IMMUNE CELLS EXPRESSING RECEPTOR SPECIFIC TO CLASS I MHC MOLECULE AND INTERFERING RNA FOR HLA GENE

20220370498 · 2022-11-24

    Inventors

    Cpc classification

    International classification

    Abstract

    The disclosure relates to immune cells for use in adoptive cell therapy that express an inhibitory receptor, useful for treating a disease or disorder, for example, cancer. The disclosure provides immune cells with reduced or eliminated HLA expression, that express an inhibitory receptor, methods of making same, shRNAs targeting HLA-A mRNA, and polynucleotides and vectors encoding same.

    Claims

    1. An immune cell comprising an inhibitory receptor comprising a ligand binding domain specific to a class I major histocompatibility complex (MHC-I) molecule, or a peptide-MHC complex thereof, wherein expression and/or function of a human leukocyte antigen (HLA) polypeptide, or an allele thereof, in said immune cell has been reduced or eliminated.

    2. The immune cell of claim 1, wherein the HLA allele is an HLA-A, HLA-B, HLA-C, or HLA-E allele.

    3. The immune cell of claim 2, wherein the HLA-A allele is an HLA-A*02, HLA-A*02:01, HLA-A*02:01:01, or HLA-A*02:01:01:01.

    4. The immune cell of claim 3, wherein the HLA-A allele is HLA-A*02:01:01:01.

    5. The immune cell of claim 1, comprising an interfering RNA, comprising a sequence complementary to a sequence of a HLA-A*02:01:01:01 mRNA.

    6. The immune cell of claim 5, wherein the interfering RNA is capable of inducing RNAi-mediated degradation of the HLA-A*02:01:01:01 mRNA.

    7. The immune cell of claim 6, wherein the interfering RNA is a short hairpin RNA (shRNA).

    8. The immune cell of claim 7, wherein the shRNA comprises a. a first sequence, having from 5′ to 3′ end a sequence complementary to the HLA-A*02:01:01:01 mRNA; and b. a second sequence, having from 5′ to 3′ end a sequence complementary to the first sequence, wherein the first sequence and the second sequence form the shRNA.

    9. The immune cell of claim 8, wherein the HLA-A*02:01:01:01 mRNA sequence comprises a coding sequence.

    10. The immune cell of claim 8, wherein the HLA-A*02:01:01:01 mRNA sequence comprises an untranslated region.

    11. The immune cell of claim 1, wherein the first sequence is 18, 19, 20, 21, or 22 nucleotides.

    12. The immune cell of claim 11, wherein the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-8794.

    13. The immune cell of claim 11, wherein the first sequence has GC content greater than or equal to 25% and less than 60%.

    14. The immune cell of claim 13, wherein the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-3990.

    15. The immune cell of claim 13, wherein the first sequence does not comprise 4 nucleotides of the same base or a run of seven C or G bases.

    16. The immune cell of claim 15, wherein the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-3508.

    17. The immune cell of claim 15, wherein the first sequence is selected from SEQ ID NOs: 400-678 or SEQ ID NOs: 400-485.

    18. The immune cell of claim 8, wherein the first sequence and second sequence are present on a single stranded polynucleotide, wherein the first sequence and second sequence are separated by 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides, wherein the 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides form a loop region in the shRNA.

    19. The immune cell of claim 18, wherein the loop region comprises a sequence selected from SEQ ID NOs: 8800-8813.

    20. The immune cell of claim 1, wherein the shRNA further comprises a 5′ flank sequence and a 3′ flank sequence, wherein the 5′ flank sequence is joined to the 5′ end of the first sequence, and wherein the 3′ flank sequence is joined to the 3′ end of the second sequence.

    21. The immune cell of claim 20, wherein the 5′ flank sequence is selected from SEQ ID NO: 8814-8816.

    22. The immune cell of claim 20, wherein the 3′ flank sequence is selected from SEQ ID NO: 8817-8819.

    23. The immune cell of claim 1, wherein the shRNA is operably linked to a promoter.

    24. The immune cell of claim 23, wherein the promoter is a U6 promoter, a wild-type H1 promoter, a wild-type 7SK promoter, or an Ef1a promoter.

    25. The immune cell of claim 24, wherein the promoter sequence is selected from SEQ ID NOs: 8826-8829.

    26. The immune cell of claim 1, wherein the immune cell is a T cell, B cell, or Natural Killer (NK) cell.

    27. The immune cell of claim 1, wherein the immune cell is autologous to a subject.

    28. The immune cell of claim 1, wherein the immune cell is allogeneic to a subject.

    29. The immune cell of claim 1, wherein the immune cell is non-natural.

    30.-32. (canceled)

    33. A pharmaceutical composition, comprising a plurality of the immune cells of claim 1.

    34.-35. (canceled)

    36. A method of treating cancer with an adoptive cell therapy, comprising administering to the subject a plurality of the immune cell of claim 1.

    37. (canceled)

    38. A vector comprising an interfering RNA, comprising an shRNA that targets a HLA-A*02:01:01:01 mRNA sequence, wherein the shRNA comprises a. a first sequence, having from 5′ to 3′ a sequence complementary to the HLA-A*02:01:01:01 mRNA; and b. a second sequence, having from 5′ to 3′ end a sequence complementary to the first sequence, wherein the first sequence and the second sequence form the shRNA.

    39.-62. (canceled)

    63. A method of manufacturing a composition comprising immune cells with reduced autocrine binding/signaling comprising: a. providing immune cells from a subject suffering from or at risk for cancer or a hematological malignancy; and b. transducing and/or transfecting the immune cell with the vector of claim 38.

    64.-65. (canceled)

    66. A method of treating a subject in need thereof comprising: a. providing immune cells from a subject suffering from or at risk for cancer or a hematological malignancy b. transducing the immune cell with the vector of claim 38; and c. administering the immune cell to the subject.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0015] A better understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention are utilized, and the accompanying drawings of which:

    [0016] FIG. 1 is a diagram illustrating hemizygous tumor cells forming a tumor against a background of heterozygous cells that compose normal tissue. The hemizygous tumor cells express only Target A, and have lost Target B due to loss of heterozygosity (LOH), while the normal cells express both Target A and Target B. This genetic difference can be exploited to create tumor-selective cytotoxic therapeutics that are blocked by Target B and activated by Target A, thereby selectively killing tumors.

    [0017] FIG. 2A is a diagram showing an exemplary architecture of a dual targeted therapeutic based on LOH in tumors. In this example, there is cell-based integration of activator and blocker signals from two receptors.

    [0018] FIG. 2B is a series of diagrams showing various activator and receptor formats and combinations.

    [0019] FIG. 3A is a pair of diagrams that show exemplary dual receptor constructs of the disclosure in TCR format. In this example, activator and inhibitor (blocker) ligand binding domains (LBDs) are each fused separately to the CD3 gamma subunit of the TCR.

    [0020] FIG. 3B is diagram and a table that show exemplary dual receptor constructs of the disclosure in CAR format. Exemplary ITIM and inhibitor domains of the inhibitor CAR are shown in the table at right.

    [0021] FIG. 4A is a set of plots showing that engineered receptors with HLA-A*02 specific blocker ligand binding domains (LBDs) lose blocking ability in the presence of A*02+ donors (1) and A*02-blocker is expressed but occupied by HLA-A*02 cis interaction (2). An HLA-A*02-blocker binds to HLA-A*02 in cis and hinders blocker function in Jurkat and in primary T cells.

    [0022] FIG. 4B is a diagram showing an autocrine signaling mechanism in an immune cell expressing an inhibitory receptor. The diagram shows that knockout of natively expressed MHC class I polypeptides reduces inhibition mediated by autocrine signaling.

    [0023] FIG. 5 is a schematic showing illustrative regions of the HLA-A*02 mRNA targeted by interfering shRNAs of the disclosure.

    [0024] FIG. 6 is a series of histograms and plots derived from fluorescence activated cell sorting (FACS) analysis of HLA-A*02 expressing Jurkat cells transfected with shRNA of the disclosure that target coding sequence (CDS) region of the HLA-A*02 mRNA. The shRNA knockdown efficiency of HLA-A*02 expression was measured by staining Jurkat cells with fluorescently labeled anti-HLA-A*02 antibody (HLA-A*02), following transfection with shRNA.

    [0025] FIG. 7 is a series of histograms and plots derived from fluorescence activated cell sorting (FACS) analysis of Jurkat cells co-transfected with HLA-A*02 and shRNA of the disclosure that target the 5′ and 3′ untranslated regions of HLA-A*02 mRNA. The shRNA-mediated reduction of HLA-A, HLA-B, and HLA-C(HLA Class I) expression was measured by staining Jurkat cells with fluorescently labeled anti-HLA-A/B/C antibody.

    [0026] FIG. 8 is a series of plots and histograms showing Jurkat cell activation and the binding capacity of the HLA-A*02 blocker module to its ligand, pMHC tetramer, in the presence (right) and absence (left) of HLA-A targeting shRNA.

    DETAILED DESCRIPTION

    [0027] The inventors have developed a solution to the problems of identifying suitable therapeutic targets and achieving cell selectivity in the treatment of diseases, particularly cancers, with adoptive cellular therapy. The primary object of the invention is an immune cell used in adoptive cell therapy that has reduced autocrine signaling. The immune cell can target cells, for example, based on loss of heterozygosity (FIG. 1). The immune cells use a two receptor system, in which activator and inhibitory signals are integrated at the cellular level within the immune cells (FIGS. 2A, 2B, 3A and 3B), by which selective targeting of tumor but not non-tumor cells is achieved. Differences in expression of surface proteins that are absent or lost in target cells but present in normal cells are thereby converted to a targeted anti-tumor cell therapy. These differences improve targeting by cell therapies, and protect normal cells from the cytotoxic effects of effector cells used for adoptive cell therapies. The two receptor system described herein can be expressed in autologous immune cells specifically engineered to decrease complications such as inhibitory signals between the immune cells used in the adoptive therapy. The inhibitory signals described herein, in some embodiments, are mediated by an inhibitory receptor, expressed by immune cells described herein, comprising a ligand binding domain specific to a class I major histocompatibility complex (MHC-I) molecule, or a peptide-MHC complex thereof. However, native expression of an MHC-I molecule by the immune cells can potentially bind to and activate or inactivate the inhibitory receptor. Such binding and activation/inactivation can occur through both inter- and intra-cellular interactions. Inter-cellular binding and activation/inactivation occurs when a natively expressed MHC-I molecule on immune cells binds an inhibitory receptor on a separate engineered immune cell expressing an inhibitory receptor. Intra-cellar inhibitory receptor binding can occur when, for example, the inhibitory receptor binds to an MHC-I molecule natively expressed on the same immune cell (FIGS. 4A and 4B). As described herein, both the inter- and intra-cellular binding/signaling of the inhibitory receptor on or among engineered immune cells are referred to as autocrine signaling or binding. Both intra- and inter-cellular inactivation can result in undesired inhibition at, for example, the site of a target activator or in a preparation or composition comprising a plurality of immune cells expressing the inhibitory receptor. The inventors of the present disclosure have recognized that the undesired autocrine binding/signaling can be suppressed if the immune cell has reduced or eliminated human leukocyte antigen (HLA) expression or function. HLA expression or function can be reduced or eliminated by targeting an HLA-A gene or allele thereof, e.g. HLA-A*02, with an interfering RNA molecule. (FIG. 4B). In some embodiments, the immune cell comprises an interfering RNA, e.g. an shRNA complementary to a portion of the HLA-A messenger RNA (mRNA) transcript. HLA-A is a component of MHC class I complex. In the MHC class I complex, B2M binds the α chain to form a complex on the cell surface. Viewed across the cell membrane with the cytoplasm down, the α1 domain is directly above B2M, and α1 and B2M lie adjacent to α2 and α3, the latter of which is linked to a transmembrane domain. Without wishing to be bound by theory, it is thought that reduced or eliminated expression or function of HLA-A interferes with the formation of the MHC class I complex, leading to immune cells with greatly reduced or absent MHC class I on the cell surface.

    [0028] The immune cell described herein comprises an inhibitory receptor comprising a binding domain specific to a class I major histocompatibility complex (MHC-I) molecule, or a peptide-MHC complex thereof, wherein expression and/or function of human leukocyte antigen (HLA) in said immune cell has been reduced or eliminated. In particular embodiments, the immune cells comprise an interfering RNA, comprising a sequence complementary to a sequence of a HLA-A*02 mRNA. In some embodiments, the interfering RNA is capable of inducing RNA interference (RNAi) mediated degradation of the HLA-A*02 mRNA. The immune cells described herein, according to some embodiments, comprise a short hairpin RNA. In some embodiments, the shRNA comprises a first sequence and a second sequence, wherein the first sequence, has from 5′ to 3′ a sequence complementary to the HLA-A*02 mRNA; and wherein the second sequence, has from 5′ to 3′ end a sequence complementary to the first sequence, wherein the first sequence and second sequence form the shRNA. In an immune cell comprising the shRNA, the HLA-A gene product is reduced or eliminated in expression and/or function. In some embodiments, an immune cell comprising the shRNA has reduced or eliminated expression or function of an MHC-I molecule.

    [0029] In one aspect, the disclosure provides vectors for expressing the shRNA described herein in an immune cell. In another aspect, the disclosure provides methods of manufacturing the immune cells described herein.

    [0030] In one aspect, disclosure provides compositions comprising the immune cells described herein.

    [0031] In one aspect, the disclosure provides methods of treatment comprising administering the immune cells described herein to a subject in need thereof. In another aspect, the disclosure provides compositions comprising the immune cells described herein for use as a medicament in the treatment of a subject in need. In some embodiments, the subject suffers from or is at risk of cancer or a hematological malignancy.

    [0032] The approach disclosed herein uses, in some embodiments, two engineered receptors, the first comprising a ligand binding domain for an activator ligand and the second comprising a ligand binding domain for an inhibitor ligand, which is selectively activated in target cells using an “AND NOT” Boolean logic (FIGS. 2A, 2B, 3A and 3B). Normal cells express both the activator and the inhibitor ligands, but activation of effector cells through the first receptor is blocked by binding of the second receptor comprising the inhibitor LBD to the inhibitor ligand, which exerts a protective effect and dominates the activity of the first, activator receptor. In contrast, in target cells that express the activator ligand but do not express the inhibitor ligand, binding of the activator ligand by the activator LBD leads to activation of the cell. Advantages of the dual activator/inhibitor receptor strategy of the instant disclosure include the ability to tune the activator and inhibitor combination to create a potent, but specific tumor-targeted adoptive cell therapy. Further, this approach can overcome the challenges of a variable effector to target cell ratio (E:T ratio) in the body, and the potentially massive excess of normal versus tumor cells seen when targeting tumor cells with adoptive cell therapies (e.g., 10.sup.13 normal cells versus 10.sup.9 tumor cells). Still further, the inventors have identified activators and inhibitors that cover large potential patient combinations, rendering this a commercially feasible approach.

    [0033] Specificity of the adoptive cell therapy for a specific cell type can be achieved through the different activities of the first and second receptors, and the differential expression of the first and second ligands for the first and second receptors, respectively. Binding of the first ligand to the first receptor provides an activation signal, while binding of the second ligand to the second receptor prevents or reduces activation of effector cells even in the presence of the first ligand. The first ligand can be expressed more broadly than the second ligand, for example in both cells targeted by an adoptive cell therapy, and in healthy cells that are not target cells for an adoptive cell therapy (non-target cells). In contrast, the second ligand is expressed in the non-target cells, and is not expressed in the target cells. Only the target cells and not the non-target express the first and not the second ligand, thereby activating effector cells comprising the dual receptors of the disclosure in the presence of these cells.

    [0034] The disclosure provides compositions and methods for targeting cells (e.g. tumor cells) based on loss of heterozygosity through use of two engineered receptors. The two engineered receptors, one an inhibitor and one activator, each comprise a different ligand binding domain that recognizes a different ligand. Differences in expression of the activator and inhibitory ligands are used to selectively activate effector cells expressing the two receptors when only the first, activator ligand is present. In some embodiments, one of the receptors activates the cell and other receptor inhibits the cell when each binds its cognate ligand. In some embodiments, the receptor comprising the second, inhibitor ligand binding domain dominates signaling so that if a target cell expresses both targets, the result is inhibition of the effector cell. Only when the inhibitory target is absent from the cell, does the first, activator ligand induce activation of the effector cell through the receptor comprising the first, activator ligand binding domain.

    [0035] Any widely expressed cell surface molecule, for example a cell adhesion molecule, a cell-cell signaling molecule, an extracellular domain, a molecule involved in chemotaxis, a glycoprotein, a G protein-coupled receptor, a transmembrane, a receptor for a neurotransmitter or a voltage gated ion channel, or a peptide antigen of any of these, can be used as a first, activator ligand. As a further example, the activator ligand can be the transferrin receptor (TFRC). Any cell surface molecule not expressed on the surface of the target cell can be used as a second ligand. In those embodiments where an engineered receptor is used in the adoptive cell therapy to treat cancer, and the target cells are cancer cells, a second, inhibitory ligand may be chosen based on the loss of heterozygosity of the second ligand in cancer cells. Exemplary genes whose expression is frequently lost in cancer cells, for example due to mutations leading to loss of heterozygosity, include HLA class I alleles, minor histocompatibility antigens (MiHAs), and Y chromosome genes. In some embodiments, the HLA class I allele comprises HLA-A*02.

    [0036] The disclosure further provides vectors and polynucleotides encoding the engineered receptors described herein.

    [0037] The disclosure further provides methods of making immune cell populations comprising the engineered receptors described herein, and methods of treating disorders using the same.

    Definitions

    [0038] Prior to setting forth this disclosure in more detail, it may be helpful to an understanding thereof to provide definitions of certain terms to be used herein.

    [0039] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which the invention belongs. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of particular embodiments, preferred embodiments of compositions, methods and materials are described herein. For the purposes of the present disclosure, the following terms are defined below. Additional definitions are set forth throughout this disclosure.

    [0040] The articles “a,” “an,” and “the” are used herein to refer to one or to more than one (i.e., to at least one, or to one or more) of the grammatical object of the article. By way of example, “an element” means one element or one or more elements.

    [0041] The use of the alternative (e.g., “or”) should be understood to mean either one, both, or any combination thereof of the alternatives.

    [0042] The term “and/or” should be understood to mean either one, or both of the alternatives.

    [0043] Throughout this specification, unless the context requires otherwise, the words “comprise”, “comprises” and “comprising” will be understood to imply the inclusion of a stated step or element or group of steps or elements but not the exclusion of any other step or element or group of steps or elements. By “consisting of” is meant including, and limited to, whatever follows the phrase “consisting of.” Thus, the phrase “consisting of” indicates that the listed elements are required or mandatory, and that no other elements may be present. By “consisting essentially of” is meant including any elements listed after the phrase, and limited to other elements that do not interfere with or contribute to the activity or action specified in the disclosure for the listed elements. Thus, the phrase “consisting essentially of” indicates that the listed elements are required or mandatory, but that no other elements are present that materially affect the activity or action of the listed elements.

    [0044] Reference throughout this specification to “one embodiment,” “an embodiment,” “a particular embodiment,” “a related embodiment,” “a certain embodiment,” “an additional embodiment,” “some embodiments,” or “a further embodiment” or combinations thereof means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment. Thus, the appearances of the foregoing phrases in various places throughout this specification are not necessarily all referring to the same embodiment. Furthermore, the particular features, structures, or characteristics may be combined in any suitable manner in one or more embodiments. It is also understood that the positive recitation of a feature in one embodiment, serves as a basis for excluding the feature in a particular embodiment.

    [0045] As used herein, the term “about” or “approximately” refers to a quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length that varies by as much as 15%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2% or 1% to a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length. In one embodiment, the term “about” or “approximately” refers a range of quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length±15%, ±10%, ±9%, ±8%, ±7%, ±6%, ±5%, ±4%, ±3%, ±2%, or ±1% about a reference quantity, level, value, number, frequency, percentage, dimension, size, amount, weight or length.

    [0046] As used herein, the term “isolated” means material that is substantially or essentially free from components that normally accompany it in its native state. In particular embodiments, the term “obtained” or “derived” is used synonymously with isolated.

    [0047] The terms “subject,” “patient” and “individual” are used interchangeably herein to refer to a vertebrate, preferably a mammal, more preferably a human. Tissues, cells, and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed. A “subject,” “patient” or “individual” as used herein, includes any animal that exhibits pain that can be treated with the vectors, compositions, and methods contemplated herein. Suitable subjects (e.g., patients) include laboratory animals (such as mouse, rat, rabbit, or guinea pig), farm animals, and domestic animals or pets (such as a cat or dog). Non-human primates and, preferably, human patients, are included.

    [0048] As used herein “treatment” or “treating,” includes any beneficial or desirable effect, and may include even minimal improvement in symptoms. “Treatment” does not necessarily indicate complete eradication or cure of the disease or condition, or associated symptoms thereof.

    [0049] As used herein, “prevent,” and similar words such as “prevented,” “preventing” etc., indicate an approach for preventing, inhibiting, or reducing the likelihood of a symptom of disease. It also refers to delaying the onset or recurrence of a disease or condition or delaying the occurrence or recurrence of the symptoms of a disease. As used herein, “prevention” and similar words also includes reducing the intensity, effect, symptoms and/or burden of disease prior to onset or recurrence.

    [0050] As used herein, the term “amount” refers to “an amount effective” or “an effective amount” of a virus to achieve a beneficial or desired prophylactic or therapeutic result, including clinical results.

    [0051] A “prophylactically effective amount” refers to an amount of a virus effective to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount is less than the therapeutically effective amount.

    [0052] A “therapeutically effective amount” of a virus or cell may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the virus or cell to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the virus or cell are outweighed by the therapeutically beneficial effects. The term “therapeutically effective amount” includes an amount that is effective to “treat” a subject (e.g., a patient).

    [0053] An “increased” or “enhanced” amount of a physiological response, e.g., electrophysiological activity or cellular activity, is typically a “statistically significant” amount, and may include an increase that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the level of activity in an untreated cell.

    [0054] A “decrease” or “reduced” amount of a physiological response, e.g., electrophysiological activity or cellular activity, is typically a “statistically significant” amount, and may include an decrease that is 1.1, 1.2, 1.5, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30 or more times (e.g., 500, 1000 times) (including all integers and decimal points in between and above 1, e.g., 1.5, 1.6, 1.7. 1.8, etc.) the level of activity in an untreated cell.

    [0055] By “maintain,” or “preserve,” or “maintenance,” or “no change,” or “no substantial change,” or “no substantial decrease” refers generally to a physiological response that is comparable to a response caused by either vehicle, or a control molecule/composition. A comparable response is one that is not significantly different or measurable different from the reference response.

    [0056] In general, “sequence identity” or “sequence homology” refers to an exact nucleotide-to-nucleotide or amino acid-to-amino acid correspondence of two polynucleotides or polypeptide sequences, respectively. Typically, techniques for determining sequence identity include determining the nucleotide sequence of a polynucleotide and/or determining the amino acid sequence encoded thereby, and comparing these sequences to a second nucleotide or amino acid sequence. Two or more sequences (polynucleotide or amino acid) can be compared by determining their “percent identity.” The percent identity of two sequences, whether nucleic acid or amino acid sequences, is the number of exact matches between two aligned sequences divided by the length of the shorter sequences and multiplied by 100. Percent identity may also be determined, for example, by comparing sequence information using the advanced BLAST computer program, including version 2.2.9, available from the National Institutes of Health. The BLAST program is based on the alignment method of Karlin and Altschul, Proc. Natl. Acad. Sci. USA 87:2264-2268 (1990) and as discussed in Altschul, et al., J. Mol. Biol. 215:403-410 (1990); Karlin And Altschul, Proc. Natl. Acad. Sci. USA 90:5873-5877 (1993); and Altschul et al., Nucleic Acids Res. 25:3389-3402 (1997). Briefly, the BLAST program defines identity as the number of identical aligned symbols (generally nucleotides or amino acids), divided by the total number of symbols in the shorter of the two sequences. The program may be used to determine percent identity over the entire length of the proteins being compared. Default parameters are provided to optimize searches with short query sequences in, for example, with the blastp program. The program also allows use of an SEG filter to mask-off segments of the query sequences as determined by the SEG program of Wootton and Federhen, Computers and Chemistry 17:149-163 (1993). Ranges of desired degrees of sequence identity are approximately 80% to 100% and integer values therebetween. Typically, the percent identities between a disclosed sequence and a claimed sequence are at least 80%, at least 85%, at least 90%, at least 95%, or at least 98%.

    [0057] The term “exogenous” is used herein to refer to any molecule, including nucleic acids, protein or peptides, small molecular compounds, and the like that originate from outside the organism. In contrast, the term “endogenous” refers to any molecule that originates from inside the organism (i.e., naturally produced by the organism).

    [0058] The term “MOI” is used herein to refer to multiplicity of infection, which is the ratio of agents (e.g. viral particles) to infection targets (e.g. cells). All publications and patents mentioned herein are hereby incorporated by reference in their entirety as if each individual publication or patent was specifically and individually indicated to be incorporated by reference. In case of conflict, the present application, including any definitions herein, will control. However, mention of any reference, article, publication, patent, patent publication, and patent application cited herein is not, and should not be taken as an acknowledgment, or any form of suggestion, that they constitute valid prior art or form part of the common general knowledge in any country in the world.

    [0059] In the present description, any concentration range, percentage range, ratio range, or integer range is to be understood to include the value of any integer within the recited range and, when appropriate, fractions thereof (such as one tenth and one hundredth of an integer), unless otherwise indicated. The term “about”, when immediately preceding a number or numeral, means that the number or numeral ranges plus or minus 10%.

    [0060] As used herein, a “target cell” refers to cell that is targeted by an adoptive cell therapy. For example, a target cell can be cancer cell, which can be killed by the transplanted T cells of the adoptive cell therapy. Target cells of the disclosure express an activator ligand as described herein, and do not express an inhibitor ligand.

    [0061] The present description includes artificial receptors with activating and inhibiting activity. The artificial receptors are sometimes referred to as “activator receptors,” “inhibitor receptors,” or “engineered receptors.” Inhibitor receptors are sometimes referred to as “blockers,” “blocking receptors,” and the like.

    [0062] “RNAi” or “RNA interference” refers to the process of sequence-specific post-transcriptional gene silencing, mediated by double-stranded RNA (dsRNA). Duplex RNAs such as siRNA (small interfering RNA), miRNA (micro RNA), shRNA (short hairpin RNA), ddRNA (DNA-directed RNA), piRNA (Piwi-interacting RNA), or rasiRNA (repeat associated siRNA) and modified forms thereof are all capable of mediating RNA interference. These dsRNA molecules may be commercially available or may be designed and prepared based on known sequence information. The anti-sense strand of these molecules can include RNA, DNA, PNA, or a combination thereof. DNA/RNA chimeric polynucleotides include, but are not limited to, a double-strand polynucleotide composed of DNA and RNA that inhibits the expression of a target gene. dsRNA molecules can also include one or more modified nucleotides, as described herein, which can be incorporated on either or both strands.

    [0063] In RNAi gene silencing or knockdown, dