TELOMERASE ENCODING DNA VACCINE
20190000946 ยท 2019-01-03
Assignee
Inventors
- Pierre Langlade Demoyen (Neuilly sur Seine, FR)
- Simon Wain-Hobson (Montigny le Bretonneux, FR)
- Thierry Huet (Nogent sur Marne, FR)
- Christelle Liard (Chatillon, FR)
- Elodie Pliquet (Cachan, FR)
Cpc classification
C07K2319/35
CHEMISTRY; METALLURGY
C12Y207/07049
CHEMISTRY; METALLURGY
A61K39/001157
HUMAN NECESSITIES
C12N9/1276
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
Abstract
The invention provides a nucleic acid construct comprising a sequence that encodes a human telomerase reverse transcriptase (hTERT) protein which is devoid of telomerase catalytic activity and of a nucleolar localization signal. The construct is useful triggering an immune response in a subject, against cells that overexpress telomerase, preferably dysplasia cells or tumor cells.
Claims
1.-28. (canceled)
29. A nucleic acid molecule comprising a sequence encoding a fusion protein which comprises the amino acid sequence of a human telomerase reverse transcriptase (hTERT) protein, wherein the hTERT protein (i) is devoid of telomerase catalytic activity by deletion of amino acids VDD within the hTERT catalytic site and, optionally, by deletion of 1 to 12 amino acids upstream and/or downstream from VDD as compared to wild-type hTERT protein, (ii) is devoid of a nucleolar localization signal sequence by deletion of at least amino acids 1-23 as compared to wild-type hTERT protein, and (iii) is fused to an amino acid sequence which enhances the addressing of the hTERT protein to a proteasome.
30. The nucleic acid molecule of claim 29, wherein the hTERT protein is devoid of the nucleolar localization signal by deletion of amino acids 1-47 as compared to wild-type hTERT protein.
31. The nucleic acid molecule of claim 29, wherein the amino acid sequence which enhances the addressing of the hTERT protein to the proteasome is fused to the N-terminus of the hTERT protein.
32. The nucleic acid molecule of claim 29, wherein the amino acid sequence which enhances the addressing of the hTERT protein to the proteasome is a sequence of ubiquitin.
33. The nucleic acid molecule of claim 29, wherein the amino acid sequence which enhances the addressing of the hTERT to the proteasome is a sequence of a chaperone protein.
34. The nucleic acid molecule of claim 29, wherein the nucleic acid is a DNA molecule.
35. The nucleic acid molecule of claim 29, comprising a sequence encoding a fusion protein which comprises the amino acid sequence that has greater than 80% identity to SEQ ID NO: 12, wherein said fusion protein (i) is devoid of telomerase catalytic activity by deletion of amino acids VDD within the hTERT catalytic site, (ii) is devoid of a nucleolar localization signal sequence by deletion of at least amino acids 1-23 as compared to wild-type hTERT protein, and (iii) is fused to an amino acid sequence which enhances the addressing of the hTERT protein to a proteasome.
36. The nucleic acid molecule of claim 29, wherein the amino acid sequence of the fusion protein consists of SEQ ID NO: 12.
37. The nucleic acid molecule of claim 29, wherein the amino acid sequence of the fusion protein consists of SEQ ID NO: 14, 16 or 18.
38. The nucleic acid molecule of claim 29, wherein the fusion protein comprises the amino acid sequence SEQ ID NO: 4 fused at the N-terminus to an amino acid sequence which enhances the addressing of the protein to a proteasome.
39. A method for triggering an immune response in a subject, against cells that overexpress telomerase, wherein the method comprises administering to the subject an effective amount of the nucleic acid molecule-of claim 29.
40. A method for preventing or treating a tumor in a subject in need thereof, wherein the method comprises administering to the subject an effective amount of the nucleic acid-molecule of claim 29.
41. The method of claim 39, wherein the cells that overexpress telomerase are dysplasia cells, tumor cells, or cells infected by an oncovirus.
42. The method of claim 40, wherein the cells that overexpress telomerase are dysplasia cells, tumor cells, or cells infected by an oncovirus.
43. An immunogenic composition comprising (a) the nucleic acid molecule of claim 29 and (b) a carrier and/or excipient.
Description
BRIEF DESCRIPTION OF FIGURES
[0016] The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
[0017] The Figures and Examples illustrate the invention without limiting its scope.
TABLE-US-00001 FIG. 1A INVAC-1 plasmid map Location (bases) Sequence Origin 1-3478 NTC8685-eRNA41H-HindIII- NTC XbaI vector 3479-3484 HindIII cloning site: A.AGCTT NTC/Invectys 3485-6967 Ubi-hTERT transgene Invectys 6968-6973 XbaI cloning site: T.CTAGA Invectys/NTC 6974-7120 NTC8685-eRNA41H-HindIII- NTC XbaI vector
[0018] Vector Features
[0019] eRNA11a RIG-I agonist: 7-532
[0020] trpA prokaryotic terminator: 535-564
[0021] Adenovirus serotype 5 VA RNAI (VA1): 568-761
[0022] Primosomal assembly site (PAS-BH) extended origin: 771-1055
[0023] pUC replication origin: 1056-2070
[0024] Sucrose selection marker (RNA-OUT): 2087-2231
[0025] SV40 enhancer: 2232-2451
[0026] CMV enhancer: 2452-2897
[0027] CMV promoter: 2898-3017
[0028] Untranslated leader (exon 1): 3018-3204
[0029] HTLV-1 R: 3089-3314
[0030] Synthetic Rabbit ?-globin-based 3 intron: 3323-3429
[0031] Exon 2 (SR-protein binding sites-Kozak): 3430-3478
[0032] Ubi-hTERT transgene including HindIII-XbaI cloning sitesInvectys): 3479-6973
[0033] Eukaryotic terminator: 6980-7114
[0034]
[0035] INVAC-1 expression vector was verified by restriction mapping. The pattern corresponds to expected restriction map.
[0036] Lane 1: 1 kb Ladder
[0037] Lane 2: Undigested INVAC-1
[0038] Lane 3: INVAC-1 digested with BglII/NotI (3496, 3262, 220, 142 bp bands)
[0039] Lane 4: INVAC-1 digested with NcoI (4084, 3036 bp bands)
[0040] Lane 5: INVAC-1 digested with HindIII/XbaI (3631, 3489 bp bands)
[0041]
[0042] Schematic alignment between wild-type hTERT and modified Ubi-hTERT proteins encoded by INVAC-1 and INVAC-1 derivatives: pUTD10Not (abbreviated as ?10Not), pUTD10Cog (abbreviated as ?10Cog) and pUTD23Tyn (abbreviated as ?23).
[0043] Sequence Features:
[0044] VDD: Deletion of amino acids 867-869 within the catalytic site
[0045] DGLLLRL (SEQ ID NO: 19): Additional deletion of amino acids 860-867; upstream VDD deletion
[0046] FLLVTPH (SEQ ID NO: 20): Additional deletion of amino acids 869-876; downstream VDD deletion
[0047] IRR: Additional deletion of amino acids 857-859; upstream DGLLLRLVDD (SEQ ID NO: 21): deletion
[0048] LTH: Additional deletion of amino acids 877-879; downstream VDDFLLVTPH (SEQ ID NO: 22): deletion
[0049] Ubi: human ubiquitin sequence (1-76 amino acids)
[0050] V5: C-terminal V5 tag for convenient protein detection
[0051] (In
[0052]
[0053] pUTD10Not, pUTD10Cog and pUTD23Tyn expression vectors (INVAC-1 derivatives) were verified by restriction mapping. The patterns correspond to expected restriction maps.
[0054] Lane M: 1 kb ladder
[0055] Lane 1: pUTD10Cog (5348, 3585 bp bands)
[0056] Lane 2: pUTD10Not (5348, 3585 bp bands)
[0057] Lane 3: pUTD23Tyn (5348, 3546 bp bands)
[0058]
[0059] Wild-type hTERT (pTRIP-CMV-hTERT), empty vector (pNTC8685-eRNA41H, INVAC-1 backbone with no foreign coding sequence), INVAC-1 and INVAC-1 derivative constructs (pUTD10Not/?10Not, pUTD10Cog/?10Cog and pUTD23Tyn/?23) were transfected into HEK293T cells (
[0060] Protein expression was monitored for 18-96 h post-transfection in HEK293T cells (
[0061] The time of cell harvesting is indicated on the top of each lane. Fifteen ?g of total protein from cell lysates were loaded per lane for membranes
[0062]
[0063] Wild-type hTERT (pTRIP-CMV-hTERT), empty vector (pNTC8685-eRNA41H, INVAC-1 backbone with no foreign coding sequence) and INVAC-1 constructs were transfected into HEK293T (
[0064] The cells were processed to immunofluorescence staining with an anti-hTERT rabbit monoclonal antibody and a goat Alexa Fluor 488? anti-rabbit secondary antibody (green). The nuclei were stained with DAPI (blue). Untreated cells were stained with DAPI only. The cells were analyzed upon fluorescence microscopy (?63).
[0065]
[0066] CrFK cells were transfected with wild-type hTERT (pTRIP-CMV-hTERT), INVAC-1 and INVAC-1 derivative constructs. Twenty-four hours later cells were collected, total cell proteins were extracted and telomerase (reverse transcriptase) activity was assessed by Telomeric Repeat Amplification Protocol (TRAP) assay. Absorbance measurements (OD450/690 nm) and Relative Telomerase Activity (RTA; sample/positive control ratio) of INVAC-1 (
[0067] No telomerase activity was detected in CrFK cells transfected with INVAC-1 and INVAC-1 derivatives.
[0068]
[0069]
[0070] Seven to ten week-old transgenic HLA-B7 mice were immunized via
[0071]
[0072] Seven week-old C57BL/6 female mice were immunized ID
[0073]
[0074] Seven to ten week-old transgenic HLA-B7 mice were immunized via the ID route (5 mice per group) with 25 ?g of INVAC-1. All animals received an electroporation at each vaccine site directly after the immunization. Twenty one days later mice received a boost injection using the same procedure. Peripheral blood was collected before the first immunization, at day 7, 15 and 21 post-priming and at day 9, 16 and 22 post-boost.
[0075] PBMCs were Ficoll purified and stimulated in an IFN-? ELIspot assay in triplicates a pool of 3 hTERT specific peptides restricted to the HLA-B7 MHC (p351, p1123 and p277) for 19 hours. Spots were revealed with a biotin-conjugated detection antibody followed by streptavidin-AP and BCIP/NBT substrate solution. Results are the median frequency of hTERT specific CD8 T-cells secreting IFN?/200,000 splenocytes. Mann-Whitney non parametric test, *: p-value<0.05. A hatched line was voluntarily set at 10 spots/200,000 splenocytes to allow determination of responding animals.
[0076]
[0077]
[0078]
[0079]
[0080] Seven to 13 week-old transgenic HLA-B7 mice were immunized via the ID route (6 mice per group) with 25 ?g of INVAC-1, hTERT?VDD (pNTC-hTERT-?VDD), hTERT (pNTC-hTERT) or empty vector NTC (pNTC8685-eRNA41H). Forty-eight animals received an electroporation at each vaccine site directly after the immunization. Half of the animals received a boost injection twenty one days after the first vaccination using the same procedure. Mice spleens were harvested 14 days or 10 days after the last immunization respectively for the animals which received a single or a priming and boost injections.
[0081] Splenocytes were Ficoll purified and stimulated in an IFN-? ELIspot assay in triplicates, with a set of 269 purified peptides from hTERT (purity>70%, GenScript) divided into 27 pool of 9-10 hTERT overlapping peptides (15mer peptides overlapping by 11 amino acids), during an overnight stimulation (19 hours). Spots were revealed with a biotin-conjugated detection antibody followed by streptavidin-AP and BCIP/NBT substrate solution.
[0082] For each mouse, the median number of spots was calculated per triplicates and per stimulation condition (medium or peptides pool). The frequency (F) of hTERT specific T-cells was then calculated after subtraction of the median number of spots in medium stimulated wells from the median number of spots in peptides pool stimulated wells. Negative values were set to 0 for subsequent analyses.
[0083] This analysis was performed for the animals which received a single (
[0084] (
[0085]
[0086]
[0087]
[0088]
[0089]
[0090]
[0091]
[0092]
[0093]
[0094]
[0095]
[0096] A hatched line was drawn at 500 mm.sup.3 to allow calculation of the tumor growth delay.
[0097]
[0098] Seven to ten week-old transgenic HLA-A2/DR1 mice were immunized via the ID route (5 mice per group) with 100 ?g of INVAC-1, 100 ?g of INVAC-1 and 1 ng IL-12, 1?PBS or 1?PBS and 1 ng IL-12. All animals received an electroporation at each vaccine site directly after INVAC-1 immunization. Fourteen days after vaccination, spleens of all mice were harvested. Splenocytes were Ficoll purified and stimulated in triplicates in an IFN-? ELIspot assay with a pool of 2 hTERT specific peptides restricted to the HLA-A2 (UCP4.1 and UCP2.1) for 19 hours. Spots were revealed with a biotin-conjugated detection antibody followed by streptavidin-AP and BCIP/NBT substrate solution. Results are the median frequency of hTERT specific CD8 T-cells secreting IFN?/200,000 splenocytes. A hatched line was set at 10 spots/200,000 splenocytes to allow the determination of responding animals.
