RESPIRATORY SYNCYTIAL VIRUS VACCINE
20190000962 ยท 2019-01-03
Assignee
Inventors
Cpc classification
C12N7/00
CHEMISTRY; METALLURGY
C07K2319/40
CHEMISTRY; METALLURGY
C12N2760/18522
CHEMISTRY; METALLURGY
C12N2760/18534
CHEMISTRY; METALLURGY
C12N2760/18551
CHEMISTRY; METALLURGY
International classification
C12N7/00
CHEMISTRY; METALLURGY
Abstract
A respiratory syncytial virus (RSV) vaccine comprising a recombinant fusion protein antigen. In one embodiment, the recombinant fusion protein antigen comprises a phosphoprotein (P) moiety, wherein the P moiety is a polypeptide that shares at least 90% identity to the polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4; and a flagellin moiety, wherein the flagellin moiety is a polypeptide that shares at least 90% identity to the polypeptide represented by SEQ ID NO 8; whereby the P moiety and flagellin moiety are covalently coupled so as to form a linear polypeptide.
Claims
1. A respiratory syncytial virus (RSV) vaccine comprising a recombinant fusion protein antigen; wherein the recombinant fusion protein antigen comprises: a phosphoprotein (P) moiety, wherein the P moiety is a polypeptide that shares at least 90% identify to the polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4; and a flagellin moiety, wherein the flagellin moiety is a polypeptide that shares at least 90% identity to the polypeptide represented by SEQ ID NO 8; where the P moiety and flagellin moiety are covalently coupled so as to form a linear polypeptide.
2. The RSV vaccine of claim 1, wherein the P moiety is a polypeptide that shares at least 98% identity to the polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4; and wherein the flagellin moiety is a polypeptide that shares at least 98% identity to the polypeptide represented by SEQ ID NO 8.
3. The RSV vaccine of claim 1, wherein the P moiety is a polypeptide that shares at least 99% identity to the polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4; and wherein the flagellin moiety is a polypeptide that shares at least 99% identity to the polypeptide represented by SEQ ID NO 8.
4. The RSV vaccine of claim 1, wherein the P moiety is a polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4; and therein the flagellin moiety is a polypeptide represented by SEQ ID NO 8.
5. The RSV vaccine of claim 1, wherein the recombinant fusion protein antigen further comprises a first linker coupling the P moiety and flagellin moiety; wherein the first linker is an amino acid or a peptide of two to fifteen amino acids.
6. The RSV vaccine of claim 1, wherein the recombinant fusion protein antigen further comprises a purification tag for facilitating the purification of the recombinant fusion protein antigen, wherein the purification tag is disposed at either the N-terminal or C-terminal of the recombinant fusion protein antigen.
7. The RSV vaccine of claim 6, wherein the purification tag is composed of six histidine residues.
8. The RSV vaccine of claim 6, wherein the recombinant protein antigen further comprises a second linker linearly coupling the purification tag with the P moiety or flagellin moiety.
9. The RSV vaccine of claim 8, wherein the second linker is a cleavable linker that is composed of an amino acid or a sequence of amino acids which can be cleaved chemically or enzymatically at its C-terminal.
10. The RSV vaccine of claim 1, wherein the recombinant fusion protein antigen is represented by SEQ ID NO 10.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0013] Preferred embodiments according to the present invention will new be described with reference to the Figures, in which like reference numerals denote like elements.
