GENETICALLY ENCODED RED FLUORESCENT VOLTAGE SENSORS ENABLING MILLIVOLT-RESOLUTION AND HIGH-SPEED NEURAL VOLTAGE IMAGING
20190004032 ยท 2019-01-03
Assignee
Inventors
Cpc classification
C07K14/705
CHEMISTRY; METALLURGY
C07K2319/60
CHEMISTRY; METALLURGY
International classification
G01N33/50
PHYSICS
C07K14/705
CHEMISTRY; METALLURGY
Abstract
Voltage reporter molecules and compositions, and methods for detecting voltage and voltage change in cells are provided. Also provided are methods for delivery, expression, and use of the voltage reporter molecules in cells, tissues, and subjects.
Claims
1. A voltage reporter polypeptide, comprising an amino acid sequence set forth as SEQ ID NO: 1 or a functional variant thereof, wherein the functional variant has at least 90% amino acid sequence identity to the corresponding region of SEQ ID NO: 1 and the amino acid sequence of the functional variant is not a sequence set forth as SEQ ID NO: 8, 9, 10, 11, 12, or 13, and wherein the functional variant comprises one or more amino acid substitutions, deletions, and insertions to the amino acid sequence set forth as SEQ ID NO: 1.
2. (canceled)
3. The voltage reporter polypeptide of claim 1, wherein the functional variant has at least 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, and 100% amino acid sequence identity to the corresponding region of SEQ ID NO: 1.
4. The voltage reporter polypeptide of claim 1, wherein the functional variant comprises the amino acid sequence of SEQ ID NO: 1 (Archon1), having one or more modifications, wherein the amino acid sequence is not modified at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 of the amino acid positions corresponding to residues: 20, 41, 44, 60, 80, 88, 96, 107, 137, 162, 184, 199, and 242 of SEQ ID NO: 1.
5. The voltage reporter polypeptide of claim 1, wherein the functional variant comprises the amino acid sequence of SEQ ID NO: 1 (Archon1), having one or more modifications, wherein the amino acid sequence is not modified at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 of the amino acid positions corresponding to residues: 97, 129, 133, 149, 152, 153, 156, 193, 196, 197, 200, 223, and 227 of SEQ ID NO: 1.
6-7. (canceled)
8. The voltage reporter polypeptide of claim 1, wherein the voltage reporter polypeptide has at least one of (a) a lower level of photobleaching, (b) a higher level of reporting sensitivity, and (c) a higher plasma membrane localization specificity compared to a control level of the photobleaching, reporting sensitivity, and plasma membrane localization specificity, respectively, when expressed in a cell membrane that undergoes a voltage change under suitable conditions for the voltage reporter polypeptide to be activated.
9. (canceled)
10. The voltage reporter polypeptide of claim 1, wherein the amino acid sequence of the functional variant comprises the amino acid sequence set forth as SEQ ID NO: 2 (Archon2); SEQ ID NO: 3 (Variant#3); SEQ ID NO: 4 (Variant#4); SEQ ID NO: 5 (Variant#5); SEQ ID NO: 6 (Variant#6); or SEQ ID NO: 7 (Variant#7).
11. The voltage reporter polypeptide of claim 10, wherein the amino acid sequence of the functional variant has 97%, 98%, 99%, or 100% identity to at least one of: SEQ ID NO: 1 (Archon1); SEQ ID NO: 2 (Archon2); SEQ ID NO: 3 (Variant#3); SEQ ID NO: 4 (Variant#4); SEQ ID NO: 5 (Variant#5); SEQ ID NO: 6 (Variant#6); and SEQ ID NO: 7 (Variant#7).
12-14. (canceled)
15. The voltage reporter polypeptide of claim 1, wherein the voltage reporter polypeptide is expressed in a membrane.
16-20. (canceled)
21. A fusion protein comprising a voltage reporter polypeptide of claim 1.
22. A nucleic acid sequence that encodes the voltage reporter polypeptide of claim 1.
23. (canceled)
24. A vector comprising the nucleic acid sequence of claim 22.
25-29. (canceled)
30. A method of determining voltage in a cell, the method comprising, a) monitoring a detectable signal of a voltage reporter polypeptide comprising an amino acid sequence set forth as SEQ ID NO: 1 or a functional variant thereof, wherein the functional variant has at least 90% amino acid sequence identity to the corresponding region of SEQ ID NO: 1 and the amino acid sequence of the functional variant is not a sequence set forth as SEQ ID NO: 8, 9, 10, 11, 12, or 13, and wherein the functional variant comprises one or more amino acid substitutions, deletions, and insertions to the amino acid sequence set forth as SEQ ID NO: 1 expressed in a cell; and b) determining a voltage characteristic in the cell by detecting a detectable signal of the reporter molecule of the expressed voltage reporter polypeptide, where the detectable signal indicates a voltage characteristic in the cell.
31-46. (canceled)
47. A method of identifying an effect of a test agent on a voltage in a cell, the method comprising, (a) contacting a first cell comprising the voltage reporter polypeptide comprising an amino acid sequence set forth as SEQ ID NO: 1 or a functional variant thereof, wherein the functional variant has at least 90% amino acid sequence identity to the corresponding region of SEQ ID NO: 1 and the amino acid sequence of the functional variant is not a sequence set forth as SEQ ID NO: 8, 9, 10, 11, 12, or 13, and wherein the functional variant comprises one or more amino acid substitutions, deletions, and insertions to the amino acid sequence set forth as SEQ ID NO: 1 expressed in a membrane of the first cell, with a stimulus that results in voltage in the cell that is detectable by the voltage reporter polypeptide; (b) contacting the first cell or a cell in communication with the first cell with a test agent; (c) detecting at least one voltage characteristic in the first cell, by detecting a detectable signal of the reporter molecule of the expressed voltage reporter polypeptide, where the detectable signal indicates voltage in the first cell; and (d) comparing the at least one voltage characteristic detected in step (c) to the at least one voltage characteristic detected in a control cell, wherein a difference in the at least one voltage characteristic detected in the first cell compared to the at least one voltage detected in the control cell identifies an effect of the test agent on the voltage in the first cell.
48-65. (canceled)
66. A composition comprising one or more of a: (i) voltage reporter polypeptide of claim 1, a fusion protein comprising the voltage reporter, and a polynucleotide sequence encoding the voltage reporter.
67. The composition of claim 66, further comprising one or more of: a carrier agent, a delivery agent, and a detectable agent.
68. The composition of claim 66 or 67, wherein the composition is a pharmaceutically acceptable composition.
69-73. (canceled)
74. A cell comprising the voltage reporter polypeptide of claim 1.
75. The cell of claim 74, wherein the cell is a vertebrate cell, and optionally, is a mammalian cell.
76. A cell comprising the fusion protein of claim 21.
77. A cell comprising the vector of claim 24.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0016]
[0017]
with the % indicating A/(A+B).
[0018] Image acquisition rate: 3.2 kHz.
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
with the with the % indicating A/(A+B) (n=8 neurons from 2 cultures).
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
TABLE-US-00001 BriefDescriptionofCertainoftheSequences SEQIDNO:1isaminoacidsequenceofArchon1 MVSIALQAGYDLLGDGRPESLWLGIGTLLMLIGTFYFLVRAWGETDKDAR EYYAVTILVSGIASAAYLSMFFGIGlTEVPVGGEMLNIYYARYAQWLFTT PLLLLHLALLAKVDRVTIGTLVGVDALMIVTGLIGTLSHTAIARYSWWLF STICMIVVLYVLATSLRSAAKERGPEVASTFNILTALVLVLWTAYPIIWI IGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSRAILQDTEAPEPSA GAD. SEQIDNO2isaminoacidsequenceofArchon2 MVSIALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDKDAR EYYAVPILVSGIASAAYLSMFFGIGlTEVPVGGEMLDIYYARYAHWLFST PLLLLDLALLAKVDRVIIGTLVGVDALMIVTGLIGALSHTAIARYSWWLF STICMIVVLYVLATSLRSAAKERGPEVASTFNILTALVLVLWTAYPIIWI IGTEGAGVVGLGIETLLFMVLDVTCKVGFGFILLRSRAILGDTEAPEPSA GAD. SEQIDNO:3isaminoacidsequenceofVariant#3 alsoreferredtohereinasVar#3 MVSIALQAGYDLLGDGRPEILWLGIGTLLMLIGTFYFLVRGWGVTDKDAR EYYAVTILVSGIASAAYLSMFFGIGlTEVSVGGEMLDIYYARYAEWLFCT PLLLLDLALLAKVDRVIIGTLVGVDALMIVTGLIGALSHTAIARYSWWLF STICMIVVLYVLATSLRSAAKERGPEVASTFNILTALVLVLWTAYPIIWI IGTEGAGVVGLGIETLLFMVLDVTGKVGFGFILLRSRAILGDTEAPEPSA GAD. SEQIDNO:4isaminoacidsequenceofVariant#4 alsoreferredtohereinasVar#4 MVSIALQAGYDLLGDGRPEILWLGIGTLLMLIGTFYFLVRGWGVTDKDAR EYYAVTILVSGLASAAYLSMFFGIGlTEVSVGGEMLDIYYARYAEWLFCT PLLLLDLALLAKVDRVIIGTLVGVDALMIVTGLIGALSHTAIARYSWWLF STICMIVVLYVLATSLRSAAKERGPEVASTFNILTALVLVLWTAYPIIWI IGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSRAILGDTEAPEPSA GAD. SEQIDNO:5isaminoacidsequenceofVariant#5 alsoreferredtohereinasVar#5 MVSIALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVVRGWGVTDKDA REYYAVPILVSGIASAAYLSMFFGIGlTEVPVGGEMLDIYYARYAHWLFT TPLLLLHLALLAKVDRVIIGTLVGVDALMIVTGLIGALSHTAIARYSWWL FSTICMIVVLYVLATSLRSAAKERGPEVASTFNILTALVLVLWTAYPIIW IIGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSRAILGDTEAPEPS AGAD. SEQIDNO:6isaminoacidsequenceofVariant#6 alsoreferredtohereinasVar#6 MVSIALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFVVRGWGVTDKDAR EYYAVPILVCGIASAAYLSMFFGIGlTEVPVGGEMLDIYYARYAHWLFTT PLLLLDLALLAKVDRVTIGTLVGVDALMIVTGLIGALSHTAIARYSWWLF STICMIVVLYVLATSLRSAAKERGPEVASTFNTLTALVLVLWTAYPIIWI IGTEGAGVVGLGIETLLFMVLDVTCKVGFGFILLRSRAILGDTEAPEPSA GAD. SEQIDNO:7isaminoacidsequenceofVariant#7 alsoreferredtohereinasVar#7 MVSIALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDRDAS GIASAAYLSMFFGIGITEVSVGGEMLDIYYARYAHWLFTTPLLLLDLALL AKVDRVTIGREYYAVPILVTLVGVDALMIVTGLIGALSPTAIARYSWWLF STICMIVVLYVLATSLRSAAKERGPEVASTFNILTALVLVLWTAYPIIWI IGTEGAGVVGLGIETLLFMVLDVTGKVGFGFVLLRSRAILGDTEAPEPSA GAD. SEQIDNO:8isaminoacidsequenceofaR2 MDPIALQAGFDLLNDGRPETLWLGIGTLLMLIGTFYFIARGWGVTDKEAR EYYAITILVPGIASAAYLAMFFGIGVTEVELASGTVLDIYYARYADWLFT TPLLLLDLALLAKVDRVTIGTLIGVDALMIVTGLIGALSKTPLARYTWWL FSTIAFLFVLYYLLTSLRSAAAKRSEEVRSTFNTLTALVAVLWTAYPILW IVGTEGAGVVGLGIETLAFMVLDVTAKVGFGFVLLRSRAILGETEAPEPS AGADASAAD. SEQIDNO:9isaminoacidsequenceofArch MDPIALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDKDAR EYYAVTILVPGIASAAYLSMFFGIGITEVTVGGEMLDIYYARYADWLFTT PLLLLDLALLAKVDRVTIGTLVGVDALMIVTGLIGALSIITAIARYSWWL FSTICMIVVLYFLATSLRSAAKERGPEVASTFNTLTALVLVLWTAYPILW IIGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSRAILGDTEAPEPS AGADVSAAD. SEQIDNO:10isaminoacidsequenceofArcher1 MDPIALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDKDAR EYYAVTILVPGIASAAYLSMFFGIGITEVTVGGEMLDIYYARYAEWLFCT PLLLLDLALLAKVDRVTIGTLVGVDALMIVTGLIGALSHTAIARYSWWLF STICMIVVLYFLATSLRSAAKERGPEVASTFNTLTALVLVLWTAYPFLWI IGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSRAILGDTEAPEPSA GAD. SEQIDNO:11isaminoacidsequenceofQuasAr1 MDPIALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDKDAR EYYAVTILVSGIASAAYLSMFFGIGITEVSVGGEMLDIYYARYAFIWLFT TPLLLLHLALLAKVDRVTIGTLVGVDALMIVTGLIGALSHTAIARYSWWL FSTICMIVVLYVLATSLRSAAKERGPEVASTFNTLTALVLVLWTAYPILW IIGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSRAILGDTEAPEPS AGAD. SEQIDNO:12isaminoacidsequenceofQuasAr2 MVSIALQAGYDLLGDGRPETLWLGIGTLLMLIGTFYFLVRGWGVTDKDAR EYYAVTILVSGIASAAYLSMFFGIGITEVSVGGEMLDIYYARYAQWLFTT PLLLLHLALLAKVDRVTIGTLVGVDALMIVTGLIGALSHTAIARYSVVWL FSTICMIVVLYVLATSLRSAAKERGPEVASTFNTLTALVLVLWTAYPILW IIGTEGAGVVGLGIETLLFMVLDVTAKVGFGFILLRSEAILGDTEAPEPS AGAD. SEQIDNOs:13-18aresetforthinFIG.12,and include:Arch-7(SEQIDNO:13);QuasAr-I#3(SEQ IDNO:14);QuasAr-I#7(SEQIDNO:15);QuasAr- I#14(SEQIDNO:16);QuasAr-I#16(SEQIDNO:17); andQuasAr-I#22(SEQIDNO:18). SEQIDNO:19istheDNAsequenceofthess signalsequencefromtruncatedMHCclassI antigen: gtcccgtgcacgctgctcctgctgttggcagccgccctggctccgactca gacgcgggcc. SEQIDNO:20istheaminoacidsequenceofthe ss signalsequencefromtruncatedMHCclassI antigen: MVPCTLLLLLAAALAPTQTRA. SEQIDNO:21istheDNAsequenceoftheERexport sequence(alsoreferredtohereinasER2: ttctgctacgagaatgaagtg. SEQIDNO:22istheaminoacidsequenceoftheER exportsequence(alsoreferredtohereinasER2: FCYENEV. SEQIDNO:23istheDNAsequenceofKGC,whichis aCterminalexportsequencefromthepotassium channelKir2.1: aaatccagaattacttctgaaggggagtatatccctctggatcaaataga catcaatgtt. SEQIDNO:24istheaminoacidsequenceofKGC, whichisaCterminalexportsequencefromthe potassiumchannelKir2.1: KSRITSEGEYIPLDQIDINV. SEQIDNO:25istheDNAsequenceofaprolactin signalsequence(alsoreferredtohereinasPr1: gacagcaaaggttcgtcgcagaaagggtcccgcctgctcctgctgaggtg gtgtcaaatctactcttgtgccagggtgtggtctccacccccgtc. SEQIDNO:26istheaminoacidsequenceofapro- lactinsignalsequence(alsoreferredtohereinas PrI: MDSKGSSQKGSRLLLLLVVSNLLLCQVVS. SEQIDNO:27isanaminoacidsequenceofapro- lactinsignalsequence: DSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPV.
DETAILED DESCRIPTION
[0048] The invention in some aspects relates to voltage reporter molecules that can be used in methods to detect voltage levels and changes in voltage levels across membranes. Voltage reporter polypeptides of the invention display voltage-sensitive fluorescence and thus, the fluorescence of a voltage reporter polypeptide of the invention can be assessed to determine a level or change in level of voltage across a cell membrane. In a non-limiting example, voltage sensor polypeptides of the invention can be used for high-speed optical imaging of neural activity with single cell resolution in intact brain circuits. Voltage sensor polypeptides of the invention can be used in cell culture, in vitro preparations and well as in in vivo settings. Some aspects of the invention include use of the voltage reporter molecules for high speed optical imaging of voltage and voltage changes in cells. Embodiments of methods of the invention can be used to image neural activity with single cell resolution in intact brain circuits.
[0049] Voltage reporter polypeptides of the invention have characteristics that distinguish them from prior detection molecules. One such characteristic is the high level of photostability of voltage reporter polypeptides of the invention. For example, though not intended to be limiting, a voltage reporter polypeptide of the invention, referred to herein as Archon 1, exhibits almost no photobleaching over timescales relevant to a diversity of behavioral and physiological experiments, whereas prior sensors capable of reporting neuronal activity at single cell resolution, exhibited significant photobleaching. Archon1 was determined to retain 9516% of its baseline fluorescence versus all other voltage sensors only retained 50% or less, over continuation illumination of several minutes, see
[0050] Another distinguishing characteristic of voltage reporter molecules of the invention, versus prior reporter molecules, is their ability to detect subthreshold events with single spike resolution. For example, though not intended to be limiting, Archon1 can be used to detect subthreshold events with single spike resolution in an intact brain circuit, which has not been achieved by any other voltage sensors to date. Yet another characteristic of voltage reporter molecules of the invention that distinguishes them from prior reporters is their compatibility for use with optogenetic tools. For example, though not intended to be limiting, Archon1 has demonstrated all-optical electrophysiology, incorporation of neuronal activity control via optogenetic tools and optical imaging of the activity via Archon voltage reporter. This high level of compatibility with other optogenetic tools is due, in part, to the negligible spectral overlap between optogenetic tools and Archon reporter molecules of the invention.
[0051] Voltage reporter molecules of the invention include genetically encoded voltage reporter molecules, which, when expressed in a membrane, alter their own fluorescence intensity in proportion to alternations in transmembrane potential of the membrane. In certain embodiments of the invention, Archon1 and other voltage reporter polypeptides of the invention can be used in methods that provide a direct way to observe millisecond-timescale dynamics of neuronal activity in defined cells or at defined points within cells such as neurons or other cells. Non-limiting means to express voltage reporter polypeptides of the invention in cells are via virus injection, electroporation of plasmid DNA, and micro injection of plasmid DNA into embryos, wherein the DNA comprises DNA encoding the voltage reporter polypeptide of the invention.
[0052] Methods to prepare and express a voltage reporter polypeptide of the invention in a cell, and in a subject, are described herein and also may include art-known methods to deliver and express genetically encoded fluorescent indicator molecules. Additionally, methods to select and apply a suitable wavelength of light to a cell in which a voltage reporter polypeptide of the invention is expressed, and means of monitoring fluorescence emission by a voltage reporter polypeptide expressed in a cell are provided herein and may also include art-known methods of illumination and imaging/monitoring. As used herein, the terms signal and signaling, used in reference to a voltage reporter polypeptide of the invention is the fluorescent emission of the voltage reporter polypeptide. In certain aspects of the invention wavelengths of light may be applied to a cell or cells in which one or more independently selected voltage reporter polypeptides of the invention are expressed thereby permitting monitoring fluorescence of the different voltage reporter polypeptides of the invention. In certain embodiments of the invention, one voltage reporter polypeptide of the invention may require a different wavelength of light than another voltage reporter polypeptide of the invention. Methods of determining illumination variables and of delivering illumination to cells, tissues, and in subjects are well-known in the art and representative methods can be found in publications such as: Maclaurin, D. et al., (2013) PNAS, vol. 110, no. 15:5939-5944; Hochbaum, D. R. et al., (2014) Nature Methods 11, 825-833; Flytzanis, N.C., et al., (2014) Nature Communications 5:4894, the content of each of which is incorporated herein by reference in its entirety.
[0053] Archon1, Archon2, and other voltage reporter polypeptides of the invention have been developed using a directed molecular evolution approach based on microscopy-guided robotic cell picking so that different characteristics and properties, such as those described herein, could be simultaneously optimized for a single fluorescent voltage reporter. The opsin-based fluorescent voltage reporter Archon 1 has now been shown to exhibit good localization in neurons of multiple species as compared to previous opsin-based reporters. Embodiments of voltage reporter polypeptides of the invention have been demonstrated as having several fold improvements in voltage sensitivity and photobleaching as compared to prior GFP-based reporters. Certain embodiments of voltage reporter polypeptides of the invention have demonstrated an increased compatibility with optogenetic control, versus that of prior sensor molecules. Activity and characteristics of embodiments of voltage reporter polypeptides of the invention, including, but not limited to Archon1, have been demonstrated using methods such as imaging spiking and millivolt-scale subthreshold and synaptic activity in various cell types and animal models, including but not limited to: imaging subthreshold (e.g., 5 mV) synaptic activity in mouse cortical brain slices, high speed spiking and subthreshold activity in the larval zebrafish brain, and neural responses synaptically downstream of optogenetically controlled neurons in C. elegans.
[0054] To develop a fluorescent voltage reporter for use in multiple voltage detection contexts, a directed molecular evolution approach was developed that enabled multiple properties of a fluorescent voltage reporter to be simultaneously optimized. In particular, robotic cell picking was adapted and used for the isolation of single mammalian cells expressing individual members of a large library of fluorescent voltage reporter candidates, based upon three parametersbrightness, localization, and voltage sensitivity. Resulting fluorescent voltage reporters of the invention, a non-limiting example of which is Archon1, have been shown to exhibit good performance along multiple dimensions of parameters desired in a fluorescent voltage reportergood localization, high signal-to-noise ratio, large and linear fluorescent changes, high speed of response, reduced photobleaching, and full compatibility with optogenetic control.
[0055] Embodiments of voltage reporter polypeptides of the invention are also several-fold brighter than previous opsin-based fluorescent voltage reporters. The voltage reporter polypeptide, Archon1, and other voltage reporter polypeptides of the invention are practical voltage reporters suitable for use in a wide range of applications. The terms sensor and reporter are used interchangeably herein in reference to molecules of the invention, which may be referred to as voltage reporter molecules or voltage sensor molecules herein.
[0056] Embodiments of voltage reporting polypeptides of the invention may be expressed in a membrane of a cell, for example in the plasma membrane of the cell. A voltage reporting polypeptide of the invention can be expressed in a cell as an integral membrane protein and can be used to detect voltage and voltage changes across the membrane. A voltage reporter polypeptide of the invention emits endogenous fluorescence that is modulated by voltage levels across a membrane in which the reporter polypeptide of the invention is expressed. In certain embodiments of the invention, a voltage reporter polypeptide of the invention can be expressed in a cell membrane and its fluorescence monitored to assess changes in membrane voltage through individual neurons, through two or more neurons in one or more of physical and chemical communication with each other, and also throughout a population of neurons.
[0057] Examples of voltage reporter molecules that have now been identified are: Archon1, Archon2, Variant#3, Variant#4, Variant#5, Variant#6, and Variant#7, which are set forth herein as SEQ ID NOs: 1-7, respectively. Certain embodiments of voltage reporter polypeptides of the invention are functional variants of one or more of Archon1 and Archon 2. In some embodiments of the invention, a voltage reporter polypeptide is a functional variant of one or more of SEQ ID NOs: 3-7. The invention in some aspects relates to novel voltage reporter polypeptides and nucleic acid sequences that encode the polypeptides. In addition, the invention includes methods of using voltage reporter molecules of the invention for one or more of monitoring, detecting, measuring, and assessing a voltage in a cell and one or more changes in voltage in a cell. Some aspects of the invention include methods of incorporating one or more voltage reporter polypeptide of the invention into at least one target cell membrane, the voltage reporter polypeptide functioning to assess voltage across the cell membrane and/or transmembrane passage of ions in the cell.
[0058] The invention comprises methods for expressing the voltage reporter polypeptides in one or more genetically targeted cells, which permits detection of millisecond-timescale voltage changes and currents in the one or more cells. The voltage reporter polypeptides of the invention can be genetically expressed in specific cells (e.g., using a virus, vector, or other means for delivery) and then used to assess voltages changes in cells in intact organisms (including humans) as well as cells in vitro. Voltage reporter polypeptides of the invention can be expressed in cell membranes of specific cells, tissues, and/or organisms and the voltage-sensitive fluorescence of the reporter polypeptides can be determined as a measure of one or more of: a voltage state of a cell, a voltage change in a cell, ion flux across the cell membrane, proton flux across the cell membrane, and excitation in the cell in which the voltage reporter of the invention is expressed. In some aspects of the invention, the voltage reporter polypeptide comprises the sequence set forth as SEQ ID NO: 1 or a functional variant thereof. In certain aspects of the invention, the voltage reporter polypeptide comprises the sequence set forth as SEQ ID NO: 2 or a functional variant thereof. In certain aspects of the invention two or more different voltage reporter polypeptides of the invention are expressed in a cell, tissue, or organism.
Molecules, Expression, and Functions
[0059] Voltage reporter polypeptides of the invention comprise a voltage-sensitive portion and a fluorophore. As used herein, the fluorophore is also referred to as the fluorescent component or fluorescent portion of the voltage reporter molecule. The voltage sensitivity permits use of a voltage reporter polypeptide to determine voltage change or conductance across a membrane in which the polypeptide is expressed. A change in voltage across a membrane in which a voltage reporter polypeptide of the invention is expressed modulates absorption in the voltage reporter polypeptide. This modulation alters the fluorescence emission of the voltage reporter polypeptide. Thus, determination of fluorescence emission of the voltage reporter polypeptide identifies the status of, and changes in, voltage across the membrane. When a voltage reporter polypeptide of the invention is expressed in a cell membrane, a modulation of voltage across the membrane alters the fluorescence emitted by the reporter. This alteration permits use of voltage reporter polypeptides of the invention to be used to indicate the voltage state of a cell, a change in voltage across a cell membrane, the lack of change across a cell membrane, etc. As used herein the term: voltage state when used in reference to a cell, can mean one of more of: depolarization of the cell, hyperpolarization of the cell, a voltage level in the cell, etc.
[0060] Depolarization and hyperpolarization of a cell in which a voltage reporter polypeptide of the invention is expressed, each result in a change in the fluorescence emission of the voltage reporter polypeptide and the fluorescence emission changes indicate the voltage state of the cell. The invention includes, in part, methods comprising expressing a voltage reporter polypeptide in a cell, determining one or more changes in fluorescence of the expressed voltage reporter polypeptide, and assessing one or more characteristics of a voltage change in the cell based on the determined change in fluorescence. Non-limiting examples of characteristics of voltage changes in a cell that can be assessed using methods of the invention are: the type of voltage change, speed of voltage change, direction (increase or decrease) of voltage change, size or amplitude of voltage change, and duration of the voltage change in the cell.
[0061] Conduction of ions and/or protons across a membrane of a cell in which a voltage reporter polypeptide of the invention is expressed may also be referred to herein as one or more of the conductivity of the membrane and voltage across the membrane. As used herein, a change in conductivity of the membrane and/or a change in voltage across a membrane may be an increase or decrease in conductivity or voltage, respectively. In certain aspects, voltage reporter polypeptides of the invention can be used for one or more of determining, measuring, assessing, quantifying alternations or changes in one or more of the conductivity of the membrane and the voltage across the membrane in which the voltage reporter polypeptide is expressed. The terms conductance and conductivity may be used interchangeably herein in reference to the movement of one or more of charge, protons, and ions across a membrane.
[0062] A voltage reporter polypeptide of the invention can be used to assess ion conductance, depolarization, and hyperpolarization in a cell in which it is expressed. As will be understood by those in the art the term depolarized used in the context of a cell means an upward change in the voltage in the cell. For example, in an excitable cell at a baseline voltage of about 65 mV, a positive change in voltage, e.g., up to 5, 10, 15, 20, 30, 40, or more millivolts (mV) is a depolarization of that cell. When the change in voltage is sufficient to reach the cell's spike initiation voltage threshold, an action potential (e.g. a spike) results. It will be understood by those in the art that the term: hyperpolarized used in the context a cell means a downward change in the cell's membrane potential and voltage such that it becomes more negative, which is the opposite of the depolarization characteristics in a cell. Hyperpolarization of a cell inhibits the occurrence of action potentials in the cell by increasing the stimulus that is necessary to move the membrane potential up to the action potential threshold.
Expression of Voltage Reporter Molecules
[0063] In certain aspects of the invention, a voltage reporter polypeptide can be expressed in a cell in methods to determine a baseline voltage level or characteristic of the voltage state and subsequent determinations of fluorescence of the voltage reporter polypeptide in the cell can be compared and/or used to assess an effect of one or more changes to a cell and/or its environment. For example, assessing changes to a cell may include contacting a first cell comprising the voltage reporter polypeptide, or contacting a second cell that is in communication with the first cell, with one or more test agents. As used herein a test agent can be: an electrical stimulation, a candidate compound, a pharmaceutical compound, etc. As used herein, the term communication with used in reference to a cell expressing a voltage reporter polypeptide of the invention, includes cells, for example that influence the cell comprising the voltage reporter polypeptide, via neurotransmitter means, electrical means, etc. Communication can be direct communication from a cell immediately (directly) upstream from the cell that expresses the voltage reporter polypeptide, or can be indirect communication, such as the result of activity of a cell further (indirectly) upstream that impacts voltage in the cell in which the voltage reporter polypeptide is expressed. Stimulation of one or more of a cell directly upstream and a cell indirectly upstream may result in a voltage change in the cell expressing the voltage reporter polypeptide and such changes can be assessed using methods of the invention.
[0064] Methods and voltage reporter molecules of the invention can be used to assess one or more changes in: (1) an internal environment of a cell, (2) an external environment of a cell, (3) an internal environment of an upstream cell, and (4) an external environment of an upstream cell. Non-limiting examples of events and situations that may change in a cell's internal or external environment include, a disease or injury condition in the cell or subject comprising the cell, contact of the cell with a test agent or compound, contact of the cell with a pharmaceutical agent or compound, a surgical procedure in the subject, contact of the cell with radiation, light, electric stimulation, etc. Other types of events and actions that alter the internal or external environment of a cell are known in the art, and can also be assessed using methods and voltage reporter molecules of the invention.
[0065] Voltage reporter polypeptides of the invention can be used to detect and assess depolarization in excitable cells in which one or more voltage reporter polypeptides of the invention are expressed. In some embodiments, a voltage reporter polypeptide of the invention, is expressed in a sub-population of cells in a cell population that also includes one or more additional subpopulations of cells in which a different voltage reporter polypeptide is expressed.
[0066] The two voltage reporter polypeptides may have the same or different characteristics, non-limiting examples of which are: sensitivity to voltage changes, speed of reaction to voltage changes, brightness levels, photobleaching levels, etc. The expression of voltage reporter polypeptides having one or more different characteristics in distinct, separate, subpopulations in a cell population can permit multiple determinations of changes in voltage in cells in the population by assessing the different characteristics of the expressed voltage reporter polypeptides. Thus, some embodiments of the invention include methods of using two or more different, independently selected voltage reporter polypeptides of the invention to assess voltage changes in a mixed population of cells. In a non-limiting example of a combined expression strategy, an Archon1 polypeptide can be expressed in a set of cells in a tissue, culture, or subject and an Archon2 voltage reporter polypeptide can be expressed in another set of cells in the tissue, culture, or subject. Different characteristics of Archon 1 and Archon2 can permit determination of effects of environmental changes on cells in the tissue, culture, or subject. For example, though not intended to be limiting, fluorescence emission by an Archon1 polypeptide expressed in a cell may change in response to a smaller amplitude voltage change in the cell in which it is expressed, than the amplitude of voltage change necessary to alter fluorescence emission of an Archon2 polypeptide expressed in a cell. This difference, and other different characteristics of voltage reporter polypeptides of the invention, may be used to assess voltage in different cells, and in sub-populations of cells in the same tissue, culture, subject, and/or system.
[0067] Voltage reporter polypeptides of the invention are well suited for targeting cells, expression in cell membranes, and for use to detect and assess voltage-associated cell activities. In some embodiments, a voltage reporter polypeptide of the invention can be utilized to detect one or more of ion flux and proton flux across cell membranes, thus for assessment of endogenous signaling pathways (such as calcium dependent signaling, etc.), and then putative modulatory compounds can be applied to the cell in which the voltage reporter is expressed, or to a cell upstream of that cell, and monitoring the voltage reporter can be used to determine the effect on voltage in the cell(s). Thus, certain aspects of the invention include methods of using voltage reporter polypeptides of the invention to screen putative therapeutic agents, known therapeutic agents, combinations of two or more independently selected known and putative therapeutic agents. One or more voltage reporter polypeptides of the invention can also be used in methods to assess the effect of internal cellular conditions, environmental conditions external to the cell, and to assess the result diseases, injuries, treatments, etc. on cell voltage and voltage changes.
Molecules and Compounds
[0068] The present invention, in part, includes novel voltage reporter polypeptides, their expression in cell membranes, and their use to determine alterations in one or more of: ion flux across the membrane, proton flux across the membrane, and voltage change in the cell in which they are expressed. Embodiments of the invention include voltage reporter polypeptides set forth as SEQ ID NO: 1-7 and their encoding polynucleotides, functional variants of SEQ ID NOs: 1-7 and their encoding polynucleotides, compositions comprising the voltage reporter molecules or functional variants thereof, and methods of using the voltage reporter molecules and/or functional variants to determine one or more voltage states in a cell. Non-limiting examples of voltage reporter polypeptides of the invention are set forth as: Archon1 (SEQ ID NO: 1) and Archon2 (SEQ ID NO: 2). Additional examples of voltage reporter polypeptides of the invention are provided herein as: Var#3 (SEQ ID NO: 3), Var#4 (SEQ ID NO: 4), Var#5 (SEQ ID NO: 5), Var#6 (SEQ ID NO: 6), and Var#7 (SEQ ID NO: 7). Aspects of the invention also include additional functional variants of SEQ ID NOs: 1 and 2, their encoding polynucleotides, compositions comprising the functional variants, and methods of using the functional variants to determine one or more voltage states in a cell.
[0069] Certain embodiments of sequences of polypeptides and polynucleotides of the invention are described herein. It is understood that the terms: voltage reporter molecules, voltage reporter polypeptides, and voltage reporter polynucleotides encompass molecules, polypeptides, and polynucleotides, respectively, described herein, as well as functional variants thereof. The invention also includes compounds and compositions that comprise one or more voltage reporter molecules of the invention. A compound or composition that comprises a voltage reporter molecule of the invention may include only the voltage reporter molecule or may include one, two, three, four, five, six, or more additional elements. Non-limiting examples of additional elements are: a vector, a promoter, a detectable label sequence, a trafficking sequence, a delivery molecule sequence, an additional voltage reporter molecule sequence, an additional sequence, etc. The term voltage reporter molecule is used herein in reference to voltage reporter polypeptides and/or encoding voltage reporter polynucleotides.