[0099]
[0100]
[0101]
[0102]
TABLE-US-00002 FIG. 20 INVAC-1 shuffled derivatives plasmid maps Location (bases) Sequence Origin 1-882 pcDNA?3.1 (+) vector Invitrogen commercial vector backbone used by GeneCust 883-922 Multiple cloning site Invitrogen (MCS) containing HindIII cloning site: A.AGCTT 923-4474 Ubi-hTERT shuffled Invectys transgenes 4475-4517 Multiple cloning site Invitrogen (MCS) containing XbaI cloning site: T.CTAGA 4518-8918 pcDNA?3.1 (+) vector Invitrogen commercial vector backbone used by GeneCust
TABLE-US-00003 FIG. 20A pUTScram: Vector features Location Gene (bases) CMV promoter 232-819 T7 promoter 863-882 hUbi (human ubiquitin) 923-1150 4xGly linker (SEQ ID NO: 98) 1151-1162 Scrambled hTERT (scrambled human TERT) 1163-4414 hTERT fragment 7 1163-1372 6xGly linker (SEQ ID NO: 99) 1373-1390 hTERT fragment 2 1391-1591 6xGly linker (SEQ ID NO: 99) 1592-1609 hTERT fragment 6 1610-1921 6xGly linker (SEQ ID NO: 99) 1922-1939 hTERT fragment 4 1940-2056 6xGly linker (SEQ ID NO: 99) 2057-2074 hTERT fragment 9 2075-2650 6xGly linker (SEQ ID NO: 99) 2651-2668 hTERT fragment 3 2669-2788 6xGly linker (SEQ ID NO: 99) 2789-2806 hTERT fragment 1 2807-3064 6xGly linker (SEQ ID NO: 99) 3065-3082 hTERT fragment 8 3083-3559 6xGly linker (SEQ ID NO: 99) 3560-3577 hTERT fragment 10 3578-4093 6xGly linker (SEQ ID NO: 99) 4094-4111 hTERT fragment 5 4112-4414 6xGly linker (SEQ ID NO: 99) 4415-4432 tag V5 4433-4474 BGH polyadenylation sequence 4518-4742 f1 ori (f1 origin) 4788-5216 SV40 early promoter and origin 5221-5564 Neomycin gene 5626-6420 SV40 pA (SV40 early polyadenylation signal) 6594-6724 pUC origin (complementary strand) 7107-7777 Ampicillin gene (complementary strand) 7922-8782
TABLE-US-00004 FIG. 20B pUTInv: Vector features Location Gene (bases) CMV promoter 232-819 T7 promoter 863-882 hUbi (human ubiquitin) 923-1150 4xGly linker (SEQ ID NO: 98) 1151-1162 Inverted hTERT (inverted human TERT) 1163-4414 hTERT fragment 10 1163-1678 6xGly linker (SEQ ID NO: 99) 1679-1696 hTERT fragment 9 1697-2272 6xGly linker (SEQ ID NO: 99) 2273-2290 hTERT fragment 8 2291-2767 6xGly linker (SEQ ID NO: 99) 2768-2785 hTERT fragment 7 2786-2995 6xGly linker (SEQ ID NO: 99) 2996-3013 hTERT fragment 6 3014-3325 6xGly linker (SEQ ID NO: 99) 3326-3343 hTERT fragment 5 3344-3646 6xGly linker (SEQ ID NO: 99) 3647-3664 hTERT fragment 4 3665-3781 6xGly linker (SEQ ID NO: 99) 3782-3799 hTERT fragment 3 3800-3919 6xGly linker (SEQ ID NO: 99) 3920-3937 hTERT fragment 2 3938-4138 6xGly linker (SEQ ID NO: 99) 4139-4156 hTERT fragment 1 4157-4414 6xGly linker (SEQ ID NO: 99) 4415-4432 tag V5 4433-4474 BGH polyadenylation sequence 4518-4742 f1 ori (f1 origin) 4788-5216 SV40 early promoter and origin 5221-5564 Neomycin gene 5626-6420 SV40 pA (SV40 early polyadenylation signal) 6594-6724 pUC origin (complementary strand) 7107-7777 Ampicillin gene (complementary strand) 7922-8782
[0103]
[0104] pUTScram expression vector was verified by restriction mapping. The pattern corresponds to expected restriction map.
[0105] Lane M: 1 kb Ladder
[0106] Lane 1: pUTScram digested with HindIII/XbaI (3576, 5342 bp bands)
[0107]
[0108] pUTInv expression vector was verified by restriction mapping. The pattern corresponds to expected restriction map.
[0109] Lane M: 1 kb Ladder
[0110] Lane 1: pUTInv digested with HindIII/XbaI (3576, 5342 bp bands)
[0111]
[0112] Schematic alignment between wild-type hTERT and modified Ubi-hTERT proteins encoded by INVAC-1 and INVAC-1 shuffled derivatives: pUTScram (Scrambled) and pUTInv (Inverted).
[0113] Modified hTERT sequence (?VDD) was divided into ten immunogenic fragments: fragment 1 (258 bp; Leu24-Gly109), fragment 2 (201 bp; Phe115-Ala181), fragment 3 (120 bp; Trp203-Ala242), fragment 4 (117 bp; Ser255-Arg293), fragment 5 (303 bp; Pro320-Thr420), fragment 6 (312 bp; Ala423-Val526), fragment 7 (210 bp; Cys528-Gln597), fragment 8 (477 bp; Arg599-Lys757), fragment 9 (576 bp; Lys760-Ile951), fragment 10 (516 bp; Asn958-Asp1129).
[0114] Sequence features:
[0115] VDD: Deletion of amino acids 867-869 within the catalytic site
[0116] Ubi: human ubiquitin sequence (1-76 amino acids)
[0117] F (Phe): Phenylalanine residue of hTERT (AA47)
[0118] G (Gly): C-terminal glycine residue of ubiquitin (AA76)
[0119] R (Arg): Arginine, first amino acid of INVAC-1 protein (AA 77)
[0120] N (Asn): Asparagine, first amino acid of artificial hTERT protein (Scrambled) encoded by pUTScram (AA 81)
[0121] C (Cys): Cysteine, first amino acid of artificial hTERT protein (Inverted) encoded by pUTInv (AA 81)
[0122] V5: C-terminal V5 tag for convenient protein detection
[0123]
[0124] Wild type hTERT, INVAC-1, pUTScram and pUTInv were transfected into HEK293T cells. Protein expression was monitored for 18-96 h post-transfection. (
[0125] Shuffled protein signal intensities were normalized to ?-actin signal on western blot (
[0126]
[0127] CrFK cells were transfected with wild-type hTERT (pTRIP-CMV-hTERT), pUTScram and pUTInv constructs. Twenty-four hours later cells were collected, total cell proteins were extracted and telomerase (reverse transcriptase) activity was assessed by Telomeric Repeat Amplification Protocol (TRAP) assay. Absorbance measurements (OD450/690 nm) and Relative Telomerase Activity (RTA; sample/positive control ratio) of shuffled constructs (
[0128]
[0129] Nine to fifteen week-old transgenic HLA-B7 mice were immunized via the ID route (3-5 mice per group) with 100 ?g of INVAC-1, pUTScram, pUTInv or 1?PBS upon two immunization cycles (prime-boost regimen). An electroporation was performed at each vaccination site directly after each immunization. Mice spleens were harvested 10 days after the second immunization.
[0130] Splenocytes were Ficoll purified and stimulated in an IFN-? ELIspot assay in triplicates with a pool of 3 specific hTERT peptides restricted to the HLA-B7 MHC (p277, p351 and p1123) or free medium for 19 hours. Spots were revealed with a biotin-conjugated detection antibody followed by streptavidin-AP and BCIP/NBT substrate solution. Results are the median frequency of hTERT specific CD8 T-cells secreting IFN?/200,000 splenocytes. Mann Whitney non parametric test was performed, *: p-value<0.05. A cut-off was voluntarily set at 10 spots/200,000 splenocytes in order to determine the frequency of responding animals (hatched line).
[0131]
[0132] Fifteen week-old transgenic HLA-B7 mice were immunized via the ID route (4-6 mice per group) with 100 ?g of INVAC-1, pUTScram, pUTInv or 1?PBS. All animals received an electroporation at each vaccine site directly after the immunization. At day 14 post injection, syngeneic splenocytes, pulsed with individual hTERT peptides restricted to the HLA-B7 MHC (either p351 or p1123) or left unpulsed were labeled with carboxyfuorescein-diacetate succinimidyl ester (CFSE) at three different concentrations: high=5 (351), medium=2 ?M (1123) and low=0.2 ?M (unpulsed). A mix containing an equal number of CFSE labeled cells from each concentration was injected through the retro-orbital vein (IV) to vaccinated mice. After 15-18 hours, the disappearance of peptide-pulsed cells was determined in the spleen by flow cytometry. The percentage of specific lysis was calculated by comparing the ratio of pulsed to unpulsed cells in vaccinated versus control mice. Data represent the percentage of specific lysis for each mouse against each individual peptide in the spleen after ID vaccination. Horizontal bars show median percentage of lysis per peptide. Statistical analyses were performed with Prism 5 software using a non-parametric Kruskal-Wallis test with Dunn's correction. p-value<0.05 was considered as statistically significant.
[0133]
[0134]
[0135]
DETAILED DESCRIPTION OF THE INVENTION
Definitions
[0136] The telomerase complex consists of an RNA template and protein components including a reverse transcriptase, designated Telomerase Reverse Transcriptase (TERT), which is the major determinant of telomerase activity. Unless otherwise specified, in the present specification, the term telomerase refers to TERT, including wild-type human telomerase, or variants thereof. Wild-type human telomerase (or hTERT) is known (GeneBank Accession number NM_198253), and has amino acid sequence SEQ ID NO: 2 (the cDNA is shown as SEQ ID NO: 1)
[0137] The telomerase catalytic activity refers to the activity of TERT as a telomerase reverse transcriptase. The term devoid of telomerase catalytic activity means that the nucleic acid sequence encodes a mutant TERT, which is inactive.
[0138] In the present invention, the term variant refers to allelic variants, splicing variants, natural or artificial mutants, which are homologous to the hTERT sequence of reference. Two amino acid sequences are homologous, substantially homologous or substantially similar when one or more amino acid residue are replaced by a biologically similar residue or when greater than 80% of the amino acids are identical, or greater than about 90%, preferably greater than about 95%, are similar (functionally identical). Preferably, the similar or homologous sequences are identified by alignment using, for example, the GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wis.) pileup program, or any of the programs known in the art (BLAST, FASTA, etc.).
[0139] By substituted or modified the present invention includes those amino acids that have been altered or modified from naturally occurring amino acids.
[0140] Variants include proteins having a sequence that differs from wild-type hTERT protein by one or several mutations (i.e. substitutions, deletions, insertions), still preferably one or several single point substitutions. The variant may comprise conservative substitutions.
[0141] The term conservative substitution as used herein denotes the replacement of an amino acid residue by another, without altering the overall conformation and function of the peptide, including, but not limited to, replacement of an amino acid with one having similar properties (such as, for example, polarity, hydrogen bonding potential, acidic, basic, shape, hydrophobic, aromatic, and the like). Amino acids with similar properties are well known in the art. For example, arginine, histidine and lysine are hydrophilic-basic amino acids and may be interchangeable. Similarly, isoleucine, a hydrophobic amino acid, may be replaced with leucine, methionine or valine. Neutral hydrophilic amino acids, which can be substituted for one another, include asparagine, glutamine, serine and threonine.
[0142] The term isolated polynucleotide is defined as a polynucleotide removed from the environment in which it naturally occurs. For example, a naturally-occurring DNA molecule present in the genome of a living bacteria or as part of a gene bank is not isolated, but the same molecule separated from the remaining part of the bacterial genome, as a result of, e.g., a cloning event (amplification), is isolated. Typically, an isolated DNA molecule is free from DNA regions (e. g., coding regions) with which it is immediately contiguous at the 5 or 3 end, in the naturally occurring genome. Such isolated polynucleotides may be part of a vector or a composition and still be defined as isolated in that such a vector or composition is not part of the natural environment of such polynucleotide.
[0143] The term immunogenic means that the composition or construct to which it refers is capable of inducing an immune response upon administration. Immune response in a subject refers to the development of an innate and adaptative immune response, including a humoral immune response, a cellular immune response, or a humoral and a cellular immune response to an antigen. A humoral immune response refers to one that is mediated by antibodies. A cellular immune response is one mediated by T-lymphocytes. It includes the production of cytokines, chemokines and similar molecules produced by activated T-cells, white blood cells, or both. Immune responses can be determined using standard immunoassays and neutralization assays for detection of the humoral immune response, which are known in the art.
[0144] In the context of the invention, the immune response preferably encompasses stimulation or proliferation of cytotoxic CD8 T-cells and/or CD4 T-cells and can be determined using immunoassays such as the ELIspot assay, the in vivo cytotoxicity assay or the cytokine secretion binding assay.
[0145] As used herein, the term treatment or therapy or immunotherapy refers to any of the alleviation, amelioration and/or elimination, reduction and/or stabilization (e.g., failure to progress to more advanced stages) of a symptom, as well as delay in progression of the tumor or dysplasia, or of a symptom thereof. The term thus includes achievement of an efficient anti tumoral immune response observed in cancer patients.
[0146] As used herein, the term prevention or preventing refers to the alleviation, amelioration and/or elimination, reduction and/or stabilization (e.g., failure to progress to more advanced stages) of a prodrome, i.e. any alteration or early symptom (or set of symptoms) that might indicate the start of a disease before specific symptoms occur.
[0147] A cell that overexpresses telomerase refers to a cell in a subject, which either expresses telomerase, e.g. upon mutation or infection, especially infection by an oncovirus, whereas it does usually not, under normal conditions, or to a cell in a subject which expresses a higher level of telomerase (e.g. upon mutation or infection), when compared to normal conditions. Preferably the cell that overexpresses telomerase shows an increase of expression of at least 5%, at least 10%, at least 20%, 30%, 40%, 50%, 60%, 70%, 80%, or more.
[0148] The patient or subject is typically a mammal subject, preferably a human subject, of any age, sex, or severity of the condition.
Nucleic Acid Constructs
[0149] It is herein provided a nucleic acid construct that is designed to allow vaccination in patients. The nucleic acid construct encodes a telomerase that is devoid of telomerase catalytic activity (which abolishes its immortalizing activity) and devoid of a nucleolar localization signal (which prevents its transfer to the nucleolus).
[0150] The nucleic acid construct of the invention is in isolated form.
[0151] The nucleic acid may be DNA or RNA, but is preferably DNA, still preferably double stranded DNA.
[0152] The nucleic acid construct is not a naturally-occurring genomic nucleic acid, in particular it does not comprise introns.
[0153] As a first safety lock, the hTERT sequence is devoid of telomerase catalytic activity. In a preferred embodiment, the sequence that encodes hTERT contains mutations that provide inactivation of the catalytic activity of the hTERT protein. The term mutation includes a substitution of one or several amino acids, a deletion of one or several amino acids, and/or an insertion of one or several amino acids. In a particular embodiment, the hTERT protein is devoid of telomerase catalytic activity by deletion of at least one amino acid.
[0154] Preferably the sequence shows a deletion, preferably a deletion of amino acids VDD, as shown in
[0155] As a second safety lock, the sequence encoding hTERT is further devoid of the nucleolar localization signal. This nucleolar localization signal is correlated with the subcellular localization of hTERT and thus its enzymatic activity. Preferably the hTERT protein is devoid of a nucleolar localization signal by deletion of at least amino acids 1-23, still preferably by deletion of amino acids 1-47.
[0156] In addition to the modifications that provide the first and second safety locks, the hTERT protein encoded by the nucleic acid construct of the invention may be a wild-type hTERT sequence, or a variant sequence.
[0157] In the sequence listing,
SEQ ID NO: 1 is the cDNA of the wild-type hTERT;
SEQ ID NO: 2 is the corresponding amino acid sequence;
SEQ ID NO: 3 is the cDNA of hTERT used in the INVAC-1 vector;
SEQ ID NO: 4 is the corresponding amino acid sequence;
SEQ ID NO: 5 is the cDNA of hTERT used in the pUTD10Not vector;
SEQ ID NO: 6 is the corresponding amino acid sequence;
SEQ ID NO: 7 is the cDNA of hTERT used in the pUTD10Cog vector;
SEQ ID NO: 8 is the corresponding amino acid sequence;
SEQ ID NO: 9 is the cDNA of hTERT used in the pUTD23Tyn vector;
SEQ ID NO: 10 is the corresponding amino acid sequence.
[0158] In a preferred embodiment, the invention employs a nucleic acid that encodes a protein of SEQ ID NO: 4.
[0159] Such nucleic acid may comprise sequence SEQ ID NO: 3.
[0160] In another embodiment, the nucleic acid construct encodes amino acid sequence SEQ ID NO: 6, 8 or 10, and preferably comprises SEQ ID NO: 5, 7 or 9.
[0161] In a preferred embodiment, the nucleic acid may further encode a protein which enhances the addressing of the hTERT protein to the proteasome (increasing class I presentation of the derived peptides). More particularly, the hTERT protein may be fused at the N-terminus with such protein enhancing addressing of the hTERT protein to the proteasome. Said protein may be preferably ubiquitin or it may be any chaperon protein, e.g. calreticulin.