[0014]
[0015] (a) SEQ ID NO 1, nucleotide sequence of RSV A2 strain P protein;
[0016] (b) SEQ OD NO 2, amino acid sequence of RSV A2 strain P protein;
[0017] (c) SEQ ID NO 3, nucleotide sequence of RSV mutant cpt-248 P protein;
[0018] (d) SEQ ID NO 4, amino acid sequence of RSV mutant cpt-248 P protein;
[0019] (e) SEQ ID NO 5, nucleotide sequence of recombinant P protein with His tag underline;
[0020] (f) SEQ ID NO 6, amino acid sequence of recombinant P protein with His tag, where the RSV mutant cpt-248 P protein as shown as SEQ ID NO 4 is underlined, and the His tag is bolded;
[0021] (g) SEQ ID NO 7, nucleotide sequence of recombinant flagellin KFD1;
[0022] (H) SEQ ID NO 8, amino acid sequence of recombinant flagellin KFD1;
[0023] (i) SEQ ID NO 9, nucleotide sequence of recombinant PKFD1, where the RSV mutant cpt-248 protein as shown as SEQ ID NO 3 is underlined, the nucleotide sequence of SEQ ID NO 7 is double underlined, and the His tag is bolded;
[0024] (j) SEQ ID NO 10, amino acid sequence of recombinant PKFD1, where the RSV mutant cpt-248 protein as shown as SEQ ID NO 4 is underlined, the amino acid sequence of SEQ ID NO 8 is double underlined, and the His tag is bolded.
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
DETAILED DESCRIPTION OF THE INVENTION
[0034] The present invention may be understood more readily by reference to the following detailed description of certain embodiments of the invention.
[0035] Throughout thus application, where publications are referenced, the disclosures of these publications are hereby incorporated by reference, in their entireties, into this application in order to more fully describe the state of art to which this invention pertains.
[0036] The practice of the present invention will employ unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are within the skill of the art. Such techniques are explained fully in the literature, for example, Molecular Cloning: A Laboratory Manual, second edition (Sambrook and Russel, 2001); Current Protocols in Molecular Biology (F. M. Ausubel et al. eds., 1987).
[0037] RSV has a linear single-stranded RNA genome with 10 genes encoding 11 proteins, including non-structural proteins (NS1 and NS2), large polymerase (L), prosphoprotein (P) nucleocapsid (N), matrix protein (M), surface attachment glycoprotein (G), surface fusion glycoprotein (F), small hydrophic protein (SH), a transcription factor (M2-1) and an accessory protein (M2-2). G and F proteins have been considered the two major protective antigens for eliciting neutralizing antibodies. G protein is heavily glycosylated and involved in vital attachment to host cells, and F protein mediates cell fusion allowing entry of the virus into the cell cytoplasm and formation of syncytia (Yang and Varga 2014).
[0038] Since RSV F protein is a very important neutralizing antigen to potentially induce mucosal immunity, it has been the focus for development or an RSV vaccine. Based on the recent identification of the very potent neutralizing antigen site in the prefusion F, the next generation of RSV vaccine candidates should include the F protein expressed in the profusion form (Yang and Varga, 2014).
[0039] Because RSV infection is restricted to the respiratory tract, an RSV vaccine should elicit mucosal immunity at upper and lower respiratory tracts in order to most effectively prevent RSV reinfection (Yang and Varga, 2014). The efficient induction of mucosal immune responses requires appropriate administration routes and specific adjuvants and/or delivery systems intranasal delivery is the most effective route to induce potent and broad mucosal immune responses at multiple mucosal sites as compared to other mucosal delivery routes (Yang and Varga, 2014).
[0040] RSV vaccines have four main categories including inactivated, live-attenuated, gene-based vectors and subunit. Live-attenuated RSV vaccines administered intranasally, and a subunit RSV postfusion F protein vaccine adjuvanted with alum and delivered intramuscularly have been extensively evaluated in a number of clinical trials in recent years. However, the live-attenuated RSV vaccine induced a response that was weaker in magnitude than that of natural infection due to loss of immunogenicity during the process of attenuation (Yang and Varga, 2014).
[0041] Being delivered usually by systemic immunization, F protein-based RSV vaccines were proven safe in older children and adults, however their immunogenicity was modest and they failed to induce potent mucosal immunity (Groothuis J R, et al. 1998).
[0042] Antigen Selections
[0043] VLPs expressing F or G protein could confer protection against RSV challenge in mice, but VLP G vaccination enhanced disease when used alone; one interesting result was that mixed VLP F+VLP G were without vaccine induced immunopathology even though no plausible explanation was provided (Lee S. et al. 2014).
[0044] Chimpanzee adenovirus and modified vaccinia virus encoding RSV proteins F, N and M2-1 have been tested in phase 1 clinical trials (Green C. A., 2015).