[0070] Some embodiments of the invention include functional variants of one of more of Archon1, Archon2, and Variant#3, Variant#4, Variant#5, Variant#6, and Variant#7. For example, one or more positions in a voltage reporter polypeptide sequence of the invention such as one of SEQ ID NOs: 1-7 may be modified to prepare a functional variant. Some aspects of the invention include methods of preparing and using polynucleotide molecules (which may also be referred to herein as genes) having nucleic acid sequences that encode a voltage reporter polypeptide of the invention. The invention, in part, also includes nucleic acid sequences that encode voltage reporter polypeptides of the invention, vectors, and constructs comprising the encoding nucleic acid sequences. A construct of the invention may also include nucleic acid sequences that encode one or more of a trafficking molecule, a fluorescent molecule, or other label or desired molecule.
[0071] A functional variant of a voltage reporter polypeptide of the invention comprises a modified sequence of the voltage reporter polypeptide of the invention from which it is derived. As used herein the term modified or modification in reference to a polypeptide sequence refers to a change of one, two, three, four, five, six, or more amino acids in the sequence as compared to the sequence from which it was derived. For example, the amino acid sequence of a functional variant of an Archon1 polypeptide may be identical to the amino acid sequence set forth as SEQ ID NO: 1, except the functional variant has one, two, three, four, five, or more amino acid substitutions, deletions, insertions, or combinations thereof.
[0072] It will be understood that sequences of a functional variant of a voltage reporter polypeptide of the invention may be considered to be derived from more than one of SEQ ID NOs: 1-7 set forth here, due to sequence similarity between one or more of SEQ ID NOs: 1, 2, 3, 4, 5, 6, and 7 as set forth herein. For example, a functional variant that has 96% sequence identity to the sequence of Archon1 (SEQ ID NO: 1), may have at least 90%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of one or more of Archon2, Var#3, Var#4, Var#5, Var#6, and Var#7, as set forth herein. Using standard sequence alignment methods one of ordinary skill in the art can align sequences for Archon 1, Archon2, and Var#3-Var#7 provided herein to determine correspondence of one or more amino acid residues of one sequence with the one or more residues in an aligned sequence. Thus, as a non-limiting example, one skilled in the art can ascertain that residue position 118, which is an I in the Archon2 sequence set forth as SEQ ID NO: 2, corresponds to position 118, which is also an 1 in the Var#3 sequence set forth as SEQ ID NO: 3, and corresponds to position 118, which is a T in the Archon1 sequence set forth herein as SEQ ID NO: 1.
[0073] Routine sequence alignment methods and techniques can be used to align two or more voltage reporter polypeptide sequences, including but not limited to sequences specifically disclosed herein, sequences described herein, and modified sequences derived from such sequences, thus providing a means by which a corresponding location of a modification made in one voltage reporter polypeptide can be identified in another voltage reporter polypeptide sequence. Amino acid sequences of voltage reporter polypeptides of the invention can be aligned with amino acid sequences of one or more other candidate voltage reporter polypeptides, to aid in identifying corresponding positions for sequence modifications such as substitutions, additions, deletions, etc., that can be based, at least in part, on the sequence alignments.
[0074] In some embodiments of the invention, certain substituted voltage reporter polypeptides and their encoding polynucleotides are excluded as voltage reporter molecules of the invention. For example, known polypeptides: Ar2, which is set forth herein as SEQ ID NO: 8; Arch, which is set forth herein as SEQ ID NO: 9; Archer1, which is set forth herein as SEQ ID NO: 10; QuasAr1, which is set forth herein as SEQ ID NO: 11; QuasAR2, which is set forth herein as SEQ ID NO: 12; and Arch-7, which is set forth herein as SEQ ID NO: 13. In some aspects of the invention, a voltage reporter polypeptide does not have at least 96%, 97%, 98%, 99%, or 100% amino acid sequence identity to one or more of the sequences set forth herein as SEQ ID NOs: 8-13.
[0075] In certain embodiments of the invention, amino acids at particular positions (in reference to corresponding to residue positions of the sequence from which they are derived) are not modified from that of the amino acid sequence from which they are derived, which may also be referred to herein as the parent sequence. In some aspects of the invention, an amino acid present in a position corresponding to a residue position in Archon1 (SEQ ID NO: 1) is not modified and is the same residue as that in the corresponding position in SEQ ID NO: 1. In some aspects of the invention, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or 11 of the 97 W, 129M, 133G, 149 W, 152S, 153T, 156M, 193 W, 196Y, 197P, and 227K residue position numbers and amino acids that are present in Archon1 (SEQ ID NO: 1), are the same in the corresponding residue position in another voltage reporter polypeptide of the invention. In certain embodiments of the invention all of the amino acids and residue positions: 97 W, 129M, 133G, 149 W, 152S, 153T, 156M, 193 W, 196Y, 197P, and 227K are the same in the residue positions in a voltage reporter polypeptide that correspond to these positions in SEQ ID NO: 1. In some aspects of the invention, 1, 2, 3, or 4 of the amino acids and residue positions: 94Y, 198I, 200 W, 223D are the same in the residue positions in a voltage reporter polypeptide that correspond to these positions in SEQ ID NO: 1.
[0076] In some aspects of the invention, an amino acid present in a position corresponding to a residue position in Archon1 (SEQ ID NO: 1) is modified and is not the same residue as that in the corresponding position in SEQ ID NO: 1. For example, a voltage reporter polypeptide of the invention may include I in the position corresponding to residue 118 in Archon1, which is T118 in Archon1, as set forth in SEQ ID NO: 1. Non-limiting examples of positions and modifications that that can be made in the sequence of Archon1, and that result in the derived sequence retaining a level of function as a voltage reporter polypeptide of the invention, are indicated in the alignment of SEQ ID NOs: 1-7, as shown in
[0077] Certain embodiments of the invention include polynucleotides comprising nucleic acid sequences that encode a voltage reporter polypeptide of the invention, and some aspects of the invention comprise methods of delivering and/or using such polynucleotides in cells, tissues, and/or organisms. Voltage reporter polynucleotide sequences and amino acid sequences used in aspects and methods of the invention may be isolated sequences. As used herein, the term isolated used in reference to a polynucleotide, nucleic acid sequence, polypeptide, or amino acid sequence means a polynucleotide, nucleic acid sequence, polypeptide, or amino acid sequence, respectively, that is separate from its native environment and present in sufficient quantity to permit its identification or use. Thus, a nucleic acid or amino acid sequence that makes up a voltage reporter polynucleotide or polypeptide molecule that is present in one or more of a vector, a cell, a tissue, an organism, etc., may be considered to be an isolated sequence if it is not naturally present in that cell, tissue, or organism, and/or did not originate in that cell, tissue, or organism.
[0078] As used herein the term host used in reference to a membrane, cell, or organism means a membrane, cell, or organism, respectively, in which a voltage reporter polypeptide of the invention is expressed. Examples of a host membrane, cell, tissue, or organism include, but are not limited to vertebrate membranes, invertebrate membranes, mammalian (including but not limited to non-human primate, human, dog, cat, horse, mouse, rat, etc.), insect (including but not limited to Drosophila, etc.), fish, worms, nematodes, and avian membranes, cells, tissues, and organisms. In certain embodiments of the invention a membrane may be a plant membrane.
[0079] Additional voltage reporter polypeptides of the invention are envisioned based on sequence similarity to the sequence of Archon 1, Archon2, and/or one of more of Var#3, Var#4, Var#5, Var#6, and Var#7 set forth herein, and the characteristics or the voltage reporter polypeptides described herein. The presence and/or level of functions/characteristics such as, but not limited to, sensitivity, reaction speed, minimal bleaching, effective and optimal localization to membrane, etc. can be determined using methods described herein and art-known methods. It is understood that that the level of sequence identity with a functional variant of a voltage reporter polypeptide of the invention set forth herein plus functionality with respect to reporter characteristics can be used to identify additional voltage reporter molecules of the invention using standard procedures for sequence alignment, comparisons, and assays for voltage reporter characteristics and activity. Additional voltage reporter polypeptides that have one or more substitutions or other modifications to the sequence of one more sequences set forth herein as SEQ ID NOs: 1-7 can be identified and tested for characteristics including, but not limited to: expression, membrane localization, bleaching, longevity, sensitivity to voltage changes, brightness, maintenance of brightness, etc. using methods and sequences disclosed herein in conjunction with art-known methods.
[0080] In some embodiments of the invention, the amino acid sequence of voltage reporter polypeptide of the invention that is a functional variant of one or more of the sequence set forth herein as SEQ ID NOs: 1-7 has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97% 98%, or 99% amino acid sequence identity to the amino acid sequence corresponding to one or more of SEQ ID NOs: 1-7. In certain embodiments of the invention, a voltage reporter polypeptide of the invention that is a functional variant of one or more of SEQ ID NOs: 1-7 has at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 990/% identity to the polypeptide sequence of the voltage reporter polypeptide sequence from which it was derived. As a non-limiting example, a functional variant of Archon 1 (SEQ ID NO: 1), may have at 97% amino acid sequence identity to the sequence from which it was derived, in this example, the sequence set forth as SEQ ID NO: 1.
[0081] Additional amino acid substitutions, deletions, and/or insertions in the sequence of a voltage reporter polypeptide of the invention set forth herein as SEQ ID NOs: 1-7, that result in a functional variant may be constrained with respect to the extent of permissible modifications from the amino acid sequence of the voltage reporter polypeptide from which it is derived in order to permit the functional variant polypeptide to have all, greater than, or at least a portion of the level of function or characteristic of the voltage reporter polypeptide from which is was derived, when the variant is expressed in a cell and a voltage change occurs in the cell under suitable conditions to determine a change in voltage across a membrane of the cell. In certain aspects of the invention determination of a level that is greater than or a portion of the level of a function or a characteristic is based on the presence or absence of the function or a percentage change, for example, though not intended to be limiting, Archon1 has been shown to have essentially zero photobleaching under 800 mW/mm.sup.2 637 nm illumination during 8 minutes of continuous excitation, thus a voltage reporter polypeptide of the invention that is derived from Archon1, may, under similar test conditions demonstrate a greater level of photobleaching than zero, and it may be described as decreasing no more than: 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 120% 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 35%, 40%, 45%, or 50% from the initial level of fluorescence emission of the derived voltage reporter polypeptide. Thus, in a non-limiting example, a voltage reporter polypeptide derived from Archon 1 may show 3% photobleaching compared to essentially 0% photobleaching of Archon 1 when the two are tested under similar conditions.
[0082] In certain aspects of the invention, determination of a level that is greater than or a portion of the level of a function or a characteristic of a parent voltage reporter polypeptide is based on a percentage of the function or characteristic identified under certain conditions. The functional variant polypeptide is then tested under similar conditions and one or more differences are determined. For example, a function or characteristic of a functional variant of a voltage reporter polypeptide of the invention may be at least 80%, 85%, 90/%, 95%, 96%, 97%, 98%, 990%, 100%, 105%, 110%, 115%, 120%, 130%, 140%, 150%, 160%, 170%, 180%, 190%, 200%, 300%, 400%, or 500% of the level of the function or the characteristic of the parent voltage reporter polypeptide of the invention from which the functional variant is derived. In a non-limiting example, it has been demonstrated that Archon1 has a level of functionality that permits imaging of subthreshold (e.g., 5 mV) synaptic activity in neurons. An embodiment of a voltage reporter polypeptide of the invention that is a functional variant of SEQ ID NO: 1 (Archon 1) when tested under similar conditions to those used to assess Archon1 sensitivity, may also show sensitivity to imaging subthreshold synaptic activity that is 100% of the sensitivity of Archon1 under the same conditions (which would be sensitivity to 5 mV), or may show 95% of the sensitivity of Archon1 under the same conditions (indicating it is slightly less sensitive than Archon 1), or may show 105% of the sensitivity of Archon1 under the same conditions (indicating it is slightly more sensitive than Archon 1). One of skill in the art will be able to determine and compare functional levels and characteristics of voltage reporter polypeptides of the invention and will understand how to compare functions and characteristics when modifying an amino acid sequence in one or more of the sequences set forth herein as SEQ ID NOs: 1-7. Characteristics include, but are not limited to those set forth in
[0083] As used herein, the term identity with respect to sequences of voltage reporter polypeptides of the invention refers to the degree of relatedness or similarity between two or more polypeptide sequences (or polynucleotide sequences). Sequence identity can be determined using art-known means that may comprise the alignment and match between the sequences. A percentage of identity or similarity may be the percentage of identical amino acids in two or more sequences, when taking account of gaps and other sequence features. The identity between polypeptide sequences can be determined by means of art-known procedures and numerous algorithms and programs are available and routinely used by those in the art to determine identity between polypeptide sequences and to determine identity between nucleic acid sequences. Non-limiting examples of programs and algorithms include BLASTP, BLASTN and FASTA (Altschul et al., NCB NLM NIH Bethesda Md. 20894; Altschul et al., 1990). Online BLAST programs from the National Library of Medicine are available, for example, at blast.ncbi.nlm.nih.gov/Blast.cgi.
[0084] A voltage reporter polypeptide of the invention that is a functional variant of at least one of SEQ ID NOs: 1-7 may be shorter or longer than its parent voltage reporter polypeptide from which it was derived, and in certain aspects of the invention, the percentage identity between two sequences is based on the percent identity of the corresponding sequence regions when the two sequences are aligned. In some aspects of the invention, a voltage reporter polypeptide that is a functional variant of one or more of SEQ ID NOs: 1-7, is a full-length functional variant of its parent sequence, and in some embodiments of the invention, it may be a functional fragment of the sequence from which it was derived.
[0085] Sequence modifications can be one or more of substitutions, insertions, and deletions and any combination thereof. Sequence modifications may be prepared using methods described herein, by site-specific mutagenesis of nucleic acids in the DNA encoding a voltage reporter polypeptide of the invention, using cassette or PCR mutagenesis, or other techniques known in the art, to produce DNA encoding a voltage reporter polypeptide that comprises sequence modified from its parent sequence, and expressing the DNA in an in vivo cell, tissue, subject, or in an in vitro cell, for use and/or for testing. Amino acid sequence variants may be characterized by the predetermined nature of the sequence modification. Voltage reporter polypeptides of the invention that are functional variants of one or more voltage reporter polypeptides set forth as SEQ ID NOs: 1-7, can be identified and tested for levels of function and characteristics including, but not limited to: expression, membrane localization, sensitivity to voltage, photobleaching levels, duration of brightness, response time to voltage change, duration of adequate fluorescence emission, etc. using methods disclosed herein and additional art-known methods. In some aspects of the invention, a voltage reporter polypeptide of the invention that is a functional variant of one or more of SEQ ID NOs: 1-7, exhibits the same qualitative level of one or more functions and characteristics, or combination thereof, as the polypeptide from which it is derived. In certain aspects of the invention, a voltage reporter polypeptide of the invention that is a functional variant of one or more of SEQ ID NOs: 1-7, can be prepare and selected on that basis that it exhibits a different qualitative level of one or more functions and characteristics, or combination thereof, as the polypeptide from which it is derived.
[0086] A site or region for introducing an amino acid sequence modification in one or more of SEQ ID NOs: 1-7 may be predetermined, and the mutation per se need not be predetermined. For example, to prepare a voltage reporter polypeptide that is a functional variant of one or more of SEQ ID NOs: 1-7, there are regions corresponding to the sequence set forth as SEQ ID NO: 1, that are more tolerant and less tolerant of modification. Non-limiting examples of regions that may be tolerant to sequence modifications include: AA 1-18, AA 21-37, AA 48-55, AA 225-254, with the amino acid numbers corresponding to the residue numbers in SEQ ID NO: 1. Although not wishing to be bound to any theory, regions that may be involved in, and/or important for, functions or characteristics of voltage reporter polypeptides of the invention, include, but are not limited to: AA 21-37 and AA 200-225 (brightness); AA 200-225 (reduced photobleaching); and AA 1-18, AA 21-37, AA 48-55, AA 141-161, and AA 225-254 (localization in plasma membrane), with the amino acid numbers corresponding to residue numbers in SEQ ID NO: 1. It will be understood that by aligning a second amino acid sequence with SEQ ID NO: 1, the corresponding residue numbers and regions in the second amino acid sequence can be determined. Methods to identify and select amino acids to modify include those described elsewhere herein as well as additional art-known methods.
[0087] A level of function of a voltage reporter polypeptide of the invention can be tested using methods described herein as can characteristics of voltage reporter polypeptides, including, but not limited to: expression, cell localization, sensitivity, level of photobleaching, duration of fluorescence, speed of reaction to voltage and voltage changes, recovery following voltage changes, brightness, etc. using methods disclosed herein. Types of sequence modifications that may be included in voltage reporter polypeptide of the invention, that is a functional variant of one or more of a voltage reporter polypeptide set forth herein as SEQ ID NOs: 1-7 may include, but are not limited to conservative amino acid substitutions, which will produce molecules having functional characteristics similar to those of the parent polypeptide. Conservative amino acid substitutions are substitutions that do not result in a significant change in the activity or tertiary structure of a selected polypeptide. Such substitutions typically involve replacing a selected amino acid residue with a different residue having similar physico-chemical properties.
[0088] For example, substitution of Glu for Asp is considered a conservative substitution because both are similarly sized, negatively charged amino acids. Groupings of amino acids by physico-chemical properties are known to those of skill in the art. The following groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) [see, e.g., Creighton, Proteins (1984)].
[0089] In some embodiments, a voltage reporter polypeptide of the invention may include one or more unnatural amino acids as well as natural amino acids. An unnatural amino acid can be included in a certain voltage reporter polypeptide of the invention to enhance a characteristic such as localization, stability, response speed, brightness, or lower toxicity, etc.