[0162] In the sequence listing
SEQ ID NO: 11 is the full-length sequence of INVAC-1 plasmid including the cDNA of Ubi-hTERT encoded by INVAC-1;
SEQ ID NO: 12 is the corresponding amino acid sequence of Ubi-hTERT encoded by INVAC-1;
SEQ ID NO: 13 is the cDNA of the pUTD10Not insert;
SEQ ID NO: 14 is the corresponding amino acid sequence;
SEQ ID NO: 15 is the cDNA of the pUTD10Cog insert;
SEQ ID NO: 16 is the corresponding amino acid sequence;
SEQ ID NO: 17 is the cDNA of the pUTD23Tyn insert;
SEQ ID NO: 18 is the corresponding amino acid sequence.
[0163] In a particular embodiment, the nucleic acid construct encodes amino acid sequence SEQ ID NO: 12.
[0164] More particularly, the nucleic acid construct may comprise SEQ ID NO: 11, or nucleotides 3488 to 6961 of SEQ ID NO: 11.
[0165] In another embodiment, the nucleic acid construct encodes amino acid sequence SEQ ID NO: 14, 16, or 18, and preferably comprises SEQ ID NO: 13, 15, or 17.
[0166] In another embodiment, it is provided nucleic acid constructs comprising sequences that derive from human telomerase reverse transcriptase (hTERT), wherein said sequences that derive from hTERT
i) encode all or substantially all epitopes of hTERT, in any order, and
ii) encode a protein that is devoid of telomerase catalytic activity and of a nucleolar localization signal.
[0167] The nucleic acid construct of the invention is in isolated form.
[0168] The nucleic acid may be DNA or RNA, but is preferably DNA, still preferably double stranded DNA. The nucleic acid construct is not a naturally-occurring genomic nucleic acid, in particular it does not comprise introns.
[0169] These constructs are designated shuffled constructs or polyepitope constructs throughout the present description.
[0170] The term epitope of hTERT refers to any amino acid fragment of hTERT that is an antigenic determinant, i.e. it is recognized by cells of the immune system and is immunogenic, i.e. it can elicit an immune response. Preferably, it can be recognized, specifically by anti-hTERT T-cells. Several immunogenic epitope sequences of hTERT have been described. See e.g., international patent application WO07014740 for WIC class I restricted hTERT epitopes. Some others are described herein (see
[0171] These shuffled constructs are capable of eliciting a specific immune response against hTERT, i.e. that cytotoxic T lymphocytes (CTLs) recognize the wild type epitopes.
[0172] None of these shuffled constructs coincides with the coding sequence of the full length hTERT.
[0173] The term substantially all epitopes means that the nucleic acid construct encodes a protein that comprises at least 80%, still preferably at least 85%, still preferably at least 90%, or at least 95% of the epitopes of wild-type hTERT.
[0174] The polynucleotide units encoding the multiple epitopes can be rearranged in any order, consecutively, i.e., the 3 end of the first polynucleotide unit is directly linked to the 5 end of the second polynucleotide unit (and so on), resulting in a polynucleotide encoding a peptidic sequence exclusively composed of consecutive epitopes. The multiple epitopes can alternatively be separated by a one-amino acid spacer or a peptide spacer, i.e., meaning that the different polynucleotide units are separated by one or several codon(s) encoding respectively one or several amino acid(s). Typically, the immunogenic hTERT fragments can be separated by about four to six Gly amino acids (SEQ ID NO: 100).
[0175] The order in which the epitopes are rearranged can be determined by the man skilled in the art, according to the following criteria: some orders may facilitate either the transcription and/or the translation of the polynucleotide, may facilitate the transport of the resulting expressed polyepitope in the endoplasmic reticulum (ER), especially if the tridimensional conformation impacts the properties, and may facilitate the processing of the polyepitope in several epitopes or analogues and avoid the processing of overlapping epitopes.
[0176] In a preferred embodiment, all, or substantially all, immunogenic epitopes from amino acid 24 to amino acid 1132 of hTERT are encoded by the nucleic acid construct, although in any order.
[0177] The Table below shows immunogenic sequences that can be rearranged in a Shuffle construct:
TABLE-US-00005 SEQ ID Immunogenicsequence NO: RRLGPQGWRLVQRGDPAAFRALVAQCLVCVPW 61 DAR VSCLKELVARVLQRL 62 VLAFGFALL 63 RSYLPNTVTDALRGSGAWGLLLRRVGDDVLVH 64 LLARCALFVLVAPSCAYQVCGPPLY REAGVPLGL 65 RRRGGSASRSLPLPKR 66 GRTRGPSDRGFCVVSPARPAEEATSLEGA 67 YAETKHFLYSSGDKEQLRPSFLLSSLRPSL 68 ARRLVETIFLGSRP 69 RRLPRLPQRYWQMRPLFLELLGNHAQCP 70 VLLKTHCPL 71 REKPQGSVA 72 EEDTDPRRLVQLLR 73 VYGFVRACLRRLVPPGLWGS 74 RRFLRNTKK 75 HAKLSLQEL 76 SVRGCAWLR 77 EHRLREEILAKFLHWLMSVYVVELLRSF 78 ETTFQKNRL 79 KSVWSKLQSIGIRQH 80 AEVRQHREARPALLTSRLRFIPK 81 DYVVGARTFRREKRAERLTSRVKAL 82 YERARRPGLLGASVLGL 83 HRAWRTFVLRVRAQDPPPELYFVKVDVTGAYD 84 TIPQDRLTEVIASIIKPQ TYCVRRYAVVQKAAH 85 TLTDLQPYMRQFVAHL 86 SPLRDAVVIEQSSSLNEASSGLFDVFLR 87 AVRIRGKSY 88 ILSTLLCSLCYGDMENKL 89 IRRDGLLLRLFLLVTPHLTHAKTFLRTLVRGVP 90 EYGCVVNLRKTVVNF DEALGGTAFVQMPAHGLFPWCGLLLDTRTLEV 91 QSDYSSY AGRNMRRKLFGVLRLKCHSLFLDLQVNSLQT 92 IYKILLLQAYRFHACVLQLPFHQQV 93 NPTFFLRVISDTASLCYSILKAKNAGMS 94 GAKGAAGPL 95 WLCHQAFLLKLTRHRVTYVPLLGSLRTAQTQL 96 SRKLPGTTL LEAAANPALPSDFKTIL 97
[0178] Accordingly, the invention provides a polyepitopic nucleic acid construct, comprising all or substantially all of the immunogenic sequences shown as SEQ ID NO: 61 to 97, in any order. The sequence is devoid of telomerase catalytic activity. In a preferred embodiment, the fragment that carries the hTERT catalytic activity contains mutations that provide inactivation of the catalytic activity. The term mutation includes a substitution of one or several amino acids, a deletion of one or several amino acids, and/or an insertion of one or several amino acids. In a particular embodiment, the protein is devoid of telomerase catalytic activity by deletion of at least one amino acid.
[0179] Preferably the sequence shows a deletion, preferably a deletion of amino acids VDD, as shown in
[0180] The sequence is further devoid of a nucleolar localization signal. This nucleolar localization signal is correlated with the subcellular localization of hTERT and thus its enzymatic activity. Preferably the protein is devoid of a nucleolar localization signal by deletion of at least amino acids 1-23, still preferably by deletion of amino acids 1-47 of hTERT.
[0181] In a preferred embodiment, the nucleic acid may further encode a protein which enhances the addressing of the protein to the proteasome (increasing class I presentation of the derived peptides). More particularly, the protein may be fused at the N-terminus with such protein enhancing addressing of the protein to the proteasome. Said protein may be preferably ubiquitin or it may be any chaperon protein, e.g. calreticulin.
[0182] ?hTERT refers to hTERT deleted of VDD 867-869 amino acids.
[0183] A particular nucleic acid construct comprises, in any order, fragment 1 encoding Leu24 to Gly109 of ?hTERT (SEQ ID NO:51), fragment 2 encoding Phe115 to Ala181 of ?hTERT (SEQ ID NO:52), fragment 3 encoding Trp203 to Ala242 of ?hTERT (SEQ ID NO:53), fragment 4 encoding Ser255 to Arg293 of ?hTERT (SEQ ID NO:54), fragment 5 encoding Pro320 to Thr420 of ?hTERT (SEQ ID NO:55), fragment 6 encoding Ala423 to Val526 of ?hTERT (SEQ ID NO:56), fragment 7 encoding Cys528 to Gln597 of ?hTERT (SEQ ID NO:57), fragment 8 encoding Arg599 to Lys757 of ?hTERT (SEQ ID NO:58), fragment 9 encoding Lys760 to Ile951 of ?hTERT (SEQ ID NO:59), fragment 10 encoding Asn958 to Asp1129 of ?hTERT (SEQ ID NO:60).
[0184] A preferred construct encodes SEQ ID NO:48 (also herein called Scrambled), also shown on
[0185] Another preferred construct encodes SEQ ID NO:50 (also herein called Inverted), also shown on
Genetic Constructs, Immunogenic Compositions and Administration
[0186] Preferably, the nucleic acid is a genetic construct comprising a polynucleotide sequence as defined herein, and regulatory sequences (such as a suitable promoter(s), enhancer(s), terminator(s), etc.) allowing the expression (e.g. transcription and translation) of the protein product in the host cell or host organism.
[0187] The genetic constructs of the invention may be DNA or RNA, and are preferably double-stranded DNA. The genetic constructs of the invention may also be in a form suitable for transformation of the intended host cell or host organism, in a form suitable for integration into the genomic DNA of the intended host cell or in a form suitable for independent replication, maintenance and/or inheritance in the intended host organism. For instance, the genetic constructs of the invention may be in the form of a vector, such as for example a plasmid, cosmid, YAC, a viral vector or transposon. In particular, the vector may be an expression vector, i.e. a vector that can provide for expression in vitro and/or in vivo (e.g. in a suitable host cell, host organism and/or expression system).
[0188] In a preferred but non-limiting aspect, a genetic construct of the invention comprises i) at least one nucleic acid of the invention; operably connected to ii) one or more regulatory elements, such as a promoter and optionally a suitable terminator; and optionally also iii) one or more further elements of genetic constructs such as 3- or 5-UTR sequences, leader sequences, selection markers, expression markers/reporter genes, and/or elements that may facilitate or increase (the efficiency of) transformation or integration.
[0189] In a particular embodiment, the genetic construct can be prepared by digesting the nucleic acid polymer with a restriction endonuclease and cloning into a plasmid containing a promoter such as the SV40 promoter, the cytomegalovirus (CMV) promoter or the Rous sarcoma virus (RSV) promoter. In a preferred embodiment, the TERT nucleic acid sequences are inserted into a NTC8685-eRNA41H expression plasmid (see
[0190] Other vectors include retroviral vectors, lentivirus vectors, adenovirus vectors, vaccinia virus vectors, pox virus vectors, measles virus vectors and adenovirus-associated vectors.
[0191] Compositions can be prepared, comprising said nucleic acid or vector. The compositions are immunogenic. They can comprise a carrier or excipients that are suitable for administration in humans or mammals (i.e. non-toxic, and, if necessary, sterile). Such excipients include liquid, semisolid, or solid diluents that serve as pharmaceutical vehicles, isotonic agents, stabilizers, or any adjuvant. Diluents can include water, saline, dextrose, ethanol, glycerol, and the like. Isotonic agents can include sodium chloride, dextrose, mannitol, sorbitol, and lactose, among others. Stabilizers include albumin, among others. Any adjuvant known in the art may be used in the vaccine composition, including oil-based adjuvants such as Freund's Complete Adjuvant and Freund's Incomplete Adjuvant, mycolate-based adjuvants, bacterial lipopolysaccharide (LPS), peptidoglycans, proteoglycans, aluminum hydroxide, saponin, DEAE-dextran, neutral oils (such as miglyol), vegetable oils (such as arachis oil), Pluronic? polyols.
[0192] The nucleic acid or composition can be administered directly or they can be packaged in liposomes or coated onto colloidal gold particles prior to administration. Techniques for packaging DNA vaccines into liposomes are known in the art, for example from Murray, 1991. Similarly, techniques for coating naked DNA onto gold particles are taught in Yang, 1992, and techniques for expression of proteins using viral vectors are found in Adolph, 1996.
[0193] For genetic immunization, the vaccine compositions are preferably administered intradermally, subcutaneously, intramuscularly, into the tumors or in any types of lymphoid organs by injection or by gas driven particle bombardment, and are delivered in an amount effective to stimulate an immune response in the host organism. In a preferred embodiment of the present invention, administration comprises an electroporation step, also designated herein by the term electrotransfer, in addition to the injection step (as described in Mir 2008, Sardesai and Weiner 2011).
[0194] The compositions may also be administered ex vivo to lymphoid or myeloid cells using liposomal transfection, particle bombardment or viral transduction (including co-cultivation techniques). The treated cells are then reintroduced back into the subject to be immunized.
[0195] While it will be understood that the amount of material needed will depend on the immunogenicity of each individual construct and cannot be predicted a priori, the process of determining the appropriate dosage for any given construct is straightforward. Specifically, a series of dosages of increasing size, starting at about 5 to 30 ?g, or preferably 20-25 ?g, up to about 500 ?g to about 5 mg, preferably up to 500-1500 ?g, 500-1200 ?g, or 500-1000 ?g, for instance, is administered to the corresponding species and the resulting immune response is observed, for example by detecting the cellular immune response by an IFN? Elispot assay (as described in the experimental section), by detecting CTL responses using an in vivo lysis assay or a chromium release assay or detecting Th (helper T-cell) response using a cytokine release assay.
[0196] In a preferred embodiment, the vaccination regimen comprises one to three injections, preferably repeated three or four weeks later.
[0197] In a particular embodiment, the vaccination schedule can be composed of one or two injections followed three or four weeks later by at least one cycle of three to five injections.
[0198] In another embodiment, a primer dose consists of one to three injections, followed by at least a booster dose every year, or every two or years for instance.
[0199] These are examples only, and any other vaccination regimen is herein encompassed.
Prevention or Treatment of Tumors
[0200] The nucleic acid or immunogenic composition as described above is useful in a method for preventing or treating a tumor in a patient.
[0201] A method for preventing or treating a tumor in a patient is described, which method comprises administering an effective amount of said nucleic acid or immunogenic composition in a patient in need thereof. Said nucleic acid or immunogenic composition is administered in an amount sufficient to induce an immune response in the patient.
[0202] The tumor may be any undesired proliferation of cells, in particular a benign tumor or a malignant tumor, especially a cancer.
[0203] The cancer may be at any stage of development, including the metastatic stage. The cancer may be chronic or non-chronic (acute).
[0204] In a particular embodiment, tumor is a solid cancer or a carcinoma. Examples include melanoma, brain tumor such as glioblastoma, neuroblastoma and astrocytoma and carcinomas of the bladder, breast, cervix, colon, lung, especially non-small cell lung cancer (NSCLC), pancreas, prostate, head and neck cancer, or stomach cancer.
[0205] In another embodiment, the tumor may be a liquid tumor, e.g. a hematopoietic tumor or leukemia, such as a chronic or acute lymphocytic leukemia, chronic or acute myeloid leukemia, lymphoma including Hodgkin's disease, multiple myeloma, malignant myeloma.