[0045] VLP containing pre-fusion form F protein was tested in cotton rats for its protection against RSV (Cullen L. M., et al. 2015).
[0046] A peptide corresponding to the viral surface small hydrophobic (SH) ectodomain of HRSV B (CGGGS-NKLSEHKTFSNKTLEQCQMYQINT) chemically conjugated to Hepatitis B core protein virus-like particles (HBc-SHeB) showed reducing viral replication in challenged mice and cotton rats (Schepens, B. et al 2014).
[0047] Adjuvant Selections
[0048] Alum-adjuvanted FI-RSV induced severe vaccine-enhanced RSV disease including weight loss, eosinophilia, and lung histopathology while it enhanced protection against RSV over unadjuvanted FI-RSV (Kim K H, et al. 2015).
[0049] Inactivated RSV adjuvanted with LPS. Poly(I:C), or PolyU induced protective immunity against live RSV challenge (Delgado M F, et al. 2009); however, all the adjuvants are chosen because of the components in RSV, i.e., F protein can activate TLR4 pathway like LPS; Poly(I:C) and PolyU function as viral genome.
[0050] Bovine RSV
[0051] Bovine RSV is a key player in the bovine respiratory disease complex, which is one of the most economically important and outstanding welfare issues in industrialized beef cattle production. The BRSV genome is very similar to the RSV genome (Hagglund S., et al. 2014).
[0052] When BRSV-immunostimulating complex (ISCOM) was used to immunize calves, IgG antibody specific for F, G, N, and SH are of high titers; it is to be noted that no significantly antibody responses against M and P were detected (Hagglund S., et al. 2014).
[0053] The present invention discovered a safe and effective RSV vaccine, where the vaccine comprises a recombinant fusion protein antigen. The recombinant fusion protein antigen comprises a phosphoprotein (P) moiety and a flagellin moiety, where the P moiety and flagellin moiety are covalently coupled so as to form a linear polypeptide. A fusion protein is a chimeric molecule in which the constituent moieties are all polypeptides and are attached (fused) to each other such that the chimeric molecule forms a continuous single chain. The various constituents can be directly attached to each other or can be coupled through one or more peptide linkers. A linker as used in reference to a chimeric molecule refers to any molecule that links or joins the constituent moieties of the chimeric molecule. Where the chimeric molecule is a fusion protein, the linker may be a peptide that joins the proteins comprising a fusion protein.
[0054] Referring now to
[0055] Referring now to
[0056] In certain embodiments, the P moiety 10 is a polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4. In certain embodiments, the P moiety 10 is a polypeptide that shares at least 90%, preferably 98%, even more preferably 99% identity to the polypeptide represented by SEQ ID NO 2 or SEQ ID NO 4.
[0057] In certain embodiments, the flagellin moiety 20 is a polypeptide represented by SEQ ID NO 8. In certain embodiments, the flagellin moiety 20 is a polypeptide that shares at least 90%, preferably 98%, even more preferably 99% identity to the polypeptide represented by SEQ ID NO 8.
[0058] In certain embodiments, the recombinant fusion protein antigen 1 further comprises a first linker 30 coupling the P moiety 10 and flagellin moiety 20, where the first linker 30 is an amino acid or a peptide of two or more amino acids, the amino acid(s) in the first linker 30 shall be flexible without large side residues to avoid immune responses. In addition, the first linker 30 shall be resistant to enzymatic digestion so as to stabilize the recombinant fusion protein antigen when such a vaccine is administrated.
[0059] In certain embodiments, the recombinant fusion protein antigen 1 further comprises a purification tag 40 for facilitating the purification of the recombinant fusion protein antigen 1. The purification tag 40 can be disposed at either the N-terminal or C-terminal of the recombinant fusion protein antigen 1. For example, six histidine residues are fusedly located at its N- or C-terminals, allowing purification using Ni.sup.2+ column. After the purification, the six histidine residues can be removed by chemical or enzymatic cleavage. In fact, any known purification tag is suitable here including myc tag, HA tag, Flag-peptide, KT3 epitope, alpha-tubulin epitope, T7 gene 10 protein peptide tag, glutathione-S-transferase (GST), strep-tag, bovine pancreatic trypsin inhibitor (BPTI), and maltose binding protein (MBP).
[0060] In certain embodiments, the recombinant fusion protein antigen 1 further comprises a second linker 50 linearly coupling the purification tag 40 with the P moiety 10 or flagellin moiety 20. In certain embodiments, the second linker 50 is a cleavable linker that is composed of an ammo acid or a sequence of amino acids, which can be cleaved chemically or enzymatically at its C-terminal in the expression vectors, the cleavable linker comprises a DNA sequence which codes for an amino acid or a sequence of ammo acids which can be cleaved chemically or enzymatically at its C-terminal.
[0061] Examples of chemical agents useful for cleaving proteins are cyanogen bromide, 2-(2-nitrophenylsulfensyl)-3-bromo-3-methylinolinium (BNPS-skatole), hydroxylamine, and the like. Cyanogen bromide cleaves proteins at the C-terminal of a methionine residue. BNPS-skatole cleaves at the C-terminal of a tryptophan residue. Hydroxylamine cleaves at the C-terminal of the moiety -Asn-Z in which Z is Gly, Leu, or Ala.
[0062] Examples of enzymatic agents useful for cleavage are trypsin, papain, pepsin, plasmin, thrombin, enterokinase, and the like. Each effects cleavage at a particular amino acid sequence which it recognizes. Enterokinase, for example, recognizes the amino acid sequence -(Asp).sub.n-Lys- in which n is an integer from 2 to 4.
[0063] As discussed above, the techniques for expression vector cloning, construction and amplification are well known to those skilled in the art. Therefore, the expression vectors for the recombinant fusion protein antigen can be constructed by routine procedures; no further details are provided herein in order not to obscure the principles of the present invention.
[0064] The RSV vaccine of the present invention further comprises a pharmaceutically acceptable solution including such as saline, PBS. In certain embodiments, the RSV vaccine may include other components such as other proteins from RSV.
EXAMPLES
[0065] 1. Preparation of Virus For Challenge
[0066] RSV stain A2 was propagated in Hep-2 cells; after sonication, centrifuged at 1000 g, 4 C. for 10 min; collected supernatants; ultra-centrifuged at 80,000 g, 4 C. for 2 hs to purify viruses. The purified viruses were titrated by plaque assay, and stored for challenges.
[0067] 2. Preparation of FI-RSV
[0068] Added neutral formalin into purified RSV A2 virus suspension solution at 1:4,000, and incubated at 37 C. for 3 days with rotation; then centrifuged at 30,000 rpm for 30 min; the pellets were resuspended into a volume of 1/25 of the original volume; then mixed FI-RSV with adjuvant Alum (4 mg/ml) and incubated at room temperature for 24 hours.
[0069] 3. Preparation of Recombinant Proteins
[0070] Referring now to
[0071] Immunization
[0072] Referring now to
[0073] Challenge
[0074] Challenge was done at day 25 after the last immunization. All mice were anesthetized by Avertin (tribromoethanol dissolved in tert-pentyl alcohol), and i.n. infected with 110.sup.7 PFU RSV A2 in a volume of 50 l. The antigens and conditions for immunization and challenges are summarized in Table 1.
TABLE-US-00001 TABLE 1 Summary of antigens and conditions for immunization and challenges Number of challenge challenge group mice Route/dose doses volume (a) Saline 18 i.n./saline-diluted 1*10.sup.7 PFU 50 l anesthetic (b) FI-RSV 18 i.m. at Day 42 1*10.sup.7 PFU 50 l (2)/2 g FI-RSV + 400 g Alum (c) P + CTB 18 i.n. (3)/40 g 1*10.sup.7 PFU 50 l P + 2 g CTB (d) P-KFDI 18 i.n. (3)/24 g 1*10.sup.7 PFU 50 l P-KFDI
[0075] Immune Plaque Assay for Determining Virus Titers in Nasal and Lung Tissues
[0076] At day 4 post challenge, mice were sacrificed, and nose and lung tissues were collected, and homogenized using a homogenizer. In 24-well plates, Vero cells were inoculated, and grew into 100% confluence; then diluted homogenized samples were added into the wells, and incubated at 37 C. for 1 hour; after washing 3 times, added into wells 1 ml DMEM culture media containing 2% FBS, 1% P+S, 0.75% methyl cellulose; then incubated at an incubator for 4-5 days. Then, gently discarded culture media from the wells; fixed the wells with paraformaldehyde and Triton X-100 for 20 minutes; added P protein-specific monoclonal antibody; incubated for 2 hours; added Goat anti-mouse IgG-HRP; incubated for 1 hour, and finally developed with AEC substrate, and counted the plaques.
[0077] Titration of Serum Neutralization Antibody Titers
[0078] Sera were inactivated; then diluted sequentially at 2-fold, the diluted serum samples (100 l) were incubated with 200 PFU of RSV A2 virus (100 l) at 37 C. for 1 hours; then added onto Vero cell monolayer; allowed to adhere for 1 hour; incubated for 3 days; determined virus titers using immune plaque assay as described above. Serum neutralization antibody titer is defined as the serum inverse dilution folds that can cause a 50% reduction of plaque numbers, i.e. 50% plaque reduction neutralization titer (PRNT).
[0079] Measurement of Airway Responsiveness in Mice
[0080] Day 4 post-challenge, anesthetized the mice with pentobarbital sodium, cut open the neck skins of the mice with surgical scissors, stripped the trachea, inserted tracheal intubation into the stripped trachea, connected the other end of tracheal intubation to a ventilator, and set the respiration rate at 1.5:1, and ventilator passive respiratory frequency for 90 times/minute.
[0081] After that, the mice were quickly transferred to the volume scan box, and the trachea was connected with the airway of the volume scan box. Starting AniRes2005 operating software to observe the airway pressure change curve and adjusting air quantity to mice to the level at which mouse's spontaneous breathing could not resist the effects of ventilator passive respiratory. After the pressure change curve became smooth and regular, the skin and muscle of the neck side of the mouse were separated, and the vein puncture was carried out to fix the needle so as to establish an intravenous drug administration passage. After intravenous injection of methacholine (MCH) excitation at sequential concentrations of 0.025, 0.05, 0.1, 0.2 mgMCH/kg, used the analysis software to simultaneously record mouse airway inspiratory resistance (RI), expiratory resistance (RE) and pulmonary adaptation (cdyn) change curves.
[0082] Digestion of Lung Tissue
[0083] The mice were anesthetized with pentobarbital sodium, and the heart was perfused with 5 ml PBS from the right atrium. The lung tissue was separated and cut to 1-2 mm.sup.2. The lung tissue was digested by 2 ml digestion buffer at 37 C. for 40 min. The formula of the digestion buffer. HBSS culture medium containing Collagenase I (125 U/ml) and DNase I (30 U/ml). After the digestion, the lung tissue was gently rubbed and filtered to obtain single cell suspension, and then separated by Percoll separation solution, so as to get the lymphocytes and mononuclear cells.
[0084] Flow Cytometry Method
[0085] For detecting various types of cell infiltration in the lung, cells were surface stained with the following specific monoclonal antibodies: FITC Anti-Mouse F4/80, PE-Cy7 Anti-Mouse Gr-1 APC-EF780 Anti-Mouse CD11b, APC Anti-Mouse CD45, PE Anti-Mouse Siglec F; the staining was at 4 for 30 min, and then the cells were fixed.
[0086] Analysis of T Cell Response Using ELISPOT Assay
[0087] At day 4 post challenge, the lung and spleen were taken, and lymphocytes were separated. Pre-coated IFN- ELISPOT plates after activation, were inoculated lung lymphocytes and spleen lymphocytes, and stimulated by P protein. The positive and negative controls were set up. Then the plates were incubated in the incubator for 48 hours, subsequently incubated with secondary antibody with AEC substrate color, with a multifunctional cell analysis and enzyme linked spot analysis system to compute plaques.