[0090] Amino acid substitutions may made to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more single residues and amino acid insertions may be on the order of from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more amino acids, though larger numbers of substitutions and insertions may be tolerated. Amino acid deletions may range from 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, or more. Substitutions, deletions, insertions or any combination thereof may be used to arrive at a voltage reporter polypeptide retains all, or a significant portion of one, some, or all of the level of function and characteristics of a voltage reporter polypeptide of the invention as set forth herein. In certain embodiments of the invention, these changes are made on a few amino acids to minimize the alteration of the molecule. However, larger changes may be tolerated in certain circumstances.
[0091] Voltage reporter polypeptides derived from one or more of SEQ ID NOs: 1-7 set forth herein, may exhibit the same qualitative function and/or characteristics of the voltage reporter polypeptide from which it is derived, and/or may show one or more increased or decreased level of a function or characteristic of its parent voltage reporter polypeptide. In some embodiments of the invention one, some (for example 2, 3, 4, 5, 6, or 7), or all of the function and characteristics of a voltage reporter polypeptide derived from a voltage reporter polypeptide set forth herein as one of SEQ ID NO: 1-7 are within 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 90%, 10%, 11%, 12%, !3%, 14% 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24%, 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, or 40% of the level of the function or characteristic determined for a voltage reporter polypeptide set forth herein as Archon 1 or Archon2. It will be understood that the level of a function or characteristic of a voltage reporter polypeptide derived from one or SEQ ID NOs: 1-7 may be higher than, essentially the same as, or lower than that function or characteristic in Archon1 or Archon2 under similar circumstances. As a non-limiting example, the sequence of Archon1 may modified with one or more independently selected substitutions, insertions or deletions such that the resulting functional variant of Archon 1 has an increased sensitivity to voltage change, better localization, faster response to voltage, slower response to voltage, less bright, brighter, etc. than in Archon1, the voltage reporter polypeptide from which it was derived. As non-limiting example, the characteristic of brightness in a voltage reporter polypeptide that is a functional variant of Archon1 may be essentially the same as the brightness of Archon1, 5% brighter than the brightness of Archon1, or 7% less bright than the brightness of Archon 1. Routine methods can be used to determine the level of characteristics and functions of voltage reporter polypeptides of the invention and such determinations can be compared in different putative and confirmed voltage reporter polypeptides of the invention.
[0092] Specific amino acid locations and/or residues for substitution in a sequence set forth herein as SEQ ID NO: 1 or SEQ ID NO: 2 have now been identified that alone, or in combination with one or more addition substitutions have been demonstrated to be effective to prepare a voltage reporter polypeptide of the invention. Examples, though not intended to be limiting are shown herein in SEQ ID NOs: 3-7.
[0093] Another aspect of the invention provides nucleic acid sequences that encode voltage reporter molecules of the invention, including those encoding functional variants of the voltage reporter polypeptides disclosed herein. It will be understood by skilled artisans that the voltage reporter polypeptides can be encoded by various nucleic acids. Each amino acid in the protein is represented by one or more sets of 3 nucleic acids (codons). Because many amino acids are represented by more than one codon, there is not a unique nucleic acid sequence that codes for a given protein. It will be understood by those of skill in the art how to prepare a nucleic acid that encodes a voltage reporter polypeptide of the invention based on knowledge of the amino acid sequence of the polypeptide. A nucleic acid sequence that codes for a polypeptide or protein is the gene of that polypeptide or protein. A gene can be RNA, DNA, or other nucleic acid than will code for the polypeptide or protein. The terms, protein, polypeptides, and peptides are used interchangeably herein.
[0094] It is understood in the art that the codon systems in different organisms can be slightly different, and that therefore where the expression of a given protein from a given organism is desired, the nucleic acid sequence can be modified for expression within that organism. Thus, in some embodiments, a polynucleotide that encodes a voltage reporter polypeptide of the invention comprises a mammalian-codon-optimized nucleic acid sequence, which may in some embodiments be a human-codon optimized nucleic acid sequence. In certain aspects of the invention, a polynucleotide that encodes a voltage reporter polypeptide comprises a zebrafish-codon-optimized nucleic acid sequence or sequence with codon optimization for another organism. Codon-optimized sequences can be prepared using routine methods.
Delivery of Voltage Detector Molecules
[0095] Delivery of a voltage reporter polypeptide or polynucleotide of the invention to a cell and/or expression of a voltage reporter polypeptide or of the invention in a cell can be done using art-known delivery means. [see for example, Chow et al. Nature 2010 Jan. 7; 463(7277):98-102; and for Adeno-associated virus injection: Betley, J. N. & Sternson, S. M. (2011) Hum. Gene Ther. 22, 669-677; for In utero electroporation: Saito, T. & Nakatsuji, N. (2001) Dev. Biol. 240, 237-46; for microinjection into zebrafish embryos: Rosen J. N. et al., (2009) J. Vis. Exp. (25), e1115, doi:10.3791/1115; and for DNA transfection for neuronal culture: Zeitelhofer, M. et al., (2007) Nature Protocols 2, 1692-1704, the content of each of which is incorporated by reference herein in its entirety].
[0096] In some embodiments of the invention a voltage reporter polypeptide of the invention is included in a fusion protein. It is well known in the art how to encode, prepare, and utilize fusion proteins that comprise a polypeptide sequence. In certain embodiments of the invention, a vector that encodes a fusion protein can be used to deliver a voltage reporter polypeptide, and optionally one more additional polypeptides, to a cell and can also in some embodiments be used to target delivery of a voltage reporter polypeptide of the invention to specific cells, cell types, tissues, or regions in a subject. Suitable targeting sequences useful to deliver a voltage reporter molecule of the invention to a cell, tissue, region of interest are known in the art. Delivery of a voltage reporter molecule of the invention to a cell, tissue, or region in a subject can be performed using art-known procedures. A fusion protein of the invention can be delivered to a cell by delivery of a vector encoding a fusion protein. The delivered fusion protein is then expressed in a specific cell type, tissue type, organ type, and/or region in a subject, or in vitro, for example in culture, in a slice preparation, etc. Preparation, delivery, and use of a fusion protein and its encoding nucleic acid sequences are well known in the art. Routine methods can be used in conjunction with teaching herein to express one or more voltage reporter polypeptides and optionally additional polypeptides, in a desired cell, tissue, or region in vitro or in a subject.
[0097] In certain aspects of the invention, a voltage reporter polypeptide of the invention that is non-toxic or substantially non-toxic to the cell into which it is delivered and/or expressed. In the absence of excitation light, a voltage reporter molecule of the invention does not significantly alter cell health or ongoing electrical activity in the cell in which it is expressed. In some embodiments of the invention, a voltage reporter molecule of the invention is genetically introduced into a cellular membrane, and reagents and methods are provided for genetically targeted expression of voltage reporter polypeptides. Genetic targeting can be used to deliver one or more voltage reporter polypeptides of the invention to specific cell types, to specific cell subtypes, to specific spatial regions within an organism, and to sub-cellular regions within a cell. In some embodiments of the invention, genetic targeting can be used to control of the amount of a voltage reporter polypeptide of the invention that is expressed and the timing of the expression. A fusion protein of the invention can be expressed in a specific cell type, tissue type, organ type, and/or region in a subject, or in vitro, for example in culture, in a slice preparation, etc. Preparation, delivery, and use of a fusion protein and its encoding nucleic acid sequences are well known in the art. Routine methods can be used in conjunction with teaching herein to express one or more voltage reporter polypeptides and optionally additional polypeptides, in a desired cell, tissue, or region in vitro or in a subject.
[0098] In some embodiments, a voltage reporter polypeptide of the invention is genetically introduced into a cellular membrane, and reagents and methods are provided herein for genetically targeted expression of voltage reporter polypeptides of the invention. Genetic targeting using trafficking or delivery polypeptides can be used to deliver a voltage reporter polypeptide of the invention to specific cell types, to specific cell subtypes, and to specific spatial regions within an organism. Routine genetic procedures can also be used to control parameters of expression, such as but not limited to: the amount of a voltage reporter polypeptide of the invention that is expressed, the timing of the expression, etc.
Vectors and Molecules
[0099] Some embodiments of the invention include a reagent for genetically targeted expression of a voltage reporter polypeptide, wherein the reagent comprises a vector that contains the gene for the voltage reporter polypeptide. As used herein, the term vector refers to a nucleic acid molecule capable of transporting between different genetic environments another nucleic acid to which it has been operatively linked. The term vector may also refer to a virus or organism that is capable of transporting the nucleic acid molecule. One type of vector is an episome, i.e., a nucleic acid molecule capable of extra-chromosomal replication. Some useful vectors are those capable of autonomous replication and/or expression of nucleic acids to which they are linked. Vectors capable of directing the expression of genes to which they are operatively linked are referred to herein as expression vectors. Other useful vectors, include, but are not limited to viruses such as lentiviruses, retroviruses, adenoviruses, and phages. Vectors useful in some methods of the invention can genetically insert a voltage reporter polypeptide of the invention into dividing and non-dividing cells and can insert a voltage reporter polypeptide of the invention into an in vivo, in vitro, or ex vivo cell.
[0100] Vectors useful in methods of the invention may include additional sequences including, but not limited to one or more signal sequences and/or promoter sequences, or a combination thereof. Expression vectors and methods of their use are well known in the art. Non-limiting examples of suitable expression vectors and methods for their use are provided herein. In certain embodiments of the invention, a vector may be a lentivirus comprising the gene for a voltage reporter polypeptide of the invention. A lentivirus is a non-limiting example of a vector that may be used to create stable cell line. The term cell line as used herein is an established cell culture that will continue to proliferate given the appropriate medium.
[0101] Promoters that may be used in methods and vectors of the invention include, but are not limited to, cell-specific promoters or general promoters. Methods for selecting and using cell-specific promoters and general promoters are well known in the art. A non-limiting example of a general purpose promoter that allows expression of a voltage reporter polypeptide in a wide variety of cell typesthus a promoter for a gene that is widely expressed in a variety of cell types, for example a housekeeping gene can be used to express a voltage reporter polypeptide of the invention in a variety of cell types. Non-limiting examples of general promoters are provided elsewhere herein and suitable alternative promoters are well known in the art. In certain embodiments of the invention, a promoter may be an inducible promoter, examples of which include, but are not limited to tetracycline-on or tetracycline-off, or tamoxifen-inducible Cre-ER.
[0102] In some embodiments of the invention a reagent for genetically targeted expression of a voltage reporter polypeptide of the invention is a vector that comprises a gene encoding a voltage reporter polypeptide of the invention, and optionally a gene encoding one or more additional polypeptides. Vectors useful in methods of the invention may include additional sequences including, but not limited to, one or more signal sequences and/or promoter sequences, or a combination thereof. In certain embodiments of the invention, a vector may be a lentivirus, adenovirus, adeno-associated virus, or other vector that comprises a gene encoding a voltage reporter polypeptide of the invention. An adeno-associated virus (AAV) such as AAV8, AAV1, AAV2, AAV4, AAV5, AAV9, are non-limiting examples of vectors that may be used to express a fusion protein of the invention in a cell and/or subject. Expression vectors and methods of their preparation and use are well known in the art. Non-limiting examples of suitable expression vectors and methods for their use are provided herein. Other vectors that may be used in certain embodiments of the invention are provided in the Examples section herein.
[0103] Promoters that may be used in methods and vectors of the invention include, but are not limited to, cell-specific promoters or general promoters. A non-limiting examples promoters that can be used in vectors of the invention are: ubiquitous promoters, such as, but not limited to: CMV, CAG, CBA, and EF1a promoters; and tissue-specific promoters, such as but not limited to: Synapsin, CamKIIa, GFAP, RPE, ALB, TBG, MBP, MCK, TNT, and aMHC promoters. Methods to select and use ubiquitous promoters and tissue-specific promoters are well known in the art. A non-limiting example of a tissue-specific promoter that can be used to express a voltage reporter polypeptide of the invention in a cell such as a neuron is a synapsin promoter, which can be used to express a voltage reporter polypeptide in certain embodiments of methods of the invention. Additional tissue-specific promoters and general promoters are well known in the art and, in addition to those provided herein, may be suitable for use in compositions and methods of the invention. Other non-limiting examples of promoters that may be used in certain embodiments of methods of the invention are provided in the Examples section. Molecules that can be administered and delivered to a cell, include, but are not limited to: opsin polypeptides, detectable label polypeptides, fluorescent polypeptides, additional trafficking polypeptides, etc.
[0104] Non-limiting examples of detectable label polypeptides that may be included in a composition comprising a voltage reporter polypeptide of the invention are: green fluorescent protein (GFP); enhanced green fluorescent protein (EGFP), red fluorescent protein (RFP); yellow fluorescent protein (YFP), dtTomato, mCardinal, mCherry, DsRed, cyan fluorescent protein (CFP); far red fluorescent proteins, etc. Numerous fluorescent proteins and their encoding nucleic acid sequences are known in the art and routine methods can be used to include such sequences in fusion proteins and vectors, respectively, of the invention.
[0105] Additional sequences that may be included in a fusion protein comprising a voltage reporter polypeptide of the invention are trafficking sequences, including, but not limited to: Kir2.1 sequences and functional variants thereof, KGC sequences, ER2 sequences, etc. Examples of trafficking polypeptides, which may also be referred to herein as export polypeptides, that may be used in certain embodiments of the invention include, but are not limited to: SEQ ID NOs: 20, 22, 24, 26, and 27. Examples of nucleic acid sequences that encode trafficking polypeptides that may be used in some embodiments of the invention include, but are not limited to: SEQ ID NOs: 19, 21, 23, and 25. Additional trafficking polypeptides and their encoding nucleic acid sequences are known in the art and routine methods can be used to include and use such sequences in fusion proteins and vectors, respectively, of the invention. In addition to trafficking motifs as KGC and ER2 sequences, the fluorescent protein tag may influence proper membranal localization of the opsin in cells. A non-limiting example comprises use of monomeric GFP-like fluorescent proteins with fluorescence spectrum complementary to that of Archon, i.e. fluorescent protein with emission wavelength shorter than 650 nm. A non-limiting example of a tag that may be used in certain embodiments of the invention are phiLOV2.1 and UnaG proteins, which are shorter than GFP-like fluorescence protein, and therefore save space in AAV vectors.
Imaging and Monitoring
[0106] According to principles of this invention, alterations in voltage in a cell can be detected and assessed by monitoring fluorescence emissions of a voltage reporter polypeptide of the invention that is expressed in the cell. Excitation of a fluorescent component of a voltage reporter polypeptide can be performed using methods described herein and other art-known methods. Monitoring emission of the fluorescent component of a voltage reporter polypeptide of the invention including identifying stability, increases, decreases, etc. can be done with routine methods known in the art and routinely used to detect fluorescent emission from fluorescent molecules, opsins, etc. In addition to methods provided herein, additional methods suitable to excite a fluorescent component of a voltage reporter polypeptide of the invention and for imaging fluorescent emissions of voltage reporter polypeptides of the invention are available in Light sheet see for example: Keller, P. J. et al., (2015) Nature Methods 12, 27-29; and two photon see for example: Yang et al, (2016) Cell, //dx.doi.org/10.1016/j.cell.2016.05.031, each of which is incorporated herein by reference in its entirety.
[0107] Certain aspects of the invention include use of imaging methods to monitor one or more characteristics of a cell, such as, but not limited to: electrical activity in a cell and ion flux across a cell membrane. Compositions and methods of the invention can be used in a cell and/or a subject as a means with which to image and/or monitor changes in voltage in a cell, changes in ion flux across a membrane of a cell, changes resulting from a disease or condition in a cell or subject, efficacy of a candidate agent to alter voltage in a cell, etc. In some aspects of the invention, methods and compounds are provided that can be used to image and detect an alteration or modulation in voltage. Methods for imaging and/or detecting fluorescence emissions in cells, tissues, and subjects are disclosed herein and are known in the art. Such methods are suitable for use in embodiments of the invention for imaging, determining, detecting, measuring, and comparing fluorescent emission of one or more voltage reporter polypeptides of the invention expressed in a cell and/or a subject. Additional non-limiting examples of imaging equipment and means that may be used in methods of the invention are provided in the Examples section herein.
Cells and Subjects
[0108] Some aspects of the invention include cells used in conjunction with one or more voltage reporter polypeptides of the invention and/or their encoding polynucleotides. Cells in which one or more voltage reporter polypeptides of the invention may be expressed, and that can be used in methods of the invention, include prokaryotic and eukaryotic cells. In certain embodiments of the invention, useful cells may be mammalian cells; including but not limited to cells of humans, non-human primates, dogs, cats, horses, fish, rodents, etc. In some embodiments of the invention, useful cells may be non-mammalian cells; including but not limited to insect cells, avian cells, fish cells, plant cells, etc. Cells in which a voltage reporter polypeptide of the invention may be expressed are non-excitable cells and excitable cells, the latter of which includes cells able to produce and respond to electrical signals. Examples of excitable cell types include, but are not limited, to neurons, muscles, visual system cells, sensory cells, auditory cells, cardiac cells, and secretory cells (such as pancreatic cells, adrenal medulla cells, pituitary cells, etc.).
[0109] Non-limiting examples of cells that may be used in methods of the invention include: neuronal cells, nervous system cells, cardiac cells, circulatory system cells, visual system cells, auditory system cells, secretory cells, endocrine cells, and muscle cells. In some embodiments, a cell used in conjunction with methods and voltage reporter molecules of the invention is a healthy normal cell, which is not known to have a disease, disorder, or abnormal condition. In some embodiments of the invention, a cell used in conjunction with methods and voltage reporter molecules of the invention may be a normal cell or an abnormal cell, for example, (1) a cell that has a disorder, disease, or condition; (2) a cell obtained from a subject that has, had, or is suspected of having disorder, disease, or condition; (3) a cell known to be or suspected of being involved in a disorder, disease, or condition; (4) a cell that is a model for a disorder, disease, or condition, etc. Non-limiting examples of such cells are: a degenerative cell, a neurological disease-bearing cell, a cell model of a disease or condition, an injured cell, a cell downstream from a disease-bearing or injured cell, etc. In some embodiments of the invention, a cell may be a control cell. A cell that is directly or indirectly upstream from a cell in which a voltage reporter polypeptide is expressed may be a normal cell, or an abnormal cell.
[0110] One or more voltage reporter polypeptides of the invention may be expressed in cells from or in culture, cells in solution, cells obtained from subjects, and/or cells in a subject (in vivo cells). One or more voltage reporter polypeptides of the invention may be expressed and monitored in cultured cells, cultured tissues (e.g., brain slice preparations, etc.), and in living subjects, etc. As used herein, a the term subject may refer to a human, non-human primate, cow, horse, pig, sheep, goat, dog, cat, bird, rodent, fish, insect, or other vertebrate or invertebrate organism. In certain embodiments, a subject is a mammal and in certain embodiments a subject is a human. Additional non-limiting examples of cell types that may be used in certain methods of the invention are provided in the Examples section, as are non-limiting examples of organisms that may subjected to certain methods of the invention.
[0111] A cell in which a voltage reporter polypeptide of the invention is expressed may be a single cell, an isolated cell, a cell in culture, an in vitro cell, an in vivo cell, an ex vivo cell, a cell in a tissue, a cell in a subject, a cell in an organ, a cell in a cultured tissue, a cell in a neural network, a cell in a brain slice, a neuron, a cell that is one of a plurality of cells, a cell that is one in a network of two or more interconnected cells, a cell in communication with another cell, a cell that is one of two or more cells that are in physical contact with each other, etc.
Controls
[0112] Voltage reporter polypeptides of the invention and methods of using such voltage reporter polypeptides can be utilized to assess changes in cells, tissues, and subjects in which they are expressed. Some embodiments of the invention include use of voltage reporter polypeptides of the invention to identify effects of candidate compounds on cells, tissues, and subjects. Results of testing a voltage reporter polypeptide of the invention can be advantageously compared to a control. In some embodiments of the invention one or more voltage reporter polypeptides of the invention, may be expressed in a cell population and used to test the effect of candidate compounds on the cells. A test cell, membrane, tissue, or organism may be a cell, tissue, or organism in which activity of a voltage reporter polypeptide of the invention can be tested or assayed. Results obtained using assays and tests of a test cell, membrane, tissue, or organism may be compared results obtained from the assays and tests performed in other test cells, membranes, tissues or organisms or assays and tests performed in control cells, membranes, tissues, or organisms.
[0113] As used herein a control value may be a predetermined value, which can take a variety of forms. It can be a single cut-off value, such as a median or mean. It can be established based upon comparative groups, such as cells or tissues that include the voltage reporter polypeptides that is under essentially the same conditions of test cells but are not contacted with a candidate compound. Another non-limiting example of a comparative group includes cells or tissues that have a disorder or condition and groups without the disorder or condition. Another non-limiting example of comparative group includes cells or tissues in which a voltage reporter polypeptides that is not a voltage reporter polypeptide of the invention (for example Arch, Archer1, Archer2, etc.) is expressed. In some embodiments of the invention, a control may be characteristics such as brightness, speed of response, photobleaching level, etc. that are determined in reporter polypeptide such as Arch, Archer1, Archer2, Arch-7, QuasAr1, and QuasAr2, QuasAr-I#3, QuasAr-I#7, QuasAr-I#14, QuasAr-I#16, and QuasAr-I#22. Another non-limiting example of comparative group includes cells from a subject or subjects with a family history of a disease or condition and cells from a subject or subjects without such a family history. A predetermined value can be arranged, for example, where a tested population is divided equally (or unequally) into groups based on results of testing. Those skilled in the art are able to select appropriate control groups and values for use in comparative methods of the invention.
Administration Means
[0114] Administration of a voltage reporter molecule of the invention may include, but are not limited to: administering to a cell or subject a composition that includes a vector comprising a polynucleotide sequence that encodes a voltage reporter polypeptide, administering to a cell or subject a composition comprising a voltage reporter polypeptide, and administering to a subject a cell in which a voltage reporter molecule is expressed. A composition of the invention optionally includes a carrier, which may be a pharmaceutically acceptable carrier.
[0115] A voltage reporter molecule (polypeptide or encoding polynucleotide) of the invention may be administered to a cell and/or subject in a formulation, which may be administered in pharmaceutically acceptable solutions, which may routinely contain pharmaceutically acceptable concentrations of salt, buffering agents, preservatives, compatible carriers, adjuvants, and optionally additional ingredients. In some aspects, a pharmaceutical composition comprises a voltage reporter molecule of the invention and a pharmaceutically-acceptable carrier. Pharmaceutically acceptable carriers are well known to the skilled artisan and may be selected and utilized using routine methods. As used herein, a pharmaceutically acceptable carrier means a non-toxic material that does not interfere with the effectiveness of the biological activity of the active ingredients. Pharmaceutically acceptable carriers may include diluents, fillers, salts, buffers, stabilizers, solubilizers, and other materials that are well-known in the art. Exemplary pharmaceutically acceptable carriers are described in U.S. Pat. No. 5,211,657 and others are known by those in the art.
[0116] An effective amount of a voltage reporter molecule of the invention is an amount that increases the level of the voltage reporter polypeptide expressed in a cell, tissue, or subject to a level that is suitable for use in a method of the invention. The amount of active voltage reporter molecule of the invention may be varied, for example, by increasing or decreasing the amount of the voltage reporter molecule that is administered, by changing the delivery composition in which the voltage reporter molecule is administered, by changing the route of administration, by changing the amount delivered, by changing elements that control timing of expression, and so on. The amount of a voltage reporter molecule administered will vary with the particular cell environment, location of the cell in which the voltage reporter molecule is to be expressed, the administration of other voltage reporter molecules of the invention, the nature of the testing parameters, the specific route of administration, and other factors within the knowledge and expertise of the practitioner. For example, the amount administered may depend upon the location and number of cells in the tissue and/or subject in which the voltage reporter polypeptide is to be expressed. An amount administered may also depend on the location of the tissue in which expression is to take place. Compositions used to deliver voltage reporter molecule of the invention may be administered alone, in combination with each other, and/or in combination with other agents and compositions. A composition used in an embodiment of the invention, may result in delivery of an amount of a voltage reporter molecule of the invention for use in a desired method.
[0117] The terms administrate and administer when used herein to describe an action that results in a voltage reporter polypeptide of the invention being present in a cell, is intended to encompass delivery of a voltage reporter polypeptide of the invention into the cell (for example, though not intended to be limiting, in the form of a fusion protein), and delivery of a polynucleotide sequence that encodes a voltage reporter polypeptide of the invention, which is subsequently expressed in the cell. A voltage reporter polypeptide of the invention may be administered using art-known methods. In some embodiments a polynucleotide that encodes a voltage reporter polypeptide of the invention is administered to a cell and/or subject and in certain embodiments a voltage reporter polypeptide is administered to a cell and/or a subject. The manner and amount of a voltage reporter molecule of the invention that is administered to a cell and/or subject may be adjusted by the individual practitioner. The absolute amount administered will depend upon a variety of factors, including the material selected for administration, whether the administration is in a single delivery or multiple deliveries, and individual subject parameters including age, physical condition, size, weight, and the stage of a disease or condition, test parameters to be followed, etc. These factors can be addressed with no more than routine experimentation.
[0118] The amount of a composition that is administered to a cell or subject to increase the level of a voltage reporter polypeptide of the invention to a cell and/or a subject can be chosen in accordance with different parameters such as the desired period of monitoring, the number of events to be monitored, etc. In the event that the amount administered to a cell or subject is insufficient at the initial amount administered, higher amounts (or effectively higher amounts by a different, more localized delivery route) may be employed to the extent that cell and subject tolerance permits. The amount and timing of expression and excitation of a voltage reporter polypeptide of the invention (e.g., by adjusting light wavelength, length of light contact, promoters, trafficking polypeptides, etc.) that has been administered to a cell and/or subject can also be adjusted based on the ability to perform desired monitoring methods in a particular cell type or subject. Parameters for illumination and excitation of a voltage reporter polypeptide of the invention that has been administered to a subject can be determined using art-known methods and without requiring undue experimentation.
[0119] Various modes of administration will be known to one of ordinary skill in the art that can be used to effectively deliver a composition to increase the level of a voltage reporter polypeptide of the invention in a desired cell, tissue, cell of a subject, organ of a subject, or region of a subject. Methods for administering a composition comprising a voltage reporter molecule of the invention may include, but is not limited to: injection, microinjection, perfusion, electroporation, or other suitable means. The invention is not limited by the particular modes of administration disclosed herein and additional art-known delivery means may be suitable for administration of voltage reporter molecules of the invention.
[0120] Other protocols suitable for administration of a voltage reporter molecule of the invention are known to those in the art. Embodiments of methods of the invention to administer a cell or vector to increase a level of a voltage reporter molecule of the invention in an animal other than a human; and administration and use of a voltage reporter molecule of the invention for testing purposes or veterinary purposes, are substantially the same as described above. It will be understood by a skilled artisan that this invention is applicable to both human and animals.
Assessment Methods
[0121] Disorders, conditions, and events that may be assessed using methods of the invention to express a voltage reporter polypeptide of the invention in a cell, tissue, and/or subject may include, but are not limited to: injury, brain damage, spinal cord injury, epilepsy, metabolic disorders, cardiac dysfunction, vision loss, blindness, deafness, hearing loss, and neurological conditions (e.g., Parkinson's disease, Alzheimer's disease, seizure), degenerative neurological conditions, drug contact, toxins, etc. In some embodiments of the invention, a disorder or condition may be monitored by expressing a voltage reporter polypeptide of the invention in at least one cell and contacting the at least one cell with a wavelength of light suitable to excite the fluorescent portion of the reporter, and monitoring for changes in the fluorescent emission of the reporter. In some embodiments of the invention, such methods can be used in methods such as, but not limited to, assessing therapeutic agents and treatments, assessing putative therapeutic agents and treatments, expanding understanding of connectivity between cells, and exploring voltage activity patterns in a cell or cells.
[0122] A voltage reporter polypeptide of the invention may be targeted to cells and membranes, and to monitor voltage-associated cell activities. Some embodiments of the invention comprise expressing a voltage reporter polypeptide in a cell and monitoring fluorescence emitted from the voltage reporter polypeptide to assess changes in voltage, action potential initiation, and synaptic transmission, etc.
[0123] The present invention in some aspects, includes one or more of preparing nucleic acid sequences that encode voltage reporter polypeptide of the invention, expressing in cells and membranes voltage reporter polypeptides encoded by the prepared nucleic acid sequences; illuminating the cells and/or membranes with suitable light to excite the voltage reporter polypeptide, and monitoring changes in voltage in the cell by assessing changes in fluorescence emission from the voltage reporter polypeptide. The ability to specifically, consistently, reproducibly, and sensitively monitor changes in voltage across membranes, in cells, and in subjects has been demonstrated. The present invention enables monitoring of voltage changes in in vivo, ex vivo, and in vitro, and the voltage reporter polypeptides of the invention and their use, have broad-ranging applications for drug screening, disease assessment, treatment assessment, and research applications, some of which are describe herein.
EXAMPLES
Example 1
Methods
Molecular Cloning and Mutagenesis.
[0124] The Ace2N-4aa-mNeon, Archer1-KGC-EGFP-ER2 and Quasar2-mOrange-KGC-ER2 genes were synthesized de novo by GenScript, based on the sequences reported in the original publications [Hochbaum, D. R. et al. (2014) Nat. Methods 1-34 doi:10.1038/nmeth.3000; Flytzanis, N. C. et al. (2014) Nat. Commun. 5, 4894; and Gong, Y. et al. (2015) Sciencexpress 350, 1-11]. Plasmids encoding mIFP, iRFP670, iRFP682, iRFP702, iRFP and iRFP720 were acquired from Addgene. The RpBphP1/PAS-GAF domains and QuasAr2-ER2 genes were synthesized de novo (Genscript) with mammalian codon optimization and subcloned into pN1 vector (Clontech) using Agel/NotI sites. Synthetic DNA oligonucleotides used for cloning were purchased from Integrated DNA Technologies. PrimeStar Max mastermix (Clontech) was used for high-fidelity PCR amplifications. Restriction endonucleases were purchased from New England BioLabs and used according to the manufacturer's protocols. Ligations were performed using T4 DNA ligase (Fermentas) or InFusion HD kit (Clontech). Small-scale isolation of plasmid DNA was performed with Mini-Prep kit (Qiagen); large-scale DNA plasmid purification was done with GenElute HP Endotoxin-Free Plasmid Maxiprep Kit (Sigma-Aldrich). Random mutagenesis was performed with a GeneMorph II Random Mutagenesis Kit (Stratagene), using conditions that resulted in the mutation frequency of up to 15 mutations per 1,000 base pairs. The QuasAr2 random library with mutation frequency of 10-15 mutations per 1,000 base pairs was prepared by GenScript. Site-directed focused library of the Arch mutants were synthesized de novo as a gBlock (EpochLifescience), amplified with corresponding primers using PCR and subcloned into the pN1 vector. Obtained gene libraries in expression vectors were electroporated into the NEB 10-beta E. coli host cells (New England BioLabs). Serial dilutions (10.sup.4 and 10.sup.5) of the electroporated cells were plated on LB/agar medium supplemented with 100 mg.Math.mL-1 of kanamycin to estimate the electroporation efficiency. The remainder of cells was grown overnight in LB medium supplemented with 100 mg/mL of kanamycin for subsequent plasmid DNA isolation.
[0125] To express voltage sensors in primary hippocampal neurons, the corresponding genes were PCR amplified and swapped with the ArchT-GFP gene in pAAV-CaMKIIa-ArchT-GFP plasmid (Addgene plasmid #37807) using BamHI and EcoRI sites. For in vivo expression in mouse brain the Archon1/2-KGC-EGFP-ER2 constructs were cloned into pCAG-WPRE vector using KpnI and BsrGI sites. For transient expression in zebrafish larvae, expression vector were designed by cloning the 4 non-repetitive upstream activating sequences (4nrUAS) as previously described [Subedi, A. et al. (2014) Methods 66, 433-440] together with a beta actin core minimal promoter followed by the 1.2 kb long 3UTR sequence of Danio rerio synaptotagmin IIa (syt2a). The expression cassette was flanked by Tol2 transposon ends. The Archon-KGC-EGFP-ER2 and miRFP genes were codon-optimized for expression in zebrafish using the online resource at www.bioinformatics.org/, synthesized de novo and cloned into the designed pTol2-4nrUAS vector using SpeI and AscI sites. For expression in C. elegans codon-optimized fusion of Archon1 to EGFP (codon optimization was done using the online resource at www.bioinformatics.org/) was subcloned into a pSM vector backbone using KpnI and SacI, and the rig-3 promoter was inserted upstream using FseI and AscI sites.
Protein Characterization In Vitro.
[0126] Protein expression and purification were performed as described previously [Piatkevich, K. D., et al., (2013) Nature Communications, 4, [2153]. doi:10.1038/ncomms3153] with few modifications. The pBAD/HisB vectors (Life Technologies/Invitrogen) encoding iRFP670, iRFP682, iRFP702, iRFP, iRFP720 and miRFP were co-transformed with pWA23h plasmid, encoding heme oxygenasel from Bradyrhizobium ORS278 (hmuO) under the rhamnose promoter, into BW25113 E. coli strain (CGSC#7636 in The Coli Genetic Stock Center). Bacterial cells were grown in RM medium supplemented with ampicillin, kanamycin, 0.002% arabinose, 0.02% rhamnose for 15-18 h at 37 C. and then for 24 h at 18 C. Proteins were purified using TALON Metal Affinity Resin (Clontech) according to the manufacturer's protocol with one minor modification: in the wash buffer, 100 mM EDTA was used instead of 400 mM imidazole. The fluorescence spectra were measured using a Fluorolog 3 spectrofluorometer (Jobin Yvon) and a plate reader SpectraMax-M5 (Molecular Devices). For absorbance measurements, a Lambda 35 UV/Vis spectrometer (Perkin Elmer) was used. Background light scattering was removed by subtracting a fitted X-4 curve from the measured spectrum. For determination of quantum yield, fluorescence signal of purified proteins was compared with that of the equally absorbing iRFP. To determine the extinction coefficient, the absorbance value for the protein at the main peak centered in red part of the spectrum was compared with the absorbance value of short wavelength peak centered at 370-390 nm assuming the latter to have the extinction coefficient of the free biliverdin IX, which is 39,900 M.sup.1 cm.sup.1 [Filonov, G. S. et al. (2011) Nat. Biotechnol. 29, 757-761]. pH titrations were done using a series of commercially available pH buffers (HYDRION).
[0127] Size exclusion chromatography was performed by GenScript on Superdex 200 10/300 GL column (GE Healthcare Life Sciences) using a gel filtration standard (#1511901; BIO-RAD). Two-photon absorption (2PA) spectra and cross sections of the proteins were measured in PBS buffer, pH=7.4 at concentrations 1-5 10-5 M in 1 mm glass spectroscopy cuvettes (Starna cells) using femtosecond fluorescence, similar to that described in: Tsai, P. S. et al. (2002) In: In Vivo Optical Imaging of Brain Function, Chapter: 6, Publisher: CRC Press, Editors: Ron D. Frostig, pp. 113-171. In particular, two-photon excitation (TPE) spectra were collected using an MOM Sutter Instrument two-photon fluorescent microscope coupled with an Insight DeepSee (Newport) femtosecond laser tunable from 680 to 1300 nm. A Plan NeoFluar 2.5/0.075 Zeiss objective was used to excite and collect fluorescence which was passed through a HQ705/100 filter (Chroma) before reaching the PMT. To correct the TPE spectra for the wavelength-to-wavelength variations of laser properties (pulse duration and beam shape), Styryl 9M (Aldrich) in chloroform was used as a reference standard [Makarov, N. S., et al., (2008) Opt. Express 16, 4029-4047]. The TPE fluorescence had quadratic dependence on excitation power in the whole spectral range presented in
Gene Library Transfection.
[0128] Conventional calcium phosphate transfection was modified to deliver a small number of plasmids per single cell to enable efficient single cell phenotyping and genotyping (see Results). HEK293FT cells were selected as an expression host due to the several reasons: i) they are suitable for calcium phosphate transfection; ii) they are widely regarded as high expressors for a variety of protein payloads; iii) they are known to have the lowest mutation rate among commonly used mammalian cell lines towards exogenous DNA [Lebkowski, J. S., et al., (1984) Mol. Cell. Biol. 4, 1951-1960]; iv) they are robust and easy to work with. Cells were authenticated by the manufacturer and tested for mycoplasma contamination to their standard levels of stringency and were here used because they are common cell lines for testing new tools. The expression vector used was the commercially available pN1 plasmid (Clontech) which can be replicated in HEK293FT cells due to the SV40 ori of replication [Mahon, M. J. (2011) Biotechniques 51, 119-126]. The replication of plasmids enables a higher level of protein expression upon single copy plasmid delivery, facilitating optical detection of recombinant protein. The CMV promoter was used to drive expression of target genes because it is known to be the strongest promoter among those commonly used in HEK293 cells [Qin, J. Y. et al. (2010) PloS One, 5, 3-6 doi.org/10.1371/journal.pone.0010611].
[0129] HEK293FT cells (Invitrogen) were maintained between 10% and 70%.sup.0 confluence at 37 C. with 5% CO.sub.2 in DMEM medium (Cellgro) supplemented with 10% heat inactivated FBS (Corning), 1%0/penicillin/streptomycin (Cellgro), and 1% sodium pyruvate (BioWhittaker). Transfection of HEK293FT cells with gene libraries was performed using a commercially available calcium phosphate transfection kit (LifeTechnologies) according to the manufacturer's protocol with minor modifications as follows. HEK293FT cells from the exponential growth phase were seeded at a density to be approximately 70% confluent on the day of transfection. Culture medium was replaced with fresh medium 30-60 minutes before adding DNA-CaPhos co-precipitate to make medium of pH 7.4. 2CaCl.sub.2/DNA solution was added quickly to an equal volume of 2HBS solution at room temperature, mixed gently for 20-30 sec by pipetting up and down, and added dropwise to cell culture. Culture medium was carefully replaced with fresh medium 24 hours after transfection. The empty pUC19 plasmid was used as dummy DNA to keep the total amount of DNA constant for all transfection conditions to avoid variations in DNA-CaPhos co-precipitate formation [Chen, C. & Okayama, H. (1987) Molecular and Cellular Biology, 7, 2745-2752; Okazaki, M., et al., (2001) Biomaterials vol. 22, Issue 18:2459-2464].
FACS Screening.
[0130] To sort the gene library transfected HEK293FT cells using flow cytometry, cells were harvested from a culture dish 48 h after gene library transfection by applying trypsin for 5-10 mins (Cellgro) and washed twice by centrifuging the cell suspension for 5 minutes at 500 rpm and re-suspending cells in PBS (Cellgro). The washed cells were then re-suspended in PBS supplemented with 4% FBS (Corning) and 10 mM EDTA at density 1-2.10.sup.6 cells/ml and filtered through a 30 m filter (Falcon) to prevent clogging on the FACS machine. The filtered cells were sorted by FACSAria (BD Biosciences) running BDFACS Diva software and equipped with standard 405, 488, 561 and 640 nm solid-state lasers. Debris, dead cells and cell aggregates were gated out before desired fluorescence signals were detected. For screening RpBphP1/PAS-GAF libraries, excitation at 640 nm and emission at 670/30 nm and 710/50 nm were used; for QuasAr2 libraries excitation was at 640 nm and emission was at 710/50 nm (see Table 1 for details). Approximately 1.5 times more cells than the size of each library were screened per FACS sorting session and 10-100k cells exhibiting higher fluorescent intensity than that of positive control (HEK293FT cells transfected with a plasmid encoding template protein) were collected in a 5 ml tube. Collected cells were plated on a 3 cm cell culture dish coated with Matrigel (BD Biosciences) for further screening and sorting using the custom cell picker (as described below).
TABLE-US-00002 TABLE 1 Screening conditions for monomeric near-infrared FPs and Arch-based voltage sensors Library size Template (independent FACS enrichment.sup.a protein Mutagenesis clones) Channel 1 Channel 2 Imaging conditions RpBphP1 Site-directed 1.29 .Math. 10.sup.6 Ex: 640 nm; Ex: 640 nm; 10x 0.3NA; Em: 670/30BP Em: 710/50BP Ex: 628/31BP; Em: 716/40BP Random 1.26 .Math. 10.sup.6 10x 0.3NA; Ex: 628/31BP; Em: 716/40BP Random 4.32 .Math. 10.sup.6 10x 0.3NA; Ex: 628/31BP; Em: 664LP QuasAr2 Random 1.6 .Math. 10.sup.6 Ex: 640 nm; Ex: 640 nm; 10x 0.3NA/40x 0.75NA.sup.b; Em: 670/30BP Em: 710/50BP Ex: 628/31BP; Em: 664LP Site-directed 8.1 .Math. 10.sup.6 10x 0.3NA/40x 0.75NA.sup.b; Ex: 628/31BP; Em: 664LP .sup.aCells showing positive signals in the indicated channels were collected, see FIG. 1A for details. .sup.bObjective lens used for protein localization screening. Exexcitation wavelength; Ememission wavelength, BPbandpass; LPlongpass.
Multi-Parameter Screening and Single Cell Isolation Using Cell Picker.
[0131] After 24 hour incubation of collected cells in a culture dish, the cell medium was gently replaced with fresh media to remove non-attached cells. Attached cells in the dish were then subjected to microscope-guided cell screening using our single cell manipulation system (CellSorter, CellSorter INC), controlled by CellSorter4.0 software [Kornyei, Z. et al. (2013) Sci. Rep. 3, 1088]. The cell sorter consisted of a pulled glass micropipette with an opening of 50 m in diameter, a motorized micromanipulator (Marzhauser SM 3.25), and a pressure controller that manipulates the pressure inside the micropipette. Both the micromanipulator and pressure controller were operated by the CellSorter4.0 software. The cell sorter was installed on an inverted microscope (Nikon Eclipse Ti equipped with 10NA 0.3, 20 and 40 objective lenses, a SPECTRA-X light engine (Lumencor) with 390/22 nm, 438/24 nm, 475/28 nm, 510/25 nm, 585/29 nm, and 631/28 nm exciters (Semrock), a 5.5 Zyla camera (Andor), and automated stage (Ludl), controlled by NIS-Elements AR software to obtain fluorescent images of entire population of cells in culture dish. To isolate cells with desired properties (e.g. high fluorescence intensity, exclusive plasma membrane localization) from a petri dish, the workflow of cell picking described in
Target Gene Recovery.
[0132] Cells individually collected in PCR tubes by the cell picker were subjected to whole genome amplification using a commercially available whole genomic amplification kit (WGA, New England BioLabs) followed by PCR amplification using corresponding primers. Amplicons with a size corresponding to that of the target gene were purified by agarose gel electrophoresis and cloned into an expression vector, and the purified plasmids were individually transfected and expressed in HEK cells for assessing desired characteristics of each gene.
Protein Characterization in Mammalian Cells.
[0133] HEK293FT (Invitrogen) and HeLa (ATCC CCL-2) cells were maintained between 10% and 70% confluence at 37 C. with 5% CO.sub.2 in DMEM medium (Cellgro) supplemented with 10% heat inactivated FBS (Corning), 1% penicillin/streptomycin (Cellgro), and 1% sodium pyruvate (BioWhittaker). Cells were authenticated by the manufacturer and tested for mycoplasma contamination to their standard levels of stringency and were used because they are common cell lines for testing new tools. HeLa cells were used simply as a testbed for protein expression, and not for any reasons of investigating the properties of HeLa cells in their own right. HEK293FT and HeLa cells were transiently transfected using TransIT-X2 (Mirus Bio LLC) according to the manufacturer's protocol and analyzed 48 h after transfection. Cells were imaged using a Nikon Eclipse Ti inverted microscope equipped with a SPECTRA X light engine (Lumencor) with 475/28 nm and 631/28 nm exciters (Semrock), a 5.5 Zyla camera (Andor), controlled by NIS-Elements AR software using 10NA 0.3 (
Induced Transmembrane Voltage (IT) in HEK Cells.
[0134] To screen for voltage sensitivity, HEK293FT cells expressing mutants selected with the cell picker were subjected to a reproducible electric field between two platinum electrodes as described previously [Hochbaum, D. R. et al. (2014) Nat. Methods 1-34 doi:10. 1038/nmeth.3000; Pucihar, G., et al., (2009) J. Vis. Exp. 88, 4-6]. In brief, HEK293FT cells were plated on 24 well plates and transfected with 500 ng of target plasmid DNA per well using TransIT-X2 (Mirus Bio LLC) following the manufacturer's protocol. Cell imaging was performed on the inverted Eclipse Ti-E (Nikon) equipped with a CMOS camera (Zyla5.5, Andor), LEDs (Spectra, Lumencor), a 637 nm Laser (637 LX, OBIS) focused on the back focal plane of 40NA 1.15 objective (Nikon), and filter set with 664LP (emission) and 650 nm (dichroic) (Semrock). The pair of platinum electrodes, with a gap of 4 mm, and mounted on an automated micromanipulator, was sequentially placed in the wells, and trains of electrical pulses (80V/cm, 50 ms, 2 Hz) generated by a DG2041A Arbitrary Waveform Function Generator (RIGOL) and amplified with a high voltage amplifier (Model 2205, Trek) were applied across the cell culture to induce changes in the membrane voltage. Fluorescent images were recorded at 200 Hz frame rate in 22 binning mode for 20 s. Whole-cell electrophysiology and fluorescence recording in HEK cells. Voltage sensitive variants selected from the ITV screening were subjected to whole-cell electrophysiology in HEK293FT cells. To evaluate voltage reporter candidates, HEK293FT cells were transfected with 100 ng of target plasmid DNA using the calcium phosphate protocol described above. 24 hours post transfection, HEK293FT cells were re-plated on round coverslips (0.15 mm thick, 25 mm in diameter, coated with 2% growth factor reduced Matrigel in DMEM for 1 h at 37 C.) at a density of 20,000 cells per well in a 24-well plate and incubated for a day at 37 C. Whole-cell patch clamp recording was performed between 48 and 72 h post transfection in artificial extracellular solution (Tyrode's solution) consisting of (in mM) 125 NaCl, 2 KCl, 3 CaCl.sub.2, 1 MgCl.sub.2, 10 HEPES, 30 glucose, pH7.3 (NaOH adjusted) at 320 mOsm; the intracellular solution consisting of (in mM) 135 K-gluconate, 8 NaCl, 10 HEPES, 4 Mg-ATP, 0.4 Na-GTP, 0.6 MgCl.sub.2, 0.1 CaCl.sub.2), pH 7.25 (KOH adjusted) at 295 mOsm. A gap-junction blocker, 2-aminoethoxydiphenyl borate (50 M, Sigma), was added to eliminate electrical coupling between cells. All-trans-retinal was not supplemented for any HEK cell recordings. Borosilicate glass pipettes (WPI) with an outer diameter 1 mm and a wall thickness of 0.2 mm were pulled using a Flaming/Brown micropipette puller (P-97, Sutter Instrument) to obtain a tip resistance of 3-10 M. Pipettes were positioned by a Sutter MP285 manipulator during whole-cell patching. To ensure accurate measurements, data was acquired from HEK293FT cells with access resistance <15 M, having reversal potentials between 10 and 40 mV, membrane resistance >0.3 G, and holding current within 100 pA. For
Primary Neuron Culture and Transfection.
[0135] All procedures involving animals at MIT were conducted in accordance with the US National Institutes of Health Guide for the Care and Use of Laboratory Animals and approved by the Massachusetts Institute of Technology Committee on Animal Care. Hippocampal neurons were prepared from postnatal day 0 or 1 Swiss Webster (Taconic) mice (both male and female mice were used) as previously described [Klapoetke, N. C. et al. (2014) Nat. Methods 11, 338-46; Chow, B. Y. et al. (2010) Nature 463, 98-102] with the following modifications: dissected hippocampal tissue was digested with 50 units of papain (Worthington Biochem) for 6-8 min, and the digestion was stopped with ovomucoid trypsin inhibitor (Worthington Biochem). Cells were plated at a density of 20,000-30,000 per glass coverslip coated with Matrigel (BD Biosciences). Neurons were seeded in 100l plating medium containing MEM (Life Technologies), glucose (33 mM, Sigma), transferrin (0.01%, Sigma), Hepes (10 mM, Sigma), Glutagro (2 mM, Corning), Insulin (0.13%, Millipore), B27 supplement (2%, Gibco), heat inactivated FBS (7.5%, Corning). After cell adhesion, additional plating medium was added. AraC (0.002 mM, Sigma) was added when glia density was 50-70% of confluent. Neurons were grown at 37 C. and 5% CO.sub.2 in a humidified atmosphere.
[0136] Cultured neurons were transfected at 4-5 days in vitro (DIV) with a commercial calcium phosphate transfection kit (Life Technologies) as previously described [Klapoetke, N. C. et al. (2014) Nat. Methods 11, 338-46]. Briefly, 500 ng of plasmid DNA per well was used for transfection followed by an additional washing with acidic MEM buffer (pH 6.7-6.8) after 30-60 min of calcium phosphate precipitate incubation to remove residual precipitates [Jiang, M. & Chen, G. (2006) Nat Protoc 1: 695-700]. All measurements on neurons were taken between DIV 14 and 18 DIV (9-14 d post transfection) to allow for sodium channel maturation. No all-trans-retinal was supplemented for any cultured neuron recordings.
Fluorescence Microscopy of Primary Neurons.
[0137] Fluorescent imaging of voltage sensors expressed in cultured hippocampal neurons for
[0138] Electrophysiology in primary hippocampal neurons. Whole-cell patch clamp recordings of cultured neurons for
[0139] In utero electroporation. Embryonic day (E) 15.5 timed-pregnant female C57BL/6 and CD1 (Charles River; for
Acute Brain Slice Preparation.
[0140] Acute brain sections were obtained from C57BL/6 and CD1 (Charles River) mice at P20-P30, using standard techniques. Mice were used without regard for sex. No statistical methods were used to estimate sample size for animal studies throughout. No randomization or blinding were used for animal studies throughout. Mice were anaesthetized by isoflurane inhalation and perfused transcardially with ice-cold artificial cerebrospinal fluid (ACSF) containing (in mM) 125 NaCl, 2.5 KCl, 25 NaHCO.sub.3, 2 CaCl.sub.2, 1 MgCl.sub.2, 1.25 NaH.sub.2PO.sub.4 and 11 glucose (295 mOsm/kg). Cerebral hemispheres were removed, placed in cold choline-based cutting solution (consisting of (in mM): 110 choline chloride, 25 NaHCO.sub.3, 2.5 KCl, 7 MgCl.sub.2, 0.5 CaCl.sub.2, 1.25 NaH.sub.2PO.sub.4, 25 glucose, 11.6 ascorbic acid, and 3.1 pyruvic acid), blocked and transferred into a slicing chamber containing ice-cold choline-based cutting solution. Coronal slices (300 m thick) were cut with a Leica VT1000 s vibratome, transferred to a holding chamber containing ACSF, and recovered for 30 min at 34 C., followed by another 30 min at room temperature. Slices were subsequently maintained at room temperature until use. Both cutting solution and ACSF were constantly bubbled with 95% 02/5% CO.sub.2.
Electrophysiology and Voltage Imaging in Acute Brain Slice
[0141] Individual slices were transferred to a recording chamber mounted on an upright microscope (Olympus BX51WI, see below herein) and continuously superfused (2-3 ml/min) with ACSF warmed to 32 C. by passing it through a feedback-controlled in-line heater (SH-27B; Warner Instruments). Cells were visualized through a 60 water-immersion objective with either infrared differential interference contrast (DIC) optics, or epifluorescence to identify GFP-positive cells. Whole-cell voltage- and current-clamp recordings were obtained from GFP-positive pyramidal neurons in layer of motor cortex, using patch pipettes (tip resistance 2.2-3.5 M) pulled from borosilicate glass (G150F-3, Warner Instruments). For current-clamp recordings the pipette solution consisted of in (mM): 130 K-gluconate, 10 KCl, 4 NaCl, 10 HEPES, 4 Mg.sub.2-ATP, 0.3 Tris-GTP, 14 Tris-phosphocreatine (290 mOsm/l; pH 7.28 adjusted with KOH), and for voltage-clamp recordings a cesium-based pipette solution was used (135 CsMeSO.sub.3, 1 EGTA(CsOH), 10 HEPES, 3.3 QX-314(Cl), 4 Mg.sub.2-ATP, 0.3 Na-GTP, Na.sub.2-phosphocreatine; 295 mOsm/l; pH 7.35 adjusted with CsOH). For 2-photon imaging of recorded cells 20 M AlexaFluor594 was added to the respective internal solution. Voltage-clamp recordings were performed in the presence of tetrodotoxin (TTX, 0.5 M) and cadmium (50 M). EPSPs were evoked by positioning a tungsten bipolar electrode (FHC) in layer 5, and delivering a train of 5 pulses (0.1 ms, 1 Hz). Individual trials were separated by >30 s. Stimulation strength was adjusted to evoke sub-threshold EPSPs, and only cells in which clean, short-latency EPSPs could be evoked were used for voltage imaging.
[0142] Archon fluorescence was excited via a red laser (637 nm, 140 mW, Coherent Obis 637-140 LX), which was focused onto the back focal plane of the objective (Olympus LUMFL N 60/1.10 W). Neutral density filters were used such that the power recorded after the objective was 7 mW. The laser spot was 25 m in diameter at the sample plane; the resulting intensity was 15 W/mm.sup.2. Fluorescence was collected through the same objective, passed through a 705/100 nm emission filter, and imaged onto an EMCCD camera (Andor iXON Ultra 888) at 1000 frames/s. In order to acquire images at this frame rate, the EMCCD region of interest was restricted to a 99300 pixel window (binned 33), and individual sweeps were no longer than s. Membrane currents and potentials were amplified and low-pass filtered at 3 kHz using a Multiclamp 700B amplifier (Molecular Devices), digitized at 10 kHz and acquired using National Instruments acquisition boards and a custom version of ScanImage written in MATLAB (Mathworks) (github.com/bernardosabatinilab/SabalabSoftware_November 2009.git). For two-photon images presented in
Visualization of Archon Expression in Fixed Brain Tissue.
[0143] Deeply anesthetized mice were perfused transcardially with 4% paraformaldehyde in 0.1 M phosphate buffer (pH 7.3) and brains were postfixed for 4 h at 4 C. 50 m sections were cut on a vibratome, stained with fluorescent Nissl stain (NeuroTrace 640/660; Molecular Probes), and mounted in ProLong Antifade Diamond reagent (Invitrogen). Images were taken first with a slide-scanning wide-field microscope (VS 120, Olympus), and high-resolution images of regions of interest were subsequently acquired with a Leica LS8 confocal microscope (Harvard NeuroDiscovery Center). Confocal images represent maximum intensity projections of 15 to 40 m image stacks.
Transient Expression in Zebrafish Embryos.
[0144] All experiments were conducted in accordance with MIT Committee on Animal Care and Janelia Farm IACUC protocols (as appropriate for the respective locations of specific experiments). Zebrafish were raised and bred at 28 C. according to standard methods. DNA plasmids encoding zArchon1-KGC-GFP-ER2 or miRFP were co-injected with Tol2 transposase mRNA into embryos of the pan-neuronal expressing Gal4 line, tg(elav13:GAL4-VP16)nns6 [Kimura, Y., et al., (2008) Development 135, 3001-3005]. The embryos used in the study were homozygous nacre. Briefly, DNA and Tol2 transposase mRNA, synthesized using pCR2FA as a template [Kwan, K. M. et al. (2007) Dev. Dyn. 236, 3088-3099](mMESSAGE mMACHINE SP6 Transcription Kit, Thermofisher), were diluted to a final concentration of 25 ng/l in 0.4 mM KCl solution containing 0.05% phenol red solution (Sigma Aldrich) to monitor the injection quality. The mixture was kept on ice to minimize degradation of mRNA during the injection. The mixture was injected into embryos at 1-4 cell stages as described previously [Fisher, S. et al. (2006) Nat. Protoc. 1, 1297-1305]. Larvae were screened for green fluorescence in the brain and spinal cord at 2-3 days post fertilization (dpf; animals were used without regard to sex) and subsequently imaged at 3-4 dpf.
Voltage Imaging in Zebrafish Embryos.
[0145] Zebrafish larvae at 3-4 dpf were used to image neurons expressing zArchon1. To prevent motion artifacts during imaging, larvae were paralyzed by applying a paralytic agent, pancronium bromide, at a final concentration of 0.20 mg/ml (Sigma Aldrich), to stop muscle motion [Panier, T. et al. (2013) Front. Neural Circuits 7, 65]. Larvae were placed in a dish with the paralytic agent until they stopped moving, taking about one minute on average. Paralyzed larvae were immobilized in 1.5% ultra-low-melting agarose (Sigma Aldrich) prepared in E3 medium following standard protocols [Renaud, O., et al., (2011) Nat. Protoc. 6, 1897-904]. The embedded larvae were mounted on an inverted epifluorescent microscope (Nikon Eclipse Ti) for voltage imaging. The fluorescence of zArchons was excited by a red laser (OBIS 637 LX) focused onto the back focal plane of a 401.15NA water-immersion objective (Nikon). Illumination intensities of 1.1-2.2 W/mm2 were used for voltage imaging recorded using a sCMOS camera (Zyla 5.5, Andor) with image acquisition rates of 250-500 Hz. No chemical or physical stimuli were applied before or during recording of spontaneous activity.
Lightsheet Zebrafish Imaging.
[0146] Lightsheet imaging for
Voltage Imaging in C. elegans.
[0147] The Archon1-KGC-EGFP-ER2 gene was codon-optimized for expression in C. elegans using the online resource at www.bioinformatics.org/. Worms were maintained and grown following standard protocols [Brenner, S. (1974) Genetics 77, 71-94]. SWF4 (flvEx3[rig-3::wArchon1-KGC-EGFP-ER2, sra-6::ChR2-GFP, elt-2::nGFP]) and SWF5 (flvEx4[rig-3::wArchon1-KGC-EGFP-ER2, sra-6::ChR2-GFP), elt-2::nGFP]) were two independent lines generated by injecting the indicated plasmids into N2 background worms and picking those with strongest expression of the wArchon1-GFP fusion. Results from these two lines were indistinguishable. SWF7 (flvEx5[rig-3::wArchon1-KGC-EGFP-ER2, elt-2::nGFP]), generated by injecting the indicated plasmid into N2 background worms, was used for control experiments examining the action of wArchon1 in the absence of channelrhodopsin-2.
[0148] Transgenic worms (used without regard to sex) at L4 stage of development were put onto NGM plates with OP50 lawns supplemented with 100 M all-trans-retinal (Sigma-Aldrich, USA) no less than 16 hours prior to experiments. Worms were mounted on 5% agarose pads on microscope slides, immobilized with 5 mM tetramisol and imaged using a Nikon Eclipse Ti inverted microscope equipped with a 401.15 NA water immersion objective (Nikon), a 637 nm Laser (637 LX, OBIS) focused on the back focal plane of the objective, a SPECTRA X light engine (Lumencor) with 475/28 nm excitation filter (Semrock), and a 5.5 Zyla camera (Andor), controlled by NIS-Elements AR software. Fluorescence of wArchon1 was imaged with 635 nm excitation at 800 mW/mm.sup.2 and 664LP emission filter (Semrock); GFP fluorescence was imaged with 475/34BP excitation filter and 527/50BP emission filter (Semrock). Optogenetic stimulation was performed with 475/34 nm illumination at 0.2 mW/mm.sup.2.
Data Analysis and Statistics.
[0149] Data were analyzed offline using NIS-Elements Advance Research software, Origin (OriginLab), FlowJo v10, Excel (Microsoft), ImageJ, Igor Pro (Wavemetrics), BoxPlotR and MATLAB. Analysis of all presented fluorescence traces was performed as following: cells and a neighboring cell-free region were selected manually and fluorescence measurements were performed for each region of interest (ROI), and then fluorescence from an Archon-free region was subtracted from cell fluorescence to correct for background; except
[0150] For kinetics analysis (
[0151] For
[0152] All statistics were performed in JMP (SAS), except that Wilcoxon rank sum tests were performed in MATLAB (MathWorks). A power analysis was not performed because the goal was to create a new technology; as noted in Dell, R. B., et al., (2002) ILAR J. 43, 207-13, and recommended by the NIH, In experiments based on the success or failure of a desired goal, the number of animals required is difficult to estimate . . . As noted in the aforementioned paper, The number of animals required is usually estimated by experience instead of by any formal statistical calculation, although the procedures will be terminated [when the goal is achieved]. These numbers reflect our past experience in developing neurotechnologies.
Results
[0153] In order to achieve the multidimensional screening capability needed to assess large numbers of mutant genes along multiple parameters, microscopy (with its capacity to measure many parameters exhibited in an image at once) was combined with robotic cell picking (
[0154] As a test case for the hierarchical robotic screen strategy, a monomeric near-infrared fluorescent protein (FP) was developed. A library of mutants of the RpBphP1 bacteriophytochrome [Giraud, E. et al. (2002) Nature 417, 202-205], was created, reasoning based on the crystal structure of RpBphP1 [Bellini, D. & Papiz, M. Z. (2012) Structure 20, 1436-1446] that this protein could serve as a viable backbone for engineering monomeric near-infrared FPs because of a lack of dimerization at its PAS-GAF domains (unique amongst bacteriophytochrome crystal structures), and did three rounds of robotic cell-picking with microscopy image-based criteria of brightness (all three rounds) and photostability (in the first round) (see Table 1, top row, for screening parameters; screening progress is described in
TABLE-US-00003 TABLE 2 Properties of bacteriophytochrome-derived FPs Extinction Molecular BphP Abs. Em. coefficient Quantum brightness.sup.b Photostability, Oligomeric Protein template (nm).sup.a (nm).sup.a (M.sup.1cm.sup.1).sup.a yield (%).sup.a vs. iRFP (%) pK.sub.a t.sub.1/2 (s) state iRFP670 RpBphP6 651 670 59,000 13.2 154 4.5 ND Dimer iRFP682 RpBphP2 670 682 69,000 11.3 155 4.6 ND Dimer iRFP702 RpBphP6 673 702.sup.c 85,000 8.2.sup.c 138 4.5.sup.c ND Dimer iRFP RpBphP2 692 713 80,000 6.3.sup.c 100 4.5.sup.c ND Dimer iRFP720 RpBphP2 700 720.sup.c 70,000 6.0.sup.c 83 4.5.sup.c ND Dimer mIFP.sup.d BrBphP 683 703 82,000 8.4 137 3.5.sup.e 227 Monomer miRFP670.sup.f RpBphP1 642 670 87,400 14 243 4.5 ND Monomer miRFP703.sup.f RpBphP1 674 703 90,900 8.6 155 4.5 ND Monomer miRFP709.sup.f RpBphP1 683 709 78,400 5.4 84 4.5 ND Monomer miRFP RpBphP1 674 703 92,400 9.7 178 4.3 432 Monomer .sup.aMeasured on protein purified from E. coli. .sup.bThe product of molar extinction coefficient and quantum yield. All data was collected in this study, except: .sup.cdata from Shcherbakova, D. M. & Verkhusha, V. V. (2013) Nature Methods, 10(8), 751-754; .sup.dthis row of data from Yu, D. et al. (2015) Nat. Methods 12, 1-6; .sup.eestimated from the plot in Yu, D. et al. (2015) Nat. Methods 12, 1-6; .sup.fdata from Shcherbakova, D. M. et al. (2016) Nat. Commun. 7, 1-12. NDnot determined. Proteins spectrally similar to miRFP were: iRFP702, iRFP, iRFP720, mIFP, miRFP703, miRFP709, and miRFP.
TABLE-US-00004 TABLE 3 provides statistical analysis for FIG. 1D, E, G, J; FIG. 2C, I, N; FIG. 3G, H, I; and FIG. 16. Statistical analysis for FIG. 1D Number of data points Standard error Protein for statistics (n) Mean of mean mIFP 4 29.33 0.75 miRFP 4 100.00 5.70 Wilcoxon rank sum test between mIFP and miRFP P-value 0.0286 rank sum test statistic 10 Statistical analysis for FIG. 1E Number of data points Standard error Protein for statistics (n) Mean of mean mIFP 8 227.36 11.27 miRFP 8 432.74 25.45 Wilcoxon rank sum test between mIFP and miRFP P-value 1.5540e04 rank sum test statistic 36 Statistical analysis for FIG. 1G Number of data points Standard error Protein for statistics (n) Mean of mean Template 16 3.0616 0.3247 Archon1 15 10.3510 1.3950 Archon2 16 7.7443 1.0947 Kruskal-Wallis Test Rank Sums (Mean- Score Expected Score Mean0)/ Protein Count Sum Score Mean Std0 Archon1 15 510.500 360.000 34.0333 3.423 Archon2 16 449.500 384.000 28.0938 1.459 Template 16 168.000 384.000 10.5000 4.838 1-Way Test, Chi Square Approximation ChiSquare DF Prob > ChiSq 24.9704 2 <.0001 Nonparametric Comparisons with Control using Steel's test Control Group: Template q* Alpha 2.21304 0.05 Score Mean Std Err Protein1 Protein2 Difference Dif Z p-Value Archon2 QuasAr2 12.4375 3.316625 3.75005 0.0003 Archon1 QuasAr2 14.9188 3.267687 4.56554 <.0001 Statistical analysis for FIG. 1J Number of data points Standard error Protein for statistics (n) Mean of mean Template 5 45.9002 2.0012 Archon1 6 80.6349 3.3146 Archon2 4 19.5504 0.8723 Kruskal-Wallis Test Rank Sums (Mean- Score Expected Score Mean0)/ Protein Count Sum Score Mean Std0 Archon1 6 75.000 48.000 12.5000 3.123 Archon2 4 10.000 32.000 2.5000 2.807 Template 5 35.000 40.000 7.0000 0.551 1-Way Test, ChiSquare Approximation ChiSquare DF Prob > ChiSq 12.3750 2 0.0021 Nonparametric Comparisons with Control using Steel's test Control Group: Template q* Alpha 2.21298 0.05 Score Mean Std Err Protein1 Protein2 Difference Dif Z p-Value Archon2 QuasAr2 4.27500 1.837117 2.32702 0.0374 Archon1 QuasAr2 5.31667 2.008316 2.64733 0.0155 Statistical analysis for FIG. 2C Number of data points Standard error Protein for statistics (n) Mean of mean Archer1 16 534.2359 66.17127 QuasAr2 18 519.0741 80.68391 Archon1 23 1440.3283 114.8950 Archon2 23 4160.2174 441.5730 Kruskal-Wallis Test Rank Sums (Mean- Score Expected Score Mean0)/ Protein Count Sum Score Mean Std0 Archer1 16 304.000 648.000 19.0000 4.132 Archon1 23 1052.00 931.500 45.7391 1.276 Archon2 23 1568.00 931.500 68.1739 6.761 QuasAr2 18 316.000 729.000 17.5556 4.753 1-Way Test, ChiSquare Approximation ChiSquare DF Prob > ChiSq 65.0330 3 <.0001 Nonparametric Comparisons For All Pairs Using Steel-Dwass test q* Alpha 2.56903 0.05 Score Mean Std Err Protein1 Protein2 Difference Dif Z p-Value Archon2 Archon1 21.3043 3.958114 5.38245 <.0001 Archon2 Archer1 19.4470 3.711762 5.23929 <.0001 Archon1 Archer1 19.1291 3.711762 5.15364 <.0001 QuasAr2 Archer1 2.4201 3.421575 0.70732 0.8942 QuasAr2 Archon1 18.2717 3.769795 4.84688 <.0001 QuasAr2 Archon2 20.4505 3.769795 5.42483 <.0001 Statistical analysis for FIG. 2I Wilcoxon signed-rank test between electric and optical FMHW of Archon1 in culture. P-value 0.0156* rank sum test statistic 14 Statistical analysis for FIG. 2N Kruskal-Wallis Test Rank Sums (Mean- Score Expected Score Mean0)/ Protein Count Sum Score Mean Std0 Ace 5 52.000 80.000 10.4000 1.477 Archer1 5 77.000 80.000 15.4000 0.134 Archon1 7 196.000 112.000 28.0000 3.945 Archon2 7 143.000 112.000 20.4286 1.441 QuasAr2 7 28.000 112.000 4.0000 3.945 1-Way Test, Chi Square Approximation ChiSquare DF Prob > ChiSq 27.9664 4 <0.0001 Nonparametric Comparisons For All Pairs Using Steel-Dwass test q* Alpha 2.72777 0.05 Score Mean Std Err Protein1 Protein2 Difference Dif Z p-Value Archon1 Ace 5.82857 2.111195 2.76079 0.0456 Archon1 Archer1 5.82857 2.111195 2.76079 0.0456 Archon2 Ace 5.82857 2.111195 2.76079 0.0456 Archon2 Archer1 4.45714 2.111195 2.11119 0.2152 Archer1 Ace 4.00000 1.914854 2.08893 0.2248 QuasAr2 Ace 5.82857 2.111195 2.76079 0.0456 QuasAr2 Archer1 5.82857 2.111195 2.76079 0.0456 Archon2 Archon1 6.85714 2.236068 3.06661 0.0184 QuasAr2 Archon1 6.85714 2.236068 3.06661 0.0184 QuasAr2 Archon2 6.85714 2.236068 3.06661 0.0184 Statistical analysis for FIG. 3G Wilcoxon signed-rank test between electric and optical FMHW of Archon1 at 1.5 W. P-value 0.002** rank sum test statistic 27.5 Wilcoxon signed-rank test between electric and optical FMHW of Archon1 at 15 W. P-value 0.0002*** rank sum test statistic 45.5 Statistical analysis for FIG. 3H Wilcoxon signed-rank test of Archon1 df/f per action potential at 1.5 W and at 15 W. P-value 0.375 rank sum test statistic 9.5 Statistical analysis for FIG. 3I Wilcoxon signed-rank test of Archon1 SNR per action potential at 1.5 W and at 15 W. P-value 0.002** rank sum test statistic 27.5 Statistical analysis for FIG. 16 providing information on (a) membrane resistance, (b) membrane capacitance, and (c) resting potential (a) Membrane resistance Kruskal-Wallis Test Rank Sums (Mean- # of Score Expected Score Mean0)/ Protein cells Sum Score Mean Std0 Negative 10 384.000 355.000 38.4000 0.478 Archer1 8 344.000 284.000 43.0000 1.098 QuasAr2 10 275.000 355.000 27.5000 1.334 Ace2N-4aa- 14 208.000 497.000 14.8571 4.236 mNeon Archon1 17 719.000 603.500 42.2941 1.575 Archon2 11 555.000 390.500 50.4545 2.647 1-Way Test, Chi Square/Approximation ChiSquare DF Prob > ChiSq 25.0740 5 0.0001 Nonparametric Comparisons with Control using Steel's test Control Group: Negative q* Alpha 2.50102 0.05 Score Mean Std Err Protein Difference Dif Z p-Value Archon2 4.10455 2.711088 1.51398 0.3990 Archer1 1.68750 2.530984 0.66674 0.9394 Archon1 1.19118 3.163208 0.37657 0.9947 QuasAr2 3.10000 2.645751 1.17169 0.6379 Ace2N-4aa-mNeon 8.65714 2.927700 2.95698 0.0136 (b) Membrane capacitance Kruskal-Wallis Test Rank Sums (Mean- # of Score Expected Score Mean0)/ Protein cells Sum Score Mean Std0 Negative 10 268.000 355.000 26.8000 1.452 Archer1 8 190.000 284.000 23.7500 1.726 QuasAr2 10 375.000 355.000 37.5000 0.327 Ace2N-4aa- 14 762.000 497.000 54.4286 3.884 mNeon Archon1 17 586.500 603.500 34.5000 0.226 Archon2 11 303.500 390.500 27.5909 1.396 1-Way Test, ChiSquare Approximation ChiSquare DF Prob > ChiSq 18.4052 5 0.0025 Nonparametric Comparisons with Control using Steel's test control Group: Negative q* Alpha 2.50102 0.05 Score Mean Std Err Protein Difference Dif Z p-Value Ace2n-4aa-mNeon 9.17143 2.927700 3.13264 0.0077 QuasAr2 3.30000 2.645751 1.24728 0.5825 Archon1 2.93824 3.163208 0.92888 0.8077 Archon2 0.85909 2.711088 0.31688 0.9976 Archer1 1.68750 2.530984 0.66674 0.9394 (c) Resting potential Kruskal-Wallis Test Rank Sums (Mean- # of Score Expected Score Mean0)/ Protein cells Sum Score Mean Std0 Negative 10 245.500 400.000 24.5500 2.285 Archer1 9 453.000 360.000 50.3333 1.436 QuasAr2 10 520.000 400.000 52.0000 1.773 Ace2N-4aa- 17 536.000 680.000 31.5294 1.722 mNeon Archon1 19 852.500 760.000 44.8684 1.062 Archon2 14 553.000 560.000 39.5000 0.084 1-Way Test, ChiSquare Approximation ChiSquare DF Prob > ChiSq 12.4210 5 0.0295 Non-parametric Comparisons with Control using Steel's test Control Group: Negative q* Alpha 2.49072 0.05 Score Mean Std Err Protein Difference Dif Z p-Value Archon1 7.478947 3.297313 2.268194 0.0870 QuasAr2 6.600000 2.635786 2.503997 0.0483 Archer1 5.594444 2.574207 2.173269 0.1085 Archon2 4.800000 2.897632 1.656525 0.3059 Ace2N-4aa-mNeon 2.461765 3.154021 0.780516 0.8833
[0155] Having validated the power of the robotic cell picking microscopy screening strategy, and showing its ability to balance high-content and high-throughput goals, the next studies were directed to multidimensional screening for a high-performance fluorescent voltage sensor. The goal was to have, in the end, a molecule compatible with optogenetic control, so it was determined to begin with a template with red fluorescence (since all optogenetic tools are sensitive to blue light to some extent, meaning that ideally it would result in a voltage reporter that would be illuminated by yellow or red light). The process began with the opsin part of the previously reported voltage sensor QuasAr2, which has fluorescence excitation and emission maxima at 590 nm and 715 nm respectively [Hochbaum, D. R. et al. (2014) Nat. Methods 1-34 doi:110.1038/nmeth.3000], leaving out the mOrange fluorescent protein part of QuasAr2 because the focus was on improvement of the voltage sensitive domain. A library was generated with error-prone PCR, FACS sorted cells for brightness, and then performed one round of robotic cell-picking to optimize brightness and localization, followed by voltage sensitivity screening via electrical stimulation as previously described [Pucihar, G., et al., (2009) J. Vis. Exp. 88, 4-6], resulting in five variants that exhibited improved brightness and localization in HEK cells (see Table 1, bottom row, for screen parameters). Sequence analysis of the mutants revealed four amino acid positions, namely T56, Ti 17, T183 and L198, that were changed in four out of the five variants identified at this stage, and four amino acid mutations were also identified in -helixes (T20S, L31V, K47R, and A137T) and two mutations in -strands (S80P and D88N) which were represented at least once in the selected mutants (see
[0156] For expression in cultured neurons and in vivo mouse, zebrafish, and C. elegans, Archons were fused with EGFP, and the Golgi export trafficking signal (KGC) and endoplasmic reticulum export (ER) sequences [Gradinaru, V. et al. (2010) Cell 141, 154-165; Chuong, A. S. et al. (2014) Nat. Neurosci. 17, 1123-1129] (
[0157] When expressed Archon2 was expressed in mouse brain slices, lower SNR and slightly worse membrane localization was obtained than with Archon1 (
[0158] Photobleaching is a problem with prior voltage reporters, making it difficult to do voltage imaging in real experimental contexts, as signals decrease and ultimately blend in with the noise. Tests were performed to assess the photobleaching properties of Archon 1, in cultured neurons. Archons were excited with 800 mW/mm.sup.2 637 nm light for 900 seconds, and it was found that Archon1 retained 9516% of its baseline fluorescence (n=9 cells from 2 cultures). Next studies were performed to assess photobleaching for other reporters, tuning the light power in each case to yield similar action potential SNR (26 for the hardware used in this experiment; see Methods section) as the Archon1 experiment. Archon2 showed 5810% retention of initial baseline fluorescence after 900 seconds (n=7 cells from 2 cultures;
[0159] As Archons are derived from a light-driven proton pump, which generates photocurrent under visible light stimulation, experiments were performed that characterized their responses to illumination with light powers representative of those used during imaging (470/20 nm at 15 mW/mm.sup.2 as used to image EGFP expressing neurons; 637 nm at 800 mW/mm.sup.2 as used in this figure for imaging). Under all tested wavelengths, Archons showed no steady state photocurrent (
[0160] To test the function of Archons in brain tissue, Archon 1 (and Archon2) were expressed in cortical pyramidal neurons by in utero electroporation (IUE). It was found that targeting the hippocampus by IUE at E15.5 also resulted in sparse expression in layer (L) pyramidal neurons in motor cortex (
[0161] A series of voltage-steps in voltage-clamp mode was used to test the ability of Archons to report membrane voltage over a physiologically relevant range. Stepping the holding-potential (Vm) from 90 to +10 mV resulted in step-like fluorescent signals for Archon1 (
[0162] Under 1.5 and 15 W/mm.sup.2 of excitation light, optically recorded APs by Archon1 displayed an average F/F of 22.49.4% and 22.210.2, respectively (
[0163] Next the use of Archon 1 was explored in multiple in vivo contexts. Zebrafish (Danio rerio) is, due to its genetic tractability and transparent nature, a widely used species in the study of the development and operation of the nervous system [Friedrich, R. W., et al., (2010) Curr. Biol. 20, R371-R381; Stewart, A. M., et al., (2014) Trends Neurosci. 37, 264-278; Ahrens, M. B. et al. (2012) Nature 485, 471-477; Ahrens, M. B., et al., (2013) Nat Methods 10, 413-420; and Wyart, C. et al. (2009) Nature 461, 407-410]. To perform in vivo voltage imaging of neurons in larval zebrafish a zebrafish codon-optimized version of Archon1 (zArchon1 for short) fused to GFP was transiently expressed in a subset of neurons. A light intensity of 2.2 W/mm.sup.2 was used for zArchon1 imaging. zArchon1, expressed in zebrafish larvae, demonstrated excellent membrane localization (see
[0164] Assessing photobleaching of voltage reporters in the context of use is important to ensure robustness of fluorescence signals over behaviorally relevant time periods in experimental settings. Thus, the photobleaching properties of zArchon1 in zebrafish larvae were assessed by applying the same illumination condition used for voltage imaging (637 nm at 2.2 W/mm.sup.2). The fluorescence of zArchon1 declined to 848% of baseline fluorescence over 300 seconds (n=9 neurons in 5 fish;
[0165] The usage of Archon1 was examined in the nematode C. elegans, whose compact nervous system and genetic tractability have long made it a preferred model organism for neuroscience. The rig-3 promoter was used to drive expression of codon-optimized Archon1 (wArchon1 for short) fused to EGFP in AVA interneurons, involved in backward locomotion (
Additional Results
Optimization of Gene Library Expression in Mammalian Cells.
[0166] For expression of gene libraries in mammalian cells a way of transfecting single genes into cultured cells was created, so that high-content imaging and subsequent genotyping of individual cells would be meaningful. Electroporation [Heiser, W. C. (2000) Methods Mol Biol. Vol. 130: pp 117-134; Reid, L. H., et al., (1991) Mol. Cell Biol. 11, 2769-2777]; and transduction [Kutner, R. H., et al., (2009) Nat. Protoc. 4, 495-505; Wang, L. & Tsien, R. Y. (2006) Nat. Protoc. 1, 1346-1350] have been used to deliver single genes into single cells in bulk, but studies were performed to determine whether commonly used chemical means might offer greater degrees of simplicity and scalability. Calcium phosphate transfection was examined due to the flexibility of adjusting the amount of DNA delivered across many orders of magnitude, in comparison to other chemical means [Jordan, M., et al., (1996) Nucleic Acids Research, 24, 596-601; Jordan, M. & Wurm, F. (2004) Methods 33, 136-143]. To validate the potential for single gene-per-cell transfection, an equimolar mixture of plasmids encoding green (EGFP) and red (mCardinal) fluorescent proteins (FPs) were delivered to cultured HEK293T cells, diluted by varying amounts of empty pUC19 plasmid, using commercially available calcium phosphate transfection kit according to a slightly modified manufacture protocol (see Methods section herein). As an expression vector, commercially available pN1 plasmid (Clontech) was used, which can be replicated in HEK293T cells due to the SV40 origin of replication, thus enhancing expression of target genes [Mahon, M. J. (2011) Biotechniques 51, 119-126]. The cells were analyzed via flow cytometry to access the fraction of the cells that expressed only one of the two transfected FPs (
[0167] To determine the impact of single-copy dilution transfection on actual library screening efficacy, a test case was selected to create a library of mutants of the RpBphP1 bacteriophytochrome (BphP) [Giraud, E. et al. (2002) Nature 417, 202-205]. The PAS-GAF domains were mutated at amino acid positions 201, 202, 257 and 282 to NNS (N, any nucleotide; S, T or C; see
[0168] To evaluate the RpBphP1 mutants expressed in the 45 picked cells, the genes recovered from the pool of extracted cells were cloned into expression vectors and 184 clones were randomly selected for further characterization. Only 85 out of 184 selected clones (all with unique nucleotide sequences, corrected for duplications) exhibited near-infrared fluorescence upon expression in HEK cells. To find out why over half of the clones were non-functional, all selected clones were sequenced. Sequence analysis revealed multiple point mutations scattered throughout the entire gene with on average 2.3 nucleotide mutations per gene in addition to the intended mutations at amino acid positions 201, 202, 257 and 282. Only about 12% of recovered genes had no nucleotide mutations beyond those at these 4 intended sites, while about 66% contained 1 to 3 nucleotide mutations at sites beyond the 4 intended sites (
[0169] To estimate the exact number of plasmids delivered per single positive cells, sequence analysis of the intended mutation regions was performed. The robot cell picking was repeated for the same gene library and eight cells were extracted that exhibited bright near-infrared fluorescence. Each of eight extracted cells was placed into a separate PCR tube for gene recovery. For each cell, 24 colonies were selected randomly for further characterization. For four of the cells, all of the recovered clones had a single common set of nucleotides at the 12 bases that were mutated intentionally, suggesting a single plasmid was transfected [although the 24 colonies yielded, due to the aforementioned HEK mutation effect, an average of 221 (meanS.D.) different clones per cell]. For the other four cells, the clones that emerged from each cell contained 3-4 unique sets of nucleotides at the intended mutated codons, implying triple or quadruple transfection (the 24 colonies yielded 212 unique clones per cell). Among the entire set of recovered genes, 41% exhibited any near-infrared fluorescence upon expression in HEK cells. Thus, the mutagenic activity of HEK293T cells can inactivate protein function. Also, since multiple plasmids end up in a given cell, perhaps 4-5 (or more) recovered genes should be phenotyped per extracted cell to ensure identification of positive clones.
Additional Discussion
[0170] Experiments have been performed to prepare, test, and utilize opsin-based fluorescent voltage reporter Archon 1, that exhibits good localization in neurons of multiple species (mouse, C. elegans, zebrafish), several fold improved brightness over previous opsin-based reporters, several fold improvements in voltage sensitivity to single APs and in photobleaching over GFP-based reporters, and compatibility with optogenetic control (which can also permit simultaneous imaging of voltage in conjunction with green reporters of calcium and other physiological signals). The utility of Archon1 has been demonstrated by imaging single spikes and millivolt-scale subthreshold or synaptic activity in acute mouse brain slices and larval zebrafish in vivo, as well as postsynaptic responses downstream of optogenetic control in C. elegans. The ability to survey neural activity in such well-defined systems, e.g., brain circuits from the mouse, or entire transparent organisms, may be used in synergy with new technologies that allow for mapping of physiological data onto fine wiring and connectivity.
[0171] Imaging of Archon1 requires excitation light intensity much higher than required for GFP-based fluorescent reporters. However, Archon1 supported imaging with about an order of magnitude lower light intensity in comparison to the best performing Arch-based voltage sensor (i.e. 0.080-0.8 W/mm.sup.2 for Archon1 vs. 3-8 W/mm.sup.2 for QuasAr2 in cultured neurons; 1.5 W/mm.sup.2 for Archon1 in acute brain slice vs. 12 W/mm.sup.2 for QuasAr2 in organotypic brain slices). To achieve light intensity above 0.1 W/mm.sup.2, commercially available red laser diodes were used, with pricing comparable to LED setups, and it was found that they provided sufficient light power to image Archon1 in a variety of neural systems as explored in experiments presented herein. Thus, in price, such setups might be comparable to blue LED setups used for imaging GCavMP under 1-photon microscopy.
[0172] To develop Archon1, a novel directed molecular evolution approach based on robotic cell picking under microscopy guidance was designed and implemented, so that different properties could be simultaneously optimized for a single fluorescent voltage reporter, in mammalian cells. Archon1 and other voltage reporter molecules of the invention represent new tools that may be of broad utility in neuroscience, and the robotic cell picking strategy for directed molecular evolution in mammalian cells may be of broad utility in the development of a variety of novel molecular tools for neuroscience and biology.
[0173] Imaging of neuronal activity using voltage reporters opens up the exciting possibility for simultaneous recordings of large populations of neurons with single cell single spike resolution in vivo. Several ongoing trends, as they mature, will help make voltage imaging even more accessible. Currently available scientific-grade cameras can perform fast imaging (500-1000 Hz) over pixel counts smaller by an order magnitude than those commonly used for calcium imaging (at 10-20 Hz); new cameras capable of fast imaging at cellular resolution over broader fields of view will continue to enhance the power of voltage imaging. Use of optics capable of large volume imaging with precise optical sectioning (e.g., through light-sheet scanning [Ahrens, M. B., et al., (2013) Nat Methods 10, 413-420; Bouchard, M. B. et al. (2015) Nat. Photonics 9, 113-119], or through computational optical sectioning [Prevedel, R. et al. (2014) Nat. Methods 11, 727-30] are used. Densely labeled neurons may be imaged in populations because reporter expression can be restricted to the somata, so that the light emitting sources are made sparser.
Example 2
[0174] Experiments are performed as described herein in Example 1 that include expressing voltage reporters of the invention (for example though not limited to: Archon1, Archon2, Variant#3, Variant #4, Variant#5, Variant#6, and Variant #7) in cells and subjects, including vertebrate and/or mammalian cells. In certain studies human cells are used in the experiments. Experiments are performed in vitro, ex vivo, and in vivo. In some experiments a voltage reporter is delivered to a subject in a cell that includes the voltage reporter. In some experiments a voltage reporter of the invention is delivered to a cell and/or a subject in the form of a vector encoding the voltage reporter, or is delivered to a cell and/or a subject in the form of a fusion protein that includes the voltage reporter of the invention.
[0175] Experiments are performed that include voltage imaging and/or and lightsheet imaging and other methods as described in Example 1 herein. Expression and function of the voltage reporters are observed. Results demonstrate use of voltage reporters of the invention in vertebrate cells and organisms, mammalian cells and organisms, which in some experiments include human cells and subjects. In some experiments the cell is one or more of a neuronal cell, a nervous system cell, a cardiac cell, a circulatory system cell, a visual system cell, and an auditory system cell.
[0176] It is to be understood that the methods, compositions, and apparatus which have been described above are merely illustrative applications of the principles of the invention. Numerous modifications may be made by those skilled in the art without departing from the scope of the invention. Although the invention has been described in detail for the purpose of illustration, it is understood that such detail is solely for that purpose and variations can be made by those skilled in the art without departing from the spirit and scope of the invention which is defined by the following claims. The contents of all references, patents and published patent applications cited throughout this application are incorporated herein by reference in their entirety.