[0206] In a particular embodiment, the treatment according to the invention may be combined with conventional therapy, including chemotherapy, radiotherapy or surgery. Combinations with adjuvant immunomodulating molecules such as GM-CSF or a cytokine like IL-2 or IL-12, could also be useful.
Example I
Abbreviations
[0207] AA: Amino Acid, APC: Antigen Presenting Cell, bp: Base-pair, CTL: Cytotoxic T-Lymphocyte, CMV: Cytomegalovirus, DNA: Deoxyribonucleic Acid, EP: Electroporation, HTLV-1: Human T-lymphotropic virus Type I, hTERT: human Telomerase Reverse Transcriptase, ID: Intradermal, IM: Intramuscular, IV: Intravenous, LTRs: Long Terminal Repeats, NoLS: Nucleolar Localization Sequence, PBMC: Peripheral Blood Mononuclear Cells, RIG-I: Retinoic acid-Inducible Gene 1, RNA: Ribonucleic Acid, RT: Room Temperature, RTA: Relative Telomerase Activity, SC: Subcutanous, TRAP: Telomeric Repeat Amplification Protocol, TERT: Telomerase Reverse Transcriptase, Ubi: Ubiquitin, VDD: Valine-Aspartic Acid-Aspartic Acid
Materials and Methods
Plasmid DNA Vectors
INVAC-1
[0208] INVAC-1 is a 7120 bp plasmid expression vector encoding a human ubiquitin-telomerase fusion construct of 1158 AA (Ubi-hTERT) corresponding to a protein of approximately 127.4 kDa (
[0209] The Ubi-hTERT transgene is inserted into a NTC validated vector backbone (Nature Technology Corporation, Lincoln, Nebr.) combining carefully designed synthetic genes for high yield bacterial production, increased expression in mammalian cells and consequently effective immune responses.
[0210] Target gene expression is driven from an optimized chimeric promoter-intron (SV40-CMV-HTLV-1 R synthetic intron) composed of a CMV promoter and start of exon 1, a HTLV-I R sequence which contains the 5 splice acceptor site, a synthetic 3 acceptor site based on the rabbit ?-globin intron, an exon 2 splicing enhancer comprising a serine-arginine rich (SR) protein binding site to improve RNA export (Lavigueur et al., 1993) and an exon 2 Kozak sequence upstream of the start codon for the gene of interest. DNA between the stop codon and the terminator is limited to reduce the possibility of cryptic peptide expression or unintended microRNA-mediated expression alteration.
[0211] To improve cellular immune responses the vector encodes an RNA polymerase III transcribed double stranded RNA agonist of the retinoic acid inducible gene-1 (RIG-I) innate immune response activator.
[0212] There is no known virulence feature associated with this vector. The plasmid does not replicate in eukaryotic target cells. The vector backbone itself does not contain protein coding sequences and no alternative protein encoding open reading frames have been identified in the vector backbone, hence there is no antibiotic resistance gene. Plasmid selection is performed by the mean of an antibiotic-free sucrose selectable marker (RNA-OUT).
Gene Synthesis and Cloning
[0213] The Ubi-hTERT gene was de novo synthesized through an overlapping 40-mer oligonucleotides assembly process (GeneCust, Luxembourg). Several conservative base changes were made to eliminate restriction sites and attenuate GC rich sequences. The insert was cloned into the expression vector pcDNA3.1(+) (Invitrogen, Carlsbad, USA) using HindIII-XbaI cloning sites and verified by sequencing.
Subcloning of the Ubi-hTERT Insert into the Cloning Vector NTC8685-eRNA41H-HindIII-XbaI
[0214] The ubiquitin-telomerase insert was cloned into the NTC8685-eRNA41H-HindIII-XbaI expression vector designed by NTC. However, their best appropriate vector NTC8685-eRNA41H (ref. NTC-DV8685-41HLV) did not have restriction sites compatible with the Ubi-hTERT insert. Accordingly, this vector was digested with SalI and BglII and ligated to a synthetic double-stranded oligonucleotide which includes appropriate restriction sites for subcloning Ubi-hTERT, i.e., HindIII-XbaI:
TABLE-US-00006 (SEQIDNO:23) SalIHindIIISmaIXbaIBglII GTCGACAAGCTTCCCGGGTCTAGAAGATCT
[0215] This new vector (NTC8685-eRNA41H-HindIII-XbaI) which now includes the above polylinker was verified by restriction digestion and sequencing using pVAC5 (GCTTTTCTGCCAGGTGCTGA SEQ ID NO: 24) and pVAC3 (GCCAGAAGTCAGATGCTCAA SEQ ID NO: 25) primers annealing to sequences upstream and downstream the polylinker site respectively.
[0216] The custom-made NTC8685-eRNA41H-HindIII-XbaI vector was digested with HindIII and XbaI and the 3631 bp vector was gel purified from the 12 bp linker. The pcDNA3.1-Ubi-hTERT construct was digested with HindIII and XbaI and the 3489 bp Ubi-hTERT insert transferred by ligating into NTC8685-eRNA41H-HindIII-XbaI acceptor to create NTC8685-eRNA41H-HindIII-XbaI-Ubi-hTERT (INVAC-1) (
Plasmid Production
[0217] INVAC-1 was first produced by NTC under research grade quality conditions. Plasmid DNA was transformed into NTC4862 E. coli cells using electroporation. Cells were plated and propagated on 6% sucrose media as recommended by the manufacturer (NTC Instruction Manual, June 2011). After extraction, plasmid DNA was resuspended in endotoxin-free 1?PBS at a final concentration of 2 mg/ml.
[0218] INVAC-1 was subsequently manufactured by Eurogentec (Belgium) for GLP and GMP scale-up, and GMP production. Full-length sequencing of INVAC-1 plasmid was carried out at this point.
INVAC-1 Derivatives
[0219] All INVAC-1 derivative constructs are double stranded DNA plasmids of approximately 8.9 kb encoding human ubiquitin-telomerase fusion proteins which are enzymatically inactive (
pUTD10Not (Abbreviated as ?10Not)
[0220] The hTERT coding sequence is located between the nucleotide 923 and 4492 bp of the pcDNA3.1 plasmid backbone. pUTD10Not encodes an 1189 AA human ubiquitin-telomerase fusion protein (?10Not) corresponding to approximately 130.8 kDa of molecular weight (
pUTD10Cog (Abbreviated as ?10Cog)
[0221] The hTERT coding sequence is located between the nucleotide 923 and 4492 bp of the pcDNA3.1 plasmid backbone. pUTD10Cog encodes an 1189 AA human ubiquitin-telomerase fusion protein (?10Cog) corresponding to approximately 130.8 kDa of molecular weight (
pUTD23Tyn (Abbreviated as ?23)
[0222] The hTERT coding sequence is located between the nucleotide 923 and 4453 bp of the pcDNA3.1 plasmid backbone. pUTD23Tyn encodes an 1176 AA human ubiquitin-telomerase fusion protein (?23) corresponding to approximately 129.4 kDa of molecular weight (
Genes Synthesis and Cloning
[0223] The genes were de novo synthesized as ubiquitin-telomerase fusion constructs through an overlapping 40-mer oligonucleotides assembly process (GeneCust, Luxembourg). Gene synthesis included unique flanking restriction sites HindIII/XbaI to allow subcloning of the gene into desired expression system. The synthesized genes were cloned between HindIII and XbaI restriction sites of the pcDNA3.1(+) expression vector (Invitrogen, Carlsbad, USA). The sequences of the plasmids were verified by sequencing using PEGFP-N5 CGGTGGGAGGTCTATATAAG (SEQ ID NO: 27) and BGH CAGGGTCAAGGAAGGCAC (SEQ ID NO: 28) primers.
Plasmids Production
[0224] All INVAC-1 derivatives were transformed and produced in E. coli 5-alpha cells (fhuA2?(argF-lacZ)U169 phoA glnV44 ?80 ?(lacZ)M15 gyrA96 recA1 relA1 endA1 thi-1 hsdR17) (Lucigen Corporation, Middleton, USA, ref. 60602-2) by RD Biotech (Besancon, France). Concentrated endotoxin-free gigaprep plasmid stocks (2 mg/mL) resuspended in 1? sterile PBS were prepared. The vectors were verified by restriction mapping (HindIII-XbaI;
pTRIP-CMV-hTERT
[0225] pTRIP-CMV-hTERT encodes the 1132 AA (corresponding to approximately 124.5 kDa) wild-type human TERT (hTERT) protein with catalytic activity. This plasmid was used as a positive control for in vitro assays. The construct was first described in patent application WO 2007/014740. The pTRIP-CMV-hTERT was constructed by first subcloning an EcoRI-SalI hTERT insert derived from the pBABE-hygro-hTERT plasmid (kindly provided by Dr. Robert Weinberg) into the pSP73 vector (Promega Life Science, Wisconsin, USA) to generate the pSPhTERT construct. A BglII-SalI fragment was then inserted into the pTRIP-CMV retroviral-derived vector cut with BamHI and XhoI to create pTRIP-CMV-hTERT. The hTERT expression is driven by the human cytomegalovirus (CMV) promoter.
[0226] The pTRIP-CMV-hTERT plasmid was transformed and produced in E. coli 5-alpha cells (fhuA2?(argF-lacZ)U169 phoA glnV44 ?80 ?(lacZ)M15 gyrA96 recA1 relA1 endA1 thi-1 hsdR17) (Lucigen Corporation, Middleton, USA, ref 60602-2) by RD Biotech (Besancon, France).
[0227] A 2 mg/ml concentrated endotoxin-free gigaprep plasmid stock resuspended in 1? sterile PBS was prepared. The produced vector was verified by restriction enzyme digestion (EcoRI+BamHI=10286+2720+886 bp bands).
pNTC-hTERT
[0228] pNTC-hTERT encodes the 1132 AA wild-type human TERT (hTERT) protein with catalytic activity (SEQ. ID NO: 2). This plasmid was used to investigate the breadth of hTERT specific T-cell responses in vivo in comparison with INVAC-1 construct.
[0229] The wild-type hTERT insert was synthesized de novo with HindIII-XbaI cloning sites through an overlapping oligonucleotides assembly process (GenScript, USA). The synthetic construct (3417 bp) was cloned in pUC57 (2710 bp) by HindIII and XbaI sites and then verified by sequencing using M13/pUC (?20) and M13/pUC (?26) primers and restriction mapping (HindIII/XbaI). Consequently, the hTERT insert was subcloned by NTC into the cloning vector NTC8685-eRNA41H-HindIII-XbaI as described above (see INVAC-1 construct). The resultant vector pNTC-hTERT was verified by restriction digestion (XmaI=4375, 2041, 506, 120 bp bands; BamHI/XmnI=6887, 155 bp bands; HindIII/XbaI=3631, 3411 bp bands) and DNA sequencing using pVAC5, pVAC3 and hTERTseq (5 GGCAAGTCCTACGTCCAGTG 3, SEQ ID NO: 44) primers.
[0230] pNTC-hTERT plasmid was produced by NTC under research grade quality conditions as described before for INVAC-1 plasmid.
pNTC-hTERT-?VDD
[0231] pNTC-hTERT-?VDD encodes the 1129 AA human TERT (hTERT) sequence modified in the catalytic site by a 9 bp deletion coding for Valine-Aspartic Acid-Aspartic Acid (?VDD; 867-869 AA). This plasmid was used to investigate the breadth of hTERT specific T-cell responses in vivo in comparison with INVAC-1 construct.
[0232] hTERT-?VDD DNA sequence is identical to the wild-type hTERT except for a 3 amino acid deletion (?VDD). A 167 bp DNA insert including the 152 bp BamHI/XmnI fragment of hTERT, but with the ?VDD deletion and additional EcoRV restriction sites was synthesized de novo by GenScript. This synthetic fragment was cloned in pUC57 vector (2710 bp) using EcoRV cloning sites. The synthesized gene was verified by sequencing using M13/pUC (?20) and M13/pUC (?26) primers and restriction digests (BamHI/NdeI). This vector was then digested using BamHI/XmnI sites and the ?VDD-BamHI/XmnI fragment was cloned in the BamHI/XmnI predigested hTERT region of the pNTC-hTERT vector (6887, 155 bp bands). The resultant vector pNTC-hTERT-?VDD was verified by restriction digestion (XmaI=4375, 2032, 506, 120 bp bands; BamHI/XmnI=6887, 146 bp bands; HindIII/XbaI=3631, 3402 bp bands) and DNA sequencing using pVAC5, pVAC3 and hTERTseq (5 GGCAAGTCCTACGTCCAGTG 3 SEQ ID NO: 44) primers.
[0233] pNTC-hTERT-?VDD was produced by NTC as described before for INVAC-1 and pNTC-hTERT constructs.
Cell Cultures and Transient Transfections for Western Blot and TRAP Assays
[0234] CrFK (Crandell Rees feline kidney), HEK293T (Human embryonic kidney) and HeLa (Henrietta Lacks'Human cervical adenocarcinoma) cell lines were cultured in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% heat-inactivated fetal calf serum (PAA, Velizy-Villacoublay, France) and 1% penicillin/streptomycin (Life Technologies, Saint-Aubin, France).
[0235] QT6 (Quail Japanese fibrosarcoma) cell line was cultured in Ham's F10 (Eurobio, Courtaboeuf, France) supplemented with 10% heat-inactivated fetal calf serum (PAA), 1% penicillin/streptomycin (Life Technologies), 1% chicken serum (PAA), 10 mM L-glutamine (Sigma-Aldrich, St. Louis, USA), 0.5% tryptose broth (Sigma-Aldrich, St. Louis, USA).
[0236] Cells were grown as monolayers in 75 cm.sup.2 flasks at 37? C. in a humidified atmosphere containing 5% CO.sub.2. The cells were grown until 70-80% confluence on the day of transfection. For western blot assays, 5?10.sup.5 cells were seeded in six-well tissue culture plates and incubated for 24 h. For TRAP assays, 7?10.sup.5 cells were seeded in six-well tissue culture plates and incubated for 24 h. INVAC-1 and INVAC-1 derivative constructs were transfected into target cells using jetPrime cationic polymer transfection reagent according to manufacturer's instructions (Polyplus-transfection Inc., France). Cells transfected with pTRIP-CMV-hTERT plasmid was used as positive control and non-transfected cells or pNTC8685-eRNA41H empty plasmid transfected cells as negative control. Transfection mediums were removed 4 hours later and replaced by 2 mL of DMEM culture medium. After appropriate time of transfection18-96 hours for western blot assays and 24 hours for TRAP assays, cells were harvested and analyzed for telomerase expression and activity.
Western Blot
[0237] For western blot analyses, transfected CrFK and HEK293T cells were lysed on ice for 10-20 minutes in RIPA buffer (Sigma-Aldrich, St. Louis, USA) supplemented with a protease inhibitor cocktail (Roche Diagnostic, Indianapolis, USA). Lysates were cleared by centrifugation at 14,000 rpm for 15 minutes at 4? C. The supernatants were harvested and the protein concentration was measured using the Bradford colorimetric assay. Protein samples were denatured 5 minutes at 95? C., separated on Nu-PAGE? Novex 4-12% Bis-Tris gels (Invitrogen, Carlsbad, USA) and electroblotted onto PVDF membranes (iBlot? transfer stack, Invitrogen, Carlsbad, USA) using the iBlot? device (Invitrogen, Carlsbad, USA). Novex? Sharp Prestained Protein Ladder (Invitrogen, Carlsbad, USA) were used to determine molecular weight. The membranes were cut approximately at 60 kDa and blocked with 1?PBS, 0.05% Tween? 20, 3% milk. The upper part of the membrane was probed with an anti-hTERT rabbit monoclonal antibody (Abcam, Cambridge, UK) diluted at 1/2000 in blocking buffer or an anti-V5 mouse monoclonal antibody (Invitrogen, Carlsbad, USA) diluted at 1/5000. The lower part of the membrane was probed with an anti-?-actin mouse monoclonal antibody (Sigma Aldrich SARL, Saint-Quentin Fallavier, France) diluted at 1/5000. Finally, the relevant proteins were visualized by staining with the appropriate secondary horseradish peroxidase (HRP) conjugated antibody for 1 h at room temperatureanti-mouse HRP linked antibody (GE Healthcare, V?lizy, France) diluted at 1/5000 or anti-rabbit HRP linked antibody (Cell Signaling, Danvers, USA) diluted at 1/1000 in blocking buffer. The immunoblot signals were detected by enhanced chemiluminescence assay using ECL HRP chemiluminescent substrate Reagent Kit. The films and the corresponding cassette were purchased from GE Healthcare (Buckinghamshire, UK).
TRAP Assay
[0238] Telomerase activity was assessed through Telomeric Repeat Amplification Protocol (TRAP) approach (Kim et al. 1994) using the TeloTAGGG Telomerase PCR ELISAPLUS kit (Roche Diagnostic GmbH Mannheim, Germany) according to the manufacturer's instructions. Twenty-four hours after transfection as described above, CrFK cells were harvested. Cells were washed with 1?PBS, followed by centrifugation at 1,600 rpm for 5 minutes at 4? C. Cells were resuspended in 0.2 ml of lysis buffer and incubated on ice for 30 minutes. Lysates were cleared by centrifugation at 14,000 rpm, 20 min at 4-8? C. The supernatants were harvested and the protein concentration was measured using the Bradford colorimetric assay. Supernatants were used for telomerase-mediated elongation of telomeric sequences and products were amplified by PCR using biotinylated primers. Each cellular supernatant was previously split into two aliquots before performing the assay: one was used to prepare a negative control by heat inactivation of telomerase for 10 min. at 85? C., the other one was used to evaluate the telomerase-mediated elongation of telomeric sequences. Furthermore, a 216 bp length internal standard, present in the reaction mixture, was simultaneously amplified to exclude false negative results due to Taq DNA-polymerase inhibitors that may be present in lysates. Lysis buffer was used as a negative control. All reaction mixtures were incubated 20 minutes at 25? C. and then 5 minutes at 94? C. Telomerase products were amplified in 30 PCR cycles: 94? C. for 30 seconds, 50? C. for 30 seconds, 72? C. for 90 seconds ended by 1 cycle at 72? C. for 10 minutes and held at 4? C. 2.5 ?L of PCR amplification products were incubated for 10 minutes at RT with denaturation reagent provided in the kit. After incubation, 100 ?L of hybridization buffer was added per well. Each solution was mixed and 100 ?L was transferred to streptavidin pre-coated microplate and incubated for 2 hours at 37? C. under gentle agitation (300 rpm). Then, the wells were washed with a washing buffer and incubated with an anti-digoxigenin horseradish peroxidase (HRP) linked antibody (1/50) for 30 minutes at RT. HRP substrate (TMB) was then added for 15 minutes at RT for colorimetric measurement. The reaction was stopped with ELISA stop reagent. The level of telomerase activity in each sample was determined by comparing the signal from the sample to the signal obtained using a known amount of positive control template (template DNA with the same sequence as a telomerase product with eight telomeric repeats). Absorbance values were reported by A.sub.450 reading against blank (reference wavelength A.sub.690 nm). The relative telomerase activity (RTA) was obtained using the following formula:
RTA=[(A.sub.S?A.sub.S0)]/A.sub.S,IS]/[(A.sub.TS8-A.sub.TS8,0)/A.sub.TS8,IS]?100
where:
A.sub.S is the absorbance of sample,
A.sub.S0, absorbance of heat-treated sample,
A.sub.S,IS, absorbance of internal standard (IS) of the sample,
A.sub.TS8, absorbance of control template (TS8),
A.sub.TS8,0, absorbance of lysis buffer,
A.sub.TS8,IS, the absorbance of internal standard (IS) of the control template (TS8).
Immunofluorescence
[0239] CrFK, HEK293T, HeLa and QT6 cells were seeded on 8-well Lab-Tek? chamber slides (Sigma-Aldrich, St. Louis, USA) at 2?10.sup.4 cells/well in 200 ?L of culture medium and incubated overnight at 37? C., 5% CO.sub.2. The next day, culture medium was discarded and 200 ?L of fresh medium were added. Ten ?L of a mix solution containing 0.2 ?g of INVAC-1, pTRIP-CMV-hTERT or control empty plasmid pNTC8685-eRNA41H and 0.5 ?L of Fugene HD (Promega France, Charbonni?res-les-bains, France) in OptiMEM (Life Technologies, Saint-Aubin, France) were added to the corresponding chamber. 2?10.sup.4 untreated cells per chamber were used as a negative control. Chamber slides were incubated for 24 and 48 hours at 37? C., 5% CO.sub.2. Transfected cells were carefully washed with 1?PBS and 200 ?L 2% PFA were added to each well for 10 minutes at 4? C. in order to fix and permeabilize the cells. Then, wells were washed twice with 1?PBS 0.05% Tween 20 and incubated 30 minutes at room temperature with 200 of blocking solution (0.5% Triton X100; Sigma-Aldrich, 3% BSA; Sigma-Aldrich, 10% Goat Serum; Invitrogen, in 1?PBS 0.05% Tween?20). Primary anti-hTERT rabbit monoclonal antibody (Abcam, Cambridge, UK) diluted at 1/100 in blocking buffer was applied on the cells for 1.5 hour at room temperature under agitation. After three washes in 1?PBS 0.05% Tween 20, a secondary goat anti-rabbit-Alexa Fluor 488? antibody (Life Technologies, Saint-Aubin, France) diluted in blocking solution (1/500) was applied for 45 minutes at room temperature under agitation. Wells were washed three times with 1?PBS 0.05% Tween?20 and mounted in VECTASHIELD? mounting medium containing DAPI (Vector laboratories, Cambridgeshire, UK). Cover slips were analyzed under fluorescence microscope (Axio observer Z1, Carl Zeiss Microlmaging GmbH, Jena, Germany) equipped with an image processing and analysis system (Axiovision, Carl Zeiss Microlmaging GmbH, Jena, Germany).
Mice
[0240] Female C57BL/6 mice (6-8 week old) were purchased from Janvier laboratories (Saint-Berthevin, France).
[0241] Two transgenic mouse strains were used: HLA-B*0702 and HLA-A2/DR1.
[0242] The HLA-B*0702 transgenic mice express the human HLA-B*0702 ?1-?2 domains of the molecule and the murine ?3 domain of the H2D molecule. These mice do not express the H2-D.sup.b and H2-K.sup.b molecules (Rohrlich et al., 2003).
[0243] The HLA-A2/DR1 transgenic mice express the human HLA-A*0201 ?1-?2 domains, the murine ?3 domain of the H2D molecule and the human ?2-microglobulin. Moreover these transgenic mice express the human HLA-DRB1*0101 and HLA-DRA*0101 molecules. They are knock-out for murine H2-D.sup.b, H2-K.sup.b and IA.sup.b genes (Pajot et al., 2004).
[0244] Both transgenic mouse strains were used between 6 and 10 weeks of age and were supplied by the Pasteur Institute of Paris. Animals were housed at the Specific Pathogen Free animal facility of the Pasteur Institute (Animal Facilities Lwoff n? 22, agreement number B 75 15-07). Prior to intradermal (ID), intramuscular (IM) or subcutaneous (SC) immunizations or intravenous (IV) injection, mice were anesthetized with a mix solution of 2% xylazine (Rompun, Bayer Sante, Loos, France) and 8% Ketamine (Imalgen 1000, Merial, Lyon, France) in 1? Phosphate Buffer Saline (1?PBS, Life Technologies, Saint-Aubin, France) through the intraperitoneal route (IP) according to individual animal weight and duration of anesthesia. All animals were handled in strict accordance with good animal practice and complied with local animal experimentation (Directive 2010/63/UE).
hTERT Peptides
[0245] hTERT peptides restricted to HLA-B*0702, HLA-A*0201 or HLA-DR were previously described (see references in Table 1). hTERT peptides restricted to H2-D.sup.b and H2-K.sup.b were determined by in-silico epitope prediction in order to bind mouse MHC Class I molecules using four algorithms available online: Syfpeithi (www.syfpeithi.de/), Bimas (www-bimas.cit.nih.gov/), NetMHCpan and SMM (tools.immuneepitope.org/main/). All synthetic peptides were purchased lyophilized (>90% purity) from Proimmune (Oxford, United Kingdom). Lyophilized peptides were dissolved in sterile water at 2 mg/mL and stored at ?20? C. prior use. Details of peptide sequences and MHC restriction are shown in Table 1.
TABLE-US-00007 TABLE1 hTERTpeptidesandMHCrestriction MHC PeptideCode(reference) Sequence Restriction MouseStrain 277 RPAEEATSL(SEQID HLA-B*0702 TransgenicHLA-B7 (Adotevietal.,2006) NO:30) 351 RPSLTGARRL(SEQID (Adotevietal.,2006) NO:29) 1123 LPSDFKTIL(SEQID (Cortez-Gonzalezetal., NO:31) 2006) 540 ILAKFLHWL(SEQID HLA-A*0201 TransgenicHLA- (Firatetal.,2002) NO:32) A2/DR1 Y572 YLFFYRKSV(SEQID (Firatetal.,2002) NO:33) Y988 YLQVNSLQTV(SEQ (Firatetal.,2002) IDNO:34) UCP2.1 SVWSKLQSI(SEQID HLA-A*0201 (Dossetetal.,2012) NO:35) UCP4.1 SLCYSILKA(SEQID HLA-A*0201 (Dossetetal.,2012) NO:36) UCP2 KSVWSKLQSIGIRQH HLA-DR TransgenicHLA- (Godetetal.,2012) (SEQIDNO:37) A2/DR1 UCP3 GTAFVQMPAHGLFPW (Godetetal.,2012) (SEQIDNO:38) UCP4 SLCYSILKAKNAGMS (Godetetal.,2012) (SEQIDNO:39) 429 RPIVNMDYV(SEQID H2D.sup.b C57/BL6J NO:40) 660 HAQCPYGVL(SEQID H2K.sup.b C57/Bl6J NO:41) 1034 QAYRFHACVL(SEQ H2K.sup.b C57/Bl6J IDNO:42) 1021 QTVCTINIYKI(SEQID H2D.sup.b C57/Bl6J NO:43)
hTERT Peptide Library
[0246] Lyophilized hTERT peptides (purity>70%) were purchased from GenScript (USA). This set is composed of 269 peptides of 15 AA overlapping of 11 AA and recovering the whole protein sequence of INVAC-1 hTERT. Each peptide was resuspended in distilled water at 2 mg/mL prior use according to supplier recommendations and kept frozen at ?20? C. before use. Twenty-seven pools of 9-10 hTERT overlapping peptides (Table 2) were used to screen the breadth of hTERT specific T-cell response in an IFN? ELISPOT assay.
TABLE-US-00008 TABLE 2 Pools of hTERT overlapping peptides P1 P2 P3 P4 P5 P6 P7 P8 P9 P10 P11 P12 P13 P14 P15 1 11 21 31 41 51 61 71 81 91 101 111 121 131 141 2 12 22 32 42 52 62 72 82 92 102 112 122 132 142 3 13 23 33 43 53 63 73 83 93 103 113 123 133 143 4 14 24 34 44 54 64 74 84 94 104 114 124 134 144 5 15 25 35 45 55 65 75 85 95 105 115 125 135 145 6 16 26 36 46 56 66 76 86 96 106 116 126 136 146 7 17 27 37 47 57 67 77 87 97 107 117 127 137 147 8 18 28 38 48 58 68 78 88 98 108 118 128 138 148 9 19 29 39 49 59 69 79 89 99 109 119 129 139 149 10 20 30 40 50 60 70 80 90 100 110 120 130 140 150 P16 P17 P18 P19 P20 P21 P22 P23 P24 P25 P26 P27 151 161 171 181 191 201 211 221 231 241 251 261 152 162 172 182 192 202 212 222 232 242 252 262 153 163 173 183 193 203 213 223 233 243 253 263 154 164 174 184 194 204 214 224 234 244 254 264 155 165 175 185 195 205 215 225 235 245 255 265 156 166 176 186 196 206 216 226 236 246 256 266 157 167 177 187 197 207 217 227 237 247 257 267 158 168 178 188 198 208 218 228 238 248 258 268 159 169 179 189 199 209 219 229 239 249 259 269 160 170 180 190 200 210 220 230 240 250 260
Tumor Cell Line
[0247] The Sarc-2 tumor cell line used to assess the anti-tumor effect mediated by INVAC-1 was obtained from a spontaneous fibrosarcoma of a HLA-A2/DR3 mouse. The tumor mass was dissociated under sterile conditions and a primary cell suspension was generated. The cell line was shown to express the HLA-A*0201 molecule. Cells were cultured in RPMI glutamax medium (Life Technologies) supplemented with 10% FBS (Life Technologies) and 1% Penicillin/Streptomycin.
Mouse Immunization and In Vivo Electroporation Procedure
[0248] Intradermal (ID) immunization was performed on the lower part of the mouse flank with insulin syringes and specific needles (U-100, 29GX?-0.33?12 mm, Terumo, Belgium) after shaving. No erythema was observed after shaving, during and after the immunization procedures. Intramuscular immunization (IM) was performed in the anterior tibialis cranialis muscle, also using insulin syringes and specific needles U-100. Subcutaneous immunization (SC) was performed at the base of the tail, also using insulin syringes and specific needles U-100. Each animal received a priming IM, ID or SC injection of plasmid (INVAC-1, NTC, pUTD10Not, pUTD10Cog or pUTD23Tyn) corresponding to either 12.5, 25, 50, 100, 200, 400, 800 or 1200 ?g of DNA or 1?PBS, depending on the experiment. According to the vaccine regimen, mice could receive a similar second or third injection of DNA or 1?PBS.
[0249] In vivo DNA electroporation was performed using the CLINIPORATOR? 2 electroporation system and software (IGEA, Italy) equipped with plate electrodes (P-30-8G, IGEA). Directly after ID or SC vaccination, a skin fold was made at the injection site, entirely covered with conductive gel (Labo FH, blue contact gel, NM Medical, France) and placed between the plate electrodes. Two pulses of different voltages were applied (HV-LV): HV: 1250 V/cm, 1 Hz, 100 ?s; 1 pulse, 1000 ms break; LV: 180 V/cm, 1 Hz, 400 ms, 1 pulse. Directly after IM injection, each muscle was entirely covered with conductive gel and placed between the plate electrodes. Two pulses of different voltages were applied (HV-LV): HV: 750 V/cm, 1 Hz, 100 ?s; 1 pulse, 1000 ms break; LV: 100 V/cm, 1 Hz, 400 ms, 1 pulse.
[0250] In certain experiments, 18 hours before DNA vaccination or concomitantly to the administration of INVAC-1, mice were injected ID with 0.5 ?g of murine GM-CSF or 1 ng of murine IL-12 in a final volume of 25 ?l/flank. Both cytokines were purchased from Miltenyi (Germany).
ELispot Assay
[0251] Spleens from immunized mice were taken and mashed, and cell suspensions were filtered through a 70 mm nylon mesh (Cell Strainer, BD Biosciences, France) to isolate splenocytes. Blood from immunized mice was collected through retro-orbital puncture under anaesthesia in order to isolate peripheral mononuclear blood cells (PBMC). Splenocytes or PBMC were purified using Ficoll (Lymphocyte Separation Medium, Eurobio, France). Ficoll-purified lymphocytes from blood or spleen were numerated using the Cellometer? Auto T4 Plus counter (Ozyme, France).
[0252] ELIspot PVDF microplates (IFN? Elispot kit, Diaclone, Abcyss, France, ref. 862.031.010P) were coated overnight with capture antibody (anti-mouse IFN-?) and blocked with 1?PBS-2% milk. Cell suspensions were added to the plates in triplicates at 2?10.sup.5 cells/well and stimulated with 5 ?g/ml of HLA or H2 restricted hTERT derived peptides with serum free culture medium or with PMA-ionomycin (respectively 0.1 ?M and 1 ?M). After 19 hours, spots were revealed with the biotin-conjugated detection antibody followed by streptavidin-AP and BCIP/NBT substrate solution. Spots were counted using the Immunospot ELIspot counter and software (CTL, Germany). When analyzing ELIspot data, a vaccinated animal is considered as a responder if the frequency of spots, corresponding to hTERT specific CD8 or CD4 T-cells, is superior to the cut-off value of 10 spots.
In Vivo Cytotoxicity Assay
[0253] For target cell preparation, splenocytes from naive HLA-B7 mice were labeled by a 1?PBS solution containing high (5 medium (1 ?M) or low (0.2 ?M) concentrations of CFSE (Vybrant CFDA-SE cell-tracer kit; Life Technologies, Saint-Aubin, France). Naive splenocytes labeled with 5 and 1 ?M CFSE were pulsed respectively with 2 different HLA-B7 peptides, 1123 and 351 at 5 ?g/mL for 1.5 hour at room temperature. CFSE low labeled splenocytes were left unpulsed. Each mouse previously vaccinated with INVAC-1 or 1?PBS received, at day 14 post-prime or at day 10 post-boost injection, 10.sup.7 CFSE-labeled cells of a mix containing an equal number of cells from each fraction through the retro-orbital vein. After 15-18 hours, single-cell suspensions from spleens were analyzed by flow cytometry using MACSQUANT? flow cytometer (Miltenyi, Germany).
[0254] The disappearance of peptide-pulsed cells was determined by comparing the ratio of pulsed (high/medium CFSE fluorescence intensity) to unpulsed (low CFSE fluorescence intensity) populations in INVAC-1 immunized mice versus control (1?PBS) mice. The percentage of specific killing per test animal was established according to the following formula: [1?[mean (CFSE.sup.lowPBS/CFSE.sup.high/mediumPBS)/(CFSE.sup.lowpDNA/CFSE.sup.highi/mediumpDNA)]]?100.
Cytokine Binding Assay (CBA)
[0255] Splenocytes (6?10.sup.5 cells) from vaccinated HLA-A2/DR1 mice were cultured 24 h at 37? C. with HLA-DR-restricted hTERT derived peptides (578, 904, and 1029) at 5 ?g/mL. Cytokine culture supernatants were recovered and kept frozen at ?20? C. until testing. A commercially available kit, the mouse Th1/Th2/Th17 Cytometric Beads Array (CBA, BD biosciences) kit was used to quantify respectively the concentration of IL-2, IFN?, TNF?, IL-4, IL-6, IL-17a and IL-10. The CBA immunoassay was carried out according to the manufacturer's instructions. Flow cytometry acquisition was done using the FACScan LSRII flow cytometer (BD Biosciences); analyses were performed using the FCAP Array? Software version 3.0 (BD Biosciences).
In Vivo Anti-Tumor Effect
[0256] For therapeutic vaccination experiments, 24 week-old HLA-A2/DR1 mice were subcutaneously engrafted with 2.10.sup.4 Sarc-2 cells on the right abdominal flank. Then, animals were immunized with DNA vaccines via the ID route followed by electroporation as described above at day 4, 21 and 35 post-engraftment. Every 2 to 3 days, tumor growth was monitored using a caliper. Mouse weight was also monitored every 2 to 3 days. Mice were euthanized when tumors reached 2000 mm.sup.3. The guidelines for the welfare and use of animals in cancer research were followed, especially for monitoring of clinical signs necessitating immediate intervention (Workman et al. 2010, BJC). Tumor volume was calculated using the following formula: (L*1.sup.2)/2. Results are expressed in mm.sup.3 (L=length; 1=width).
[0257] For prophylactic vaccination, 5-10 week-old HLA-A2/DR1 mice were vaccinated twice (days 0 and 21) as described above. Thirty two days after the last immunization, animals were subcutaneously engrafted with 5.10.sup.4 Sarc-2 cells. Mice weight and tumor growth were monitored every 2 to 3 days as described before. Mice were euthanized when tumors reached 2000 mm.sup.3.
[0258] The tumor growth delay (TGD) criterion was used to assess vaccine efficacy. It compares the time to reach a defined tumor volume (500 mm.sup.3) in control and treated groups.
Statistical Analysis and Data Handling
[0259] Prism-5 software was used for data handling, analysis and graphic representations. Data are represented as the mean?standard deviation or as median. Statistical analyses of ELISpot assays were performed using a Mann Whitney non parametric and/or a Kruskal-Wallis analysis with Dunn's multiple comparison test. Significance was set at p-value<0.05.
Results
Characterization and Sequence Analysis of INVAC-1 Plasmid DNA
[0260] Ubi-hTERT transgene was successfully inserted into pNTC8685-eRNA41H-HindIII-XbaI as shown by restriction mapping using various restriction endonucleases (
[0261] Full-length sequencing of INVAC-1 plasmid has been performed on the Master Cell Bank plasmid material (SEQ ID NO: 11 &
Characterization and Sequence Analysis of INVAC-1 Derivative Constructs
[0262] Three INVAC-1 derivative DNA plasmids expressing different Ubi-hTERT fusion proteins were synthesized and cloned (
INVAC-1 and INVAC-1 Derivative Proteins are Correctly Expressed In Vitro and Degraded by the Proteasome Pathway
[0263] Western blot assay was performed to provide information about the global expression of wild-type hTERT, INVAC-1 and INVAC-1 derivative proteins after 18 h to 96 h of in vitro transient transfection into HEK293T and CrFK cell lines. The bands of wild-type hTERT protein corresponded to the size of unmodified hTERT at 124.5 kDa (
[0264] In contrast to wild-type hTERT (pTRIP-CMV-hTERT), INVAC-1 construct produced two distinct bands: A weak upper band corresponding to the Ubi-hTERT fusion protein at the predicted size of 127.4 kDa and a lower band corresponding to INVAC-1-encoded hTERT protein lacking the ubiquitin polypeptide (119 kDa). These two forms of INVAC-1-encoded hTERT protein were detected in both cell lines, HEK293T and CrFK (
[0265] These results validate the in vitro expression pattern and identity of Ubi-hTERT fusion proteins encoded by INVAC-1 and INVAC-1 derivatives. The ubiquitin polypeptide fused to hTERT-derived proteins played its role by enhancing the degradation of the proteins in accordance with the N-end rule. According to this N-end rule, hTERT became an unstable protein rapidly degraded by the proteasome system involved in the production of peptides for antigen presentation by major histocompatibility complex (MHC) class I molecules (Cadima-Couto, 2009; Michalek et al, 1993). Thus, these data indicate that the Ubi-hTERT fusion constructs which undergo enhanced degradation in mammalian tissue culture cells, could also be rapidly degraded in vivo and can effectively induce higher CD8+ T-cell responses than wild-type hTERT.
INVAC-1 Protein has a Predominant Cytoplasmic Distribution and a Nucleolar Exclusion Pattern
[0266] With the idea to delocalize INVAC-1-derived hTERT protein to enhance its degradation, the nucleolar localization signal (N-terminal part of hTERT) was removed. Therefore, the cellular localization of hTERT encoded by INVAC-1 was assessed by immunofluorescence analysis after transfection into CrFK, HEK293, HeLa, QT6 cell lines (
[0267] Wild-type hTERT (pTRIP-CMV-hTERT) was shown to predominantly localize into the nucleus and nucleolus in transfected HEK293T cells at 24 h (
[0268] The weak anti-hTERT fluorescence signal which could be observed in HEK293T and HeLa cells after transfection of pNTC8685-eRNA41H empty backbone vector was probably due to the cross reactivity with endogenous hTERT.
[0269] To overcome the non-specific fluorescence background due to endogenous hTERT protein expression, non-human cell lines, QT6 quail fibrosarcoma and CrFK feline kidney cells, were used for immunostaining. No background signal was observed in both cell lines after transient transfection with pNTC8685-eRNA41H empty backbone vector (
[0270] Taken together, these results showed that INVAC-1-derived hTERT protein has a modified subcellular distribution as compared to wild-type hTERT in different cell lines. This alteration may be an advantage for enhancing proteasomal degradation of the protein into peptides for MHC class I presentation to generate specific cellular immune responses (Andersson and Barry, 2004).
[0271] Transfection of QT6 and CrFK cells (without non specific hTERT background) with INVAC-1 derivatives (pUTD10Not, pUTD10Cog and pUTD23Tyn) confirmed a nucleolar exclusion pattern of these hTERT-derived proteins (data not shown). Their subcellular distribution was mostly cytoplasmic as compared to wild-type hTERT.
INVAC-1 and INVAC-1 Derivatives have No Enzymatic Activity
[0272] Human telomerase plays a critical role in tumor growth by participating to immortalization and preventing senescence of tumor cells. Therefore, the use of wild-type telomerase as a vaccine product may lead to safety concerns.
[0273] A TRAP assay was performed to evaluate the telomerase activity of Ubi-hTERT constructs in telomerase negative CrFK cell line. Telomerase activity was only detected in CrFK cells transfected with wild-type hTERT using pTRIP-CMV-hTERT plasmid. No telomerase activity was detected in CrFK cells transfected with INVAC-1 or INVAC-1 derivatives (
[0274] As shown in
[0275] Relative Telomerase Activity (RTA) data (
[0276] All samples treated with the internal amplification standard (IS) control were highly positive confirming the absence of Taq DNA polymerase inhibitors in CrFK lysate samples and thus reemphasizing the specificity of the assay.
[0277] In conclusion, these results confirmed that INVAC-1 and INVAC-1 derivatives do not have any enzymatic activity. Therefore, with regards to the telomerase activity, there is no safety concern for using INVAC-1 in human.
Electroporation is Advantageous to Induce Significant Levels of hTERT Specific CD8 T-Cells Secreting Interferon-? after ID Administration of INVAC-1
[0278] The intensity of hTERT specific CD8 T-cell responses was assessed in C57BL/6 mice previously immunized with INVAC-1 via the intradermal route followed or not by skin electroporation (
INVAC-1 Vaccination Via Different Administration Routes Followed by Electroporation Induces hTERT Specific CD8 T-Cell Secreting Interferon-?. The ID Vaccination Route Appears to be the Best Route
[0279] Conventional vaccines are commonly administered via the SC or IM route. However, the intradermal route of immunization is now regaining interest in the field of vaccination (Combadiere and Liard, 2011). Consequently, the ID route was tested for the administration of INVAC-1 and compared to the conventional SC and IM routes.
[0280] In a first set of experiments different groups of transgenic HLA-B7 mice were immunized with INVAC-1 via the ID or SC route immediately followed by electroporation (
[0281] Moreover, as shown in
[0282] Both experiments demonstrated that the ID route of vaccination was more efficient than the IM and SC routes for the INVAC-1-mediated induction of hTERT specific CD8 T-cells. Similar data were obtained using other mouse models i.e HLA-A2-DR1 mice (data not shown). Consequently, all subsequent immunogenicity studies performed with INVAC-1 were then designed with an ID administration of the vaccine followed by electroporation.
Impact of the Vaccine Dose on hTERT Specific CD8 T-Cell Response after a Single ID Immunization with INVAC-1 and Electroporation
[0283] Another important parameter to be tested was the impact of the vaccine dose on hTERT specific CD8 T-cell responses. C57BL/6 mice were immunized via the ID route followed by electroporation in both lower flanks with increasing doses of INVAC-1. The vaccine volume remained constant at 50 ?L/site. Animals were vaccinated in 2 or 4 sites depending on the final vaccine dose received. Fourteen days after vaccination/electroporation, mouse spleens were harvested and the specific cellular immune responses were monitored via an IFN-? ELISPOT assay using hTERT peptides restricted to H2.
[0284] In a first set of experiments, C57BL/6 mice received a single ID injection of INVAC-1/electroporation with doses ranging from 12.5 ?g to 100 ?g (
[0285] In a second series of experiments, C57BL/6 mice received a single ID injection of INVAC-1/electroporation with doses ranging from 100 ?g to 1200 ?g (
[0286] In conclusion, for the vaccine specific CD8 T-cell criterion in C57BL/6 mice, a dose response was observed as a consequence of the administration of different quantities of INVAC-1. Interestingly, no sign of vaccine toxicity was observed in animals injected with the highest doses of vaccine (800 and 1200 ?g) in comparison with control mice (monitoring of body weight and macroscopic autopsy at sacrifice). Similar data were obtained in transgenic HLA-B7 mice (data not shown).
A Prime-Boost Regimen is Recommended for INVAC-1 Vaccination in Order to Increase the Level of hTERT Specific CD8 T-Cell Response
[0287] Most of vaccination protocols recommended for conventional vaccines (BCG, measles, influenza . . . ) include a prime-boost regimen in order to improve the frequency of vaccine specific immune responses. Consequently, the impact of a prime-boost regimen on the generation of hTERT specific CD8 T-cell responses was tested for INVAC-1 ID vaccination and electroporation. Towards this aim, transgenic HLA-B7 mice were immunized ID with INVAC-1 and skin vaccination sites were electroporated directly after vaccine administration. Twenty one days after the first immunization, mice received a second injection of INVAC-1 using the same vaccination procedure. At different time points after prime and boost immunizations, peripheral blood was collected in order to monitor hTERT specific CD8 T-cell responses via an IFN-? ELISPOT assay using hTERT peptides restricted to HLA-B7 (
[0288] In conclusion, a prime-boost vaccination regimen is recommended for INVAC-1 ID vaccination/electroporation because first it allows increasing the frequency of hTERT specific CD8 T-cells circulating in the blood (effector T-cells) and secondly it shortens the time necessary to reach the peak of the specific cellular immune response, which is an important parameter in the context of an anti-cancer vaccination.
ID Vaccination with ?10Not, ?10Cog or ?23 Constructs Followed by Electroporation Also Induces hTERT Specific CD8 T-Cell Response. A Prime-Boost Vaccination Regimen is Recommended to Increase the Frequency of Vaccine Specific CD8 T-Cells.
[0289] Together with the development of INVAC-1, 3 other DNA plasmid constructs (INVAC-1 derivatives) were designed: ?10Not (pUTD10Not), ?10Cog (pUTD10Cog) or ?23 (pUTD23Tyn). Three deletions were engineered into the catalytic site of the hTERT enzyme. They ranged from 10-23 amino acid residues and spanned the crucial trio of Valine-Aspartic acid-Aspartic acid residues (Val-Asp-Asp, or VDD in the one letter code) (
[0290] In order to confirm this hypothesis, C57BL/6 mice were immunized via the ID route followed by electroporation with INVAC-1, ?10Not, ?10Cog, ?23 or PBS (
[0291] For the animals which received a single DNA injection, a significant difference in the frequency of hTERT specific CD8 T-cells was observed only in the group of mice vaccinated with 100 of INVAC-1 in comparison with control animals vaccinated with PBS (p<0.05) (
[0292] In a second set of experiments, transgenic HLA-B7 mice were vaccinated ID with INVAC-1, ?10Not, ?10Cog, ?23 or PBS (
[0293] As shown for INVAC-1, the 3 INVAC-1 derivatives ?10Not, ?10Cog and ?23 were also capable of inducing hTERT specific CD8 T-cells in vivo after ID vaccination and electroporation in two different mouse strains. A prime-boost vaccination regimen was also recommended for INVAC-1 derivatives to reach significant levels of hTERT specific CD8 T-cell responses. Taken together, these results demonstrate that INVAC-1 is the construct which allows the induction of the best hTERT specific CD8 T-cell response. This is probably due to the difference observed in ?hTERT protein expression levels after plasmid transfection as shown by western blotting (
The Breadth of hTERT Specific T-Cell Response after ID Vaccination(s) Followed by Electroporation is Different According to the hTERT Plasmid Construct Used for Vaccination (INVAC-1, pNTC-hTERT or pNTC-hTERT-?VDD)
[0294] The impact of hTERT sequence modifications engineered within the INVAC-1 construct, i.e, (1) the deletion of the nucleolar localization signal, (2) the addition of the ubiquitin sequence and (3) the deletion within the catalytic site, on the repertoire of the T-cell immune response against hTERT has been assessed. INVAC-1 hTERT specific cellular immune responses were screened after ID immunization(s)/electroporation(s) with INVAC-1 and compared to responses induced by a DNA encoding the native/wild-type sequence of the human TERT (pNTC-hTERT) and a DNA encoding the hTERT sequence only deleted in the VDD region (pNTC-hTERT-?VDD). Control animals received ID injection(s) of 25 ?g of pNTC empty vector followed by electroporation.
[0295] A first series of HLA-B7 transgenic mice received a single injection of either one of the 4 constructs using the vaccination protocol described before (25 ?g/mouse). A second series of animals received a prime injection and a boost 21 days after the first vaccination with either one of the 4 constructs using the vaccination protocol described before (25 ?g/mouse).
[0296] Fourteen days after a single injection or 10 days post-boost, splenocytes from vaccinated and control mice were tested in an IFN? ELIspot assay using 269 peptides of 15 AA overlapping of 11 AA and recovering the whole protein sequence of hTERT (27 pools composed of 10 peptides each).
[0297] Immunization with INVAC-1 induced a large repertoire of T-cells against numerous hTERT epitopes since after the priming, about 12 pools of peptides were recognized (
[0298] The advantage for a second cycle of immunization (prime-boost) with INVAC-1 in transgenic mice was confirmed in this study. In vivo T-cell repertoire was improved as at least 5 new epitopes were revealed (
[0299] Analyzing these data globally by doing the sum of total median of frequency of specific T-cell detected for the 27 pools of peptides, no major differences were observed after one (prime) or two (prime-boost) cycles of immunizations between the three hTERT constructs (
[0300] In conclusion, INVAC-1 vaccination mediated a large repertoire of T-cell immune response against numerous hTERT epitopes different from wild-type hTERT and hTERT?VDD constructs in terms of peptides/epitopes recognized by T-cells.
ID Vaccination with INVAC-1 Followed by Electroporation Induces hTERT Specific T-Cell Responses with the Hallmark of an Anti-Cancer Immune Response: Cytotoxic CD8 T-Cells and Th1 CD4 T-Cells
[0301] Among immune cells that are relevant in antitumor immune responses, cytotoxic CD8 T lymphocytes (CTL) and Th1 CD4 T-cells have been identified as the most powerful effector cells (Vesely et al., 2011) (Braumuller et al., 2013).
[0302] In a first step, the cytotoxic activity of hTERT specific CD8 T-cells was investigated in vivo after ID vaccination/electroporation with INVAC-1. Indeed, this activity is necessary to kill tumor cells. In order to measure the in vivo cytolytic strength of the hTERT specific CD8.sup.+ T-cell response elicited by INVAC-1 immunization, an in vivo cytotoxicity assay was performed using carboxyfuorescein-diacetate succinimidyl ester (CFSE)-labelled, peptide-pulsed splenocytes as target cells. HLA-B7 transgenic mice which received a prime or a prime-boost vaccination with INVAC-1 (or PBS as control) via the ID route as described before were intravenously injected with 7.10.sup.6 target cells. Target cells were splenocytes from naive congenic mice independently labelled with 3 different concentrations of CFSE and pulsed with either a hTERT peptide restricted to HLA-B7 (p351, immuno-dominant peptide or p1123, sub-dominant peptide) or left unpulsed as an internal control. After 15-18 hours, spleen cells were harvested and the disappearance of peptide-pulsed cells in immunized vs. control mice was quantified by flow cytometry.
[0303] Results show that all mice developed specific CTLs against the immuno-dominant peptide p351 after a single injection (
[0304] It has been recently described that a hTERT specific CD4 T-cell response may be associated with a better chemotherapy response in NSCLC patients (Godet et al., 2012). Therefore, the presence of a hTERT specific CD4 T-cell response after INVAC-1 ID injection was investigated. To this aim HLA-A2/DR1 transgenic mice were ID immunized with INVAC-1 followed by electroporation and the hTERT specific CD4 T-cell response was monitored in the spleen 14 days after vaccination via an IFN-? ELISPOT assay using hTERT peptides restricted to DR1. As shown in
[0305] It has been emphasized that Th1 immunity had a clear positive effect on cancer cell elimination in vivo (Braumuller et al., 2013). As a matter of fact, CD4.sup.+Th1 cells produce several cytokines (such as IFN-?, TNF-? and IL-2) essential for the induction of cell-mediated immunity against tumors. Consequently, after INVAC-1 ID vaccination, the different cytokines secreted by hTERT specific CD4 T-cells were investigated. To this aim, splenocytes from INVAC-1-vaccinated HLA-A2/DR1 transgenic mice were stimulated in vitro for 24 hours with a pool of hTERT peptides or left unstimulated. Supernatants were recovered and assayed in a Cytokine Binding Assay (CBA) in order to evaluate the concentration of Th1, Th2 and Th17 cytokines secreted by hTERT specific CD4 T-cells.
[0306] As shown in
[0307] Thus, ID vaccination/electroporation with INVAC-1 is able to promote the expansion of hTERT specific CD8 T-cells which exhibit a cytotoxic activity in vivo along with specific CD4 T-cells with a Th1 profile. Both types of response are the hallmark of a favourable anti-cancer immune response.
Therapeutic and Preventive ID Vaccination with INVAC-1 Followed by Electroporation Delay Tumor Growth after Syngeneic Tumor Inoculation in HLA-A2/DR1 Transgenic Mice
[0308] Up to this point, results have shown that an ID injection of INVAC-1 followed by electroporation was able to induce cytotoxic CD8 T-cells and Th1 CD4 T-cells in mice. The next step was then to evaluate the protection of transgenic HLA-A2/DR1 mice conferred by INVAC-1 ID vaccination and electroporation after Sarc-2 (fibrosarcoma) tumor cells inoculation. In a first attempt, transgenic HLA-A2/DR1 mice were vaccinated ID with INVAC-1 followed by electroporation in a prime-boost strategy or mock vaccinated with PBS. One month after preventive vaccination, mice were challenged via the SC route with 50,000 Sarc-2 cells. Tumor volume was measured every 2-3 days.
[0309] In a second series of experiments, transgenic mice were engrafted with 20,000 Sarc-2 cells and were ID vaccinated with INVAC-1 followed by electroporation 4 days after cell inoculation (
Administration of Murine GM-CSF Along with INVAC-1 ID Vaccination/Electroporation Improves the Intensity and Quality of hTERT Specific Cellular Immune Response and Delays Tumor Growth after a Syngeneic Tumor Challenge in HLA-A2/DR1 Transgenic Mice.
[0310] Different cytokines have been used so far as immunomodulators to facilitate antigen recognition and T-cell expansion in anti-cancer vaccination studies both in animal models and in humans.
[0311] One of the most frequently used cytokine is the GM-CSF (Granulocyte macrophage Colony Stimulating Factor). This cytokine is known to help the maturation of Antigen Presenting Cells and to favor the Th1 cellular immune responses (Parmiani et al., 2007). Regarding the major role played by GM-CSF in the context of anti-tumor vaccines, the impact of the addition of murine GM-CSF (mGM-CSF) on hTERT specific T-cell responses after INVAC-1 ID vaccination and electroporation was tested. To this aim, C57BL/6 mice received an ID injection of mGM-CSF 18 hours prior being vaccinated with INVAC-1 via the ID route followed by electroporation (
[0312] Thereafter, the combination mGM-CSF/INVAC-1 was studied in the Sarc-2 animal tumor model in order to evaluate if mGM-CSF could potentiate anti-tumor effects.
[0313] To this aim, HLA-A2/DR1 transgenic mice were engrafted with 20,000 Sarc-2 cells and were vaccinated ID with INVAC-1 and mGM-CSF followed by electroporation 4 days after cell engraftment (
Administration of Murine IL-12 Along with INVAC-1 ID Vaccination/Electroporation Improves the Intensity of hTERT Specific CD8 T-Cell Response
[0314] The impact of the IL-12 cytokine on hTERT specific CD8 T-cell response after INVAC-1 ID vaccination and electroporation was also investigated. To this aim, HLA-A2/DR1 mice received an ID injection of IL-12 along with the ID administration of INVAC-1 followed by electroporation (
Example II
Abbreviations
[0315] AA: Amino Acid, bp: Base-pair, CTL: Cytotoxic T-Lymphocyte, CMV: Cytomegalovirus, DNA: Deoxyribonucleic Acid, EP: Electroporation, ID: Intradermal, NoLS: Nucleolar Localization Sequence, RNA: Ribonucleic Acid, RTA: Relative Telomerase Activity, TRAP: Telomeric Repeat Amplification Protocol, TERT: Telomerase Reverse Transcriptase, Ubi: Ubiquitin, VDD: Valine-Aspartic Acid-Aspartic Acid
Materials and Methods
Plasmid DNA Vectors
INVAC-1
[0316] The INVAC-1 construct was already described in EXAMPLE I.
INVAC-1 Shuffled Derivatives
[0317] pUTScram and pUTInv constructs are double stranded DNA plasmids of approximately 8.9 kb encoding human ubiquitin-telomerase-based fusion proteins which are enzymatically inactive. The Scrambled and Inverted transgenes were inserted into Invitrogen pcDNA3.1(+) vector (5.4 kb) derived from pcDNA3.0 which was designed for high-level of stable and transient expression in mammalian cells. Transgene expression is driven from human cytomegalovirus immediate-early (CMV) promoter to allow efficient high-level expression in a wide range of mammalian cells. The vector contains multiple cloning sites (MCS) to facilitate cloning. Efficient transcription termination is driven by the Bovine Growth Hormone (BGH) polyadenylation signal.
pUTScram (Named Scrambled)
[0318] The Ubi-Scrambled hTERT insert (Scrambled, 1184 AA) starts at position 923 and ends at position 4474 of the pUTScram plasmid (
pUTInv (Named Inverted)
[0319] The Ubi-inverted hTERT insert (Inverted, 1184 AA) starts at position 923 and ends at position 4474 of the pUTInv plasmid (
Genes Synthesis and Cloning
[0320] The genes were de novo synthesized as ubiquitin-telomerase-based fusion constructs through an overlapping 40-mer oligonucleotides assembly process (GeneCust, Luxembourg). Several conservative base changes were made to eliminate restriction sites and attenuate GC rich sequences. Gene synthesis included unique flanking restriction sites HindIII/XbaI to allow subcloning of the gene into desired expression system. The synthesized genes were cloned between HindIII and XbaI restriction sites of the pcDNA3.1(+) expression vector (Invitrogen, Carlsbad, USA). The sequences of the plasmids were verified by sequencing using PEGFP-N5 CGGTGGGAGGTCTATATAAG (SEQ ID NO: 27) and BGH CAGGGTCAAGGAAGGCAC (SEQ ID NO: 28) primers.
Plasmids Production
[0321] These INVAC-1 shuffled derivatives synthetized by GeneCust were transformed and produced in E. coli 5-alpha cells (fhuA2?(argF-lacZ)U169 phoA glnV44 ?80 ?(lacZ)M15 gyrA96 recA1 relA1 endA1 thi-1 hsdR17) (Lucigen Corporation, Middleton, USA, ref. 60602-2) by RD Biotech (Besancon, France). Cells were plated and propagated on Lenox Broth media containing ampicillin (#EU04000D, Euromedex). After extraction and purification, concentrated endotoxin-free gigaprep plasmid stocks (2 mg/mL) resuspended in 1? sterile PBS were prepared. The vectors were verified by restriction mapping (HindIII-XbaI;
pTRIP-CMV-hTERT
[0322] This DNA plasmid was already described in EXAMPLE I.
Cell Cultures and Transient Transfections for Western Blot and TRAP Assays
[0323] CrFK (Crandell Rees feline kidney) and HEK293T (Human embryonic kidney) cell lines were cultured in Dulbecco's modified Eagle's medium (DMEM) supplemented with 10% heat-inactivated fetal calf serum (PAA, Velizy-Villacoublay, France) and 1% penicillin/streptomycin (Life Technologies, Saint-Aubin, France).
[0324] Cells were grown as monolayers in 75 cm.sup.2 flasks at 37? C. in a humidified atmosphere containing 5% CO.sub.2. The cells were grown until 70-80% confluence on the day of transfection. For western blot assays, 5?10.sup.5 cells were seeded in six-well tissue culture plates and incubated for 24 h. For TRAP assays, 7?10.sup.5 cells were seeded in six-well tissue culture plates and incubated for 24 h. INVAC-1, pUTScram and pUTInv constructs were transfected into target cells using jetPrime cationic polymer transfection reagent according to manufacturer's instructions (Polyplus-transfection Inc., France). Cells transfected with pTRIP-CMV-hTERT plasmid was used as positive control and non-transfected cells as negative control. Transfection mediums were removed 4 hours later and replaced by 2 mL of DMEM culture medium. After appropriate time of transfection18-96 hours for western blot assays and 24 hours for TRAP assays, cells were harvested and analyzed for telomerase expression and activity.
Western Blot
[0325] Western blot analyses were performed using transfected HEK293T cells. The western blot procedure is as described in EXAMPLE I.
TRAP Assay
[0326] This procedure is as described in EXAMPLE I.
Mice
[0327] HLA-B*0702 transgenic mouse strain was used in these experiments.
[0328] The HLA-B*0702 transgenic mice express the human HLA-B*0702 ?1-?2 domains of the molecule and the murine ?3 domain of the H2D molecule. These mice do not express the H2-D.sup.b and H2-K.sup.b molecules (Rohrlich, Cardinaud et al. 2003).
[0329] Mice were used between 9 and 15 weeks of age and were supplied by the Pasteur Institute of Paris. Animals were housed at the Specific Pathogen Free animal facility of the Pasteur Institute (Animal Facilities Lwoff n? 22, agreement number B 75 15-07). Prior to intradermal (ID) or intravenous (IV) injection, mice were anesthetized with a mix solution of 2% xylazine (Rompun, Bayer Sant?, Loos, France) and 8% Ketamine (Imalgen 1000, Merial, Lyon, France) in 1? Phosphate Buffer Saline (1?PBS, Life Technologies, Saint-Aubin, France) through the intraperitoneal route (IP) according to individual animal weight and duration of anesthesia. All animals were handled in strict accordance with good animal practice and complied with local animal experimentation (Directive 2010/63/UE).
hTERT Peptides
[0330] hTERT peptides restricted to HLA-B*0702, were previously described in EXAMPLE I. Lyophilized peptides were dissolved in sterile water at 2 mg/mL and stored at ?20? C. prior use.
Mouse Immunization and In Vivo Electroporation Procedure
[0331] Intradermal (ID) immunization was performed on the lower part of the mouse flank with insulin syringes and specific needles (U-100, 29GX?-0.33?12 mm, Terumo, Belgium) after shaving. No erythema was observed after shaving, during and after the immunization procedures. Each animal received a priming ID injection of plasmid (INVAC-1, pUTScram or pUTInv) with 100 ?g of DNA or 1?PBS. According to the vaccine regimen, mice could receive a similar second injection of DNA or 1?PBS.
[0332] In vivo DNA electroporation was performed using the CLINIPORATOR? 2 electroporation system and software (IGEA, Italy) equipped with plate electrodes (P-30-8G, IGEA). Directly after ID vaccination, a skin fold was made at the injection site, entirely covered with conductive gel (Labo FH, blue contact gel, NM Medical, France) and placed between the plate electrodes. Two pulses of different voltages were applied (HV-LV): HV: 1250 V/cm, 1 Hz, 100 ?s; 1 pulse, 1000 ms break; LV: 180 V/cm, 1 Hz, 400 ms, 1 pulse.
ELISpot Assay
[0333] ELISpot Assay was performed according to the method described in EXAMPLE I. Only a pool of three specific hTERT peptides restricted to HLA-B*0702 (p277, p351 and p1123) was used in Example II.
In Vivo Cytotoxicity Assay
[0334] In vivo lysis assay was performed according to the procedure described in EXAMPLE I. Only two specific hTERT peptides restricted to HLA-B*0702 (p351 and p1123) were used respectively as immunodominant and subdominant peptides in Example II.
Statistical Analysis and Data Handling
[0335] GraphPad Prism 5 software was used for data handling, analysis and graphic representations. Data are represented as the mean?standard deviation or as median. Statistical analyses of ELISpot assays were performed using a Mann Whitney non parametric and/or a Kruskal-Wallis analysis with Dunn's multiple comparison test. Significance was set at p-value<0.05.
Results
Characterization and Sequence Analysis of INVAC-1 Plasmid DNA
[0336] The characterization and sequence analysis of INVAC-1 plasmid DNA were already described in EXAMPLE I.
Characterization and Sequence Analysis of INVAC-1 Shuffled Derivative Constructs (pUTScram and pUTInv)
[0337] Two INVAC-1 shuffled derivative genes were synthesized and cloned (
[0338] Codon optimization was carried out for high level expression in mammalian cells (
INVAC-1 Shuffled Derivative Proteins are Correctly Expressed In Vitro and Degraded by the Proteasome Pathway
[0339] Western blot assay was performed to provide information about the global expression of wild-type hTERT, INVAC-1, pUTScram and pUTInv proteins after 18 h to 96 h of in vitro transient transfection into HEK293T cell lines. The bands of wild-type hTERT protein corresponded to the size of unmodified hTERT at 124.5 kDa (
INVAC-1 Shuffled Derivatives have a Predominant Cytoplasmic Distribution and a Nucleolar Exclusion Pattern
[0340] As demonstrated for INVAC-1 and INVAC-1 derivatives (pUTD10Not, pUTD10Cog and pUTD23Tyn, see EXAMPLE I), Scrambled and Inverted shuffled proteins encoded by pUTScram and pUTInv were distributed between nucleus and cytoplasm with a nucleolar exclusion pattern (data not shown).
INVAC-1 Shuffled Derivatives have No Enzymatic Activity
[0341] A TRAP assay was performed to evaluate the telomerase activity of Ubi-hTERT shuffled constructs in telomerase negative CrFK cell line. Telomerase activity was only detected in CrFK cells transfected with wild-type hTERT using pTRIP-CMV-hTERT plasmid.
[0342] As shown in
Shuffled hTERT Constructs Induce hTERT Specific CD8 T-Cell Response
[0343] pUTScram and pUTInv constructs were designed to induce antigen presentation of multiple hTERT epitopes increasing the scope of INVAC-1 features. Immunogenicity comparison of pUTScram, pUTInv and INVAC-1 was assessed in HLA-B7 mice ID immunized with the different constructs followed by skin electroporation after two cycles of immunization (prime-boost regimen). Animals were sacrificed ten days after the second vaccination/electroporation. Mouse spleens were harvested and the induced CD8 T-cell response was monitored via an IFN-? ELISPOT assay using hTERT peptides restricted to HLA-B7 MEW class I (pool of 3 peptides p277, p351 and p1123). A significant difference in the frequency of hTERT specific CD8 T-cells was observed in mice vaccinated with INVAC-1, pUTScram (Scrambled) and pUTInv (Inverted) in comparison with control animals (
[0344] These results demonstrate that artificial hTERT shuffled constructs, pUTScram (Scrambled) and pUTInv (Inverted), were capable to induce significant high levels of hTERT specific CD8 T-cell responses after two immunization cycles as INVAC-1 did. Indeed, as previously demonstrated for INVAC-1, the advantage of a prime-boost vaccination regimen is to selectively boost the previous activated specific T-cells and broaden epitope presentation in order to generate secondary hTERT specific T-cell involving new specific TCRs.
Vaccination with Artificial Shuffled hTERT Constructs pUTScram and pUTInv Induce in Vivo Cytotoxic hTERT Specific CD8 T-Cells
[0345] Among immune cells that are relevant in antitumor immune responses, cytotoxic CD8 T lymphocytes (CTL) and Th1 CD4 T-cells have been identified as the most powerful effector cells (Vesely, Kershaw et al. 2011) (Braumuller, Wieder et al. 2013).
[0346] The cytotoxic activity of hTERT specific CD8 T-cells was investigated in vivo after ID vaccination/electroporation with INVAC-1, pUTScram and pUTInv. In order to measure the in vivo cytolytic strength of the hTERT specific CD8.sup.+ T-cell response elicited by DNA immunization, an in vivo cytotoxicity assay was performed using carboxyfluorescein-diacetate succinimidyl ester (CFSE)-labelled and peptide-pulsed splenocytes as target cells. HLA-B7 transgenic mice which received one vaccination with DNA constructs (or PBS as control) via the ID route, as described before, were intravenously injected with 10.sup.7 target cells. Target cells were splenocytes from naive congenic mice independently labelled with 3 different concentrations of CFSE and pulsed with either a hTERT peptide restricted to HLA-B7 (p351, immunodominant peptide or p1123, subdominant peptide) or left unpulsed as an internal control. After 15-18 hours, spleens of immunized mice were harvested and splenocyte suspensions were analysed by flow cytometry. The percentage of specific lysis was evaluated by comparing the ratio of pulsed to unpulsed CFSE labeled cells in vaccinated mice versus control mice.
[0347] Results show that all mice immunized with the different constructs developed hTERT specific cytotoxic T lymphocytes (CTLs) after one immunization.
[0348] As expected, the cytotoxicity against the immunodominant peptide p351 was higher than against the subdominant peptide p1123 for the three groups (
[0349] Immunization with INVAC-1 and pUTInv led to a specific lysis of telomerase immune-dominant (p351) epitopes-bearing target cells of 37% and 35%, respectively (
[0350] As stated previously, it can be expected that multiple injection cycles would allow increasing the number of animals that develop a specific CTL lysis against both immunodominant and subdominant peptides. Indeed, previous results (see EXAMPLE I) demonstrated that a second immunization widens the breadth of the immune response against subdominant epitopes.
[0351] In conclusion, as INVAC-1, artificial shuffled hTERT Scrambled or Inverted-mediated immunization can generate hTERT specific CD8 T-cells that exhibit in vivo cytolytic activity.
REFERENCES
[0352] Adolph, K. 1996 ed. Viral Genome Methods CRC Press, Florida [0353] Adotevi, O., Mollier, K., Neuveut, C., Cardinaud, S., Boulanger, E., Mignen, B., Fridman, W. H., Zanetti, M., Charneau, P., Tartour, E., et al. (2006). Immunogenic HLA-B*0702-restricted epitopes derived from human telomerase reverse transcriptase that elicit antitumor cytotoxic T-cell responses. Clin Cancer Res 12, 3158-3167. [0354] Andersson, H. A., and Barry, M. A. (2004). Maximizing antigen targeting to the proteasome for gene-based vaccines. Mol Ther 10, 432-446. [0355] Bachmair, A., Finley, D., and Varshaysky, A. (1986). In vivo half-life of a protein is a function of its amino-terminal residue. Science 234, 179-186. [0356] Braumuller, H., Wieder, T., Brenner, E., Assmann, S., Hahn, M., Alkhaled, M., Schilbach, K., Essmann, F., Kneilling, M., Griessinger, C., et al. (2013). T-helper-1-cell cytokines drive cancer into senescence. Nature 494, 361-365. [0357] Cadima-Couto, I., Freitas-Vieira, A., Nowarski, R., Britan-Rosich, E., Kotler, M., and Goncalves, J. (2009). Ubiquitin-fusion as a strategy to modulate protein half-life: A3G antiviral activity revisited. Virology 393, 286-294. [0358] Cheever et al., The prioritization of cancer antigens: a national cancer institute pilot project for the acceleration of translational research. Clin Cancer Res, 2009. 15(17): p. 5323-37. [0359] Combadiere, B., and Liard, C. (2011). Transcutaneous and intradermal vaccination. Human Vaccines 7, 811-827. [0360] Cortez-Gonzalez, X., Sidney, J., Adotevi, O., Sette, A., Millard, F., Lemonnier, F., Langlade-Demoyen, P., and Zanetti, M. (2006). Immunogenic HLA-B7-restricted peptides of hTRT. Int Immunol 18, 1707-1718. [0361] Dosset, M., Godet, Y., Vauchy, C., Beziaud, L., Lone, Y. C., Sedlik, C., Liard, C., Levionnois, E., Clerc, B., Sandoval, F., et al. (2012). Universal cancer peptide-based therapeutic vaccine breaks tolerance against telomerase and eradicates established tumor. Clin Cancer Res 18, 6284-6295. [0362] Firat, H., Cochet, M., Rohrlich, P. S., Garcia-Pons, F., Darche, S., Danos, O., Lemonnier, F. A., and Langlade-Demoyen, P. (2002). Comparative analysis of the CD8(+) T cell repertoires of H-2 class I wild-type/HLA-A2.1 and H-2 class I knockout/HLA-A2.1 transgenic mice. Internat Immunol 14, 925-934. [0363] Godet, Y., Fabre-Guillevin, E., Dosset, M., Lamuraglia, M., Levionnois, E., Ravel, P., Benhamouda, N., Cazes, A., Le Pimpec-Barthes, F., Gaugler, B., et al. (2012). Analysis of spontaneous tumor-specific CD4 T cell immunity in lung cancer using promiscuous HLA-DR telomerase-derived epitopes: potential synergistic effect with chemotherapy response. Clin Cancer Res 18, 2943-2953. [0364] Lavigueur, A., H. La Branche, et al. (1993). A splicing enhancer in the human fibronectin alternate ED1 exon interacts with SR proteins and stimulates U2 snRNP binding. Genes Dev 7: 2405-2417. [0365] Michalek, M. T., Grant, E. P., Gramm, C., Goldberg, A. L., and Rock, K. L. (1993). A role for the ubiquitin-dependent proteolytic pathway in MHC class I-restricted antigen presentation. Nature 363, 552-554. [0366] Mir L M. 2008. Application of electroporation gene therapy: past, current, and future. Methods Mol Biol 423: 3-17. [0367] Murray, 1991, ed. Gene Transfer and Expression Protocols Humana Pres, Clifton, N.J. [0368] Pajot, A., Michel, M. L., Fazilleau, N., Pancre, V., Auriault, C., Ojcius, D. M., Lemonnier, F. A., and Lone, Y. C. (2004). A mouse model of human adaptive immune functions: HLA-A2.1-/HLA-DR1-transgenic H-2 class I-/class II-knockout mice. Eur J Immunol 34, 3060-3069. [0369] Parmiani, G., Castelli, C., Pilla, L., Santinami, M., Colombo, M. P., and Rivoltini, L. (2007). Opposite immune functions of GM-CSF administered as vaccine adjuvant in cancer patients. Ann Oncol 18, 226-232. [0370] Rohrlich, P. S., Cardinaud, S., Firat, H., Lamari, M., Briand, P., Escriou, N., and Lemonnier, F. A. (2003). HLA-B*0702 transgenic, H-2KbDb double-knockout mice: phenotypical and functional characterization in response to influenza virus. Int Immunol 15, 765-772. [0371] Rosenberg S A, Yang J C, Restifo N P (2004). Cancer immunotherapy: moving beyond current vaccines. Nat Med. 10:909-15. [0372] Sardesai N Y, Weiner D B. 2011. Electroporation delivery of DNA vaccines: prospects for success. Curr Opin Immunol 23: 421-429. [0373] Tasaki, T., Sriram, S. M., Park, K. S., and Kwon, Y. T. (2012). The N-end rule pathway. Annu Rev Biochem 81, 261-289. [0374] Varshaysky, A. (1996). The N-end rule: functions, mysteries, uses. Proc Natl Acad Sci USA 93, 12142-12149. [0375] Vesely, M. D., Kershaw, M. H., Schreiber, R. D., and Smyth, M. J. (2011). Natural innate and adaptive immunity to cancer. Annu Rev Immunol 29, 235-271. [0376] Yang, 1992, Gene transfer into mammalian somatic cells in vivo, Crit. Rev. Biotech. 12: 335-356 [0377] Yang, Y., Chen, Y., Zhang, C., Huang, H., and Weissman, S. M. (2002). Nucleolar localization of hTERT protein is associated with telomerase function. Exp Cell Res 277, 201-209.