcgaatggaatagcgaatatgatagcattaccatcgaaagcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcctgctggatatctgcaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgagcctgattggttcaagc780 gatagccgtaaaaccgatgaaggtcatctgaaagttaccctgcatcacaactattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 48 1kelghevklpydgwaaygegttggamaspqnvfvvtnrteliqalggnnhtnqynsvpki 61iyvkgtidlnvddnnqpvgpifykdphfdfeaylreydpatwgkkevegpleearvrsqk 121kqkdrimvyvgsntsiigvgkdakikgggfliknvdnviirniefeapldyfpewdptdg 181tlgewnseydsisiegsshiwidhntftdgdhpdrslgtyfgrpfqqhdglldiknssdf 241itisynvftnhdkvtligasdsrmadsghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvfsqiyaqnnyfsfdwdidpsliikvwskneesmyetgtivd 361lpngrryidlvasynesntlqlkkevtwkpmfyhvihptpsvpalvkakagagnlh 49 1kelghDvlkpydgwaSygegttggSmaspqnvYTvtnKtelVqalggnnhtnqynsvpki 61iyvkgtiElnvddnnqpvgpEfykdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdyfpewdptdg 181tlgewnseydsiTiegsHhiwidhntftdfdhpdKslgtyfgrpfqqhdglldiknssdf 241itisynvfKDhdkvtligasdsrmadEghlrvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyqannyfsfdwdidpsKiikvswkneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 50 1kelghDvlkpNdgwaSygegttggSEaspDnvYTvtnKSelVqalggnnhtnqynsTpki 61iyvkgtiElnvddnnqpvgpEYyDdphYdfeaylKeydpKKwgkkevSgpleearArsqk 121kqkEriVvNvgsntsiigvgkdakiVgggfliknvdnviirniefeapVdFfpewdptdg 181EYgewnseydsiTieSsHhiwidhntftdfdhpdKslgtyfgrpfqqhdglldiknssdf 241itisynvfKDhdkvSligSsdsrKTdEghlKvtlhhnyyknvtqrlprvrfgqvhiynny 301yefsnladydfqyawgvgvEsKiyaqnnyfsfdwdidpsKiikvwskneesmyeSgtivd 361lpngrryidlvasynesntlqlkkevGwkpmfyhvihptpsvpalvkakagagnlh 51 aaagaactgggtcatgaagttctgaaaccgtatgatggttgggcagcgtatggtgaaggt60 acaaccggtggtgcaatggcaagtccgcagaatgtttttgttgttaccaatcgtaccgaa120 ctgattcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgatctgaacgtggatgataataatcagccggttggtccg240 gatttctataaagatccgcattttgattttgaggcctatctgcgtgaatatgatccggca300 acctggggtaaaaaagaagttgaaggtccgctggaagaagcacgcgttcgtagccagaaa360 aaacagaaagatcgtatcatggtttatgtgggtagcaacaccagcattattggtgttggt420 aaagacgcgaaaatcaaaggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccgctggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattagcattgaaggcagcagccatatt600 tggattgatcacaatacctttaccgatggcgatcatccggatcgtagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaaaaatagcagcgatttt720 atcaccatcagctacaacgtgtttaccaaccacgataaagttaccctgattggtgcaagc780 gatagccgtatggcagatagcggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgattttcagtatgcatggggtgttggtgtgttt960 agccagatttatgcacagaacaactatttcagcttcgattgggatattgatccgagcctg1020 attatcaaagtttggagcaaaaatgaagaaagcatgtatgaaaccggcaccatcgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttacctggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 52 aaagaactgggtcatgatgtgctgaaaccgtatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcatggcaagtccgcagaatgtttataccgttaccaataaaaccgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccgtgccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaattctataaagatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggtggattattttccggaatgggatccgaccgatggc540 accctgggtgaatggaatagcgaatatgatagcattaccattgaaggcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaaaaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgaccctgattggtgcaagc780 gatagccgtatggcagatgaaggtcatctgcgtgttaccctgcatcacaattattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248 53 aaagaactgggtcatgatgtgctgaaaccgaatgatggttgggcaagctatggtgaaggt60 acaaccggtggtagcgaagcaagtccggataatgtttataccgttaccaataaaagcgaa120 ctggttcaggcactgggtggtaataatcataccaatcagtataattccaccccgaaaatc180 atctatgtgaaaggcaccattgaactgaacgtggatgataataatcagccggttggtccg240 gaatattatgatgatccgcattatgattttgaagcctatctgaaagagtatgatccgaaa300 aaatggggcaaaaaagaagttagcggtccgctggaagaagcacgcgcacgtagccagaaa360 aaacagaaagaacgtattgttgtgaatgtgggtagcaacaccagcattattggtgttggt420 aaagatgccaaaattgtgggtggtggtttcctgattaaaaacgtggataatgtgatcatc480 cgcaacatcgaatttgaagcaccggttgatttttttccggaatgggatccgaccgatggt540 gaatatggcgaatggaatagcgaatatgatagcattaccatcgaaagcagccatcatatt600 tggatcgatcacaatacctttaccgatggcgatcatccggataaaagcctgggcacctat660 tttggtcgtccgtttcagcagcatgatggcgcactggatatcaaaaatagcagcgatttt720 atcaccatcagctacaacgtgtttaaagaccatgataaagtgagcctgattggttcaagc780 gatagccgtaaaaccgatgaaggtcatctgaaagttaccctgcatcacaactattacaaa840 aatgttacccagcgtctgcctcgtgttcgttttggtcaggttcatatctataacaactac900 tatgagtttagcaacctggccgattatgactttcagtatgcatggggtgttggtgttgaa960 agcaaaatctatgcccagaacaactatttcagcttcgattgggatattgacccgagcaaa1020 attatcaaagtttggagcaaaaacgaagaaagcatgtatgaaagcggtacgattgttgat1080 ctgccgaatggtcgtcgttatattgatctggttgcaagctataatgaaagcaataccctg1140 cagctgaaaaaagaggttggttggaaaccgatgttctatcatgttattcatccgaccccg1200 agcgttccggcactggttaaagcaaaagccggtgcaggtaatctgcat1248