[0088] Histology
[0089] Lungs were fixed with formalin. After fixation, tissue sections were prepared following standard procedures. Some slides were stained with hematoxylin-eosin (H&E) to identify cellular infiltrates.
[0090] Results
[0091] Referring now to
[0092] Referring now to
[0093] Referring now to
[0094] Referring now to
[0095] Referring now to
[0096] Referring now to
[0097] Referring now to
[0098] While the present invention has been described with reference to particular embodiments, it will be understood that the embodiments are illustrative and that the invention scope is not limited. Alternative embodiments of the present invention will become apparent to those having ordinary skill in the art to which the present invention pertains. Such alternate embodiments are considered to be encompassed within the scope of the present invention. Accordingly, the scope of the present invention is defined by the appended claims and is supported by the foregoing description.
REFERENCES
[0099] Cullen L M, Blanco J C, Morrison T G. Cotton rat immune responses to virus-like particles containing the pre-fusion form of respiratory syncytial virus fusion protein. J Transl Med. 2015 Nov. 5; 13:350.
Delgado M F.sup.1, Coviello S, Monsalvo A C, Melendi G A, Hernandez J Z, Batalle J P, Diaz L, Trento A, Chang H Y, Mitzner W, Ravetch J, Melero J A, Irusta P M, Polack F P. Lack of antibody affinity maturation due to poor Toll-like receptor stimulation leads to enhanced respiratory syncytial virus disease. Nat Med. 2009 January; 15(1):3441.
Green C A, Scarselli E, Sande C J, Thompson A J, de Lara C M, Taylor K S, Haworth K, Del Sorbo M, Angus B, Siani L, Di Marco S, Traboni C, Folgori A, Colloca S, Capone S, Vitelli A, Cortese R, Klenerman P, Nicosia A, Pollard A J. Chimpanzee adenovirus- and MVA-vectored respiratory syncytial virus vaccine is safe and immunogenic in adults. Sci Transl Med. 7:300ra126 (2015)
Groothuis J R, King S J, Hogerman D A, Paradiso P R, Simoes E A. Safety and immunogenicity of a purified f protein respiratory syncytial virus (pfp-2) vaccine in seropositive children with bronchopulmonary dysplasia. The Journal of infections diseases. 1998; 177(2):467-469.
Hgglund S, Hu K, Blodrn K, Makabi-Parwu B, Gaillard A L, Ellencrona K, Chevret D, Hellman L, Bengtsson K L, Riffault S, Taylor G, Valarcher J F, Elout J F. Characterization of an experimental vaccine for bovine respiratory syncytial virus. Clin Vaccine Immunol. 21: 997-1004 (2014).
Kim K. H., Lee Y. T., Hwang H. S., Kwon Y. M., Jung Y. J., Lee Y., Lee J. S., Lee Y. N., Park S., Kang S. M. Alum adjuvant enhances protection against respiratory syncytial virus but exacerbates pulmonary inflammation in modulating multiple innate and adaptive immune cells PLOS ONE. 10: e0139916 (2015).
Lee S, Quan F S, Kwon Y, Sakamoto K, Kang S M, Compans R W, Moore M L. Additive protection induced by mixed a virus-like particles presenting respiratory syncytial virus fusion or attachment glycoproteins. Antiviral Res. 2014 November; 111:129-35.
Schepens B.sup.1, Sedeyn K.sup.2, Vande Ginste L.sup.2, De Baets S.sup.2, Schotsaert M.sup.2, Roose K.sup.2, Houspie L.sup.3, Van Ranst M.sup.3, Gilbert B.sup.4, van Rooijen N.sup.5, Fiers W.sup.2, Piedra P.sup.6 , Saelens X.sup.1. Protection and mechanism of action of a novel human respiratory syncytial virus vaccine candidate based on the extracellular domain of small hydrophobic protein. EMBO Mol Med. 2014 Oct. 8; 6(II);1436-54.
Yang K. and S. M. Varga. Mucosal vaccines against respiratory syncytial virus. Curr Opin Virol. 6:78-84 (2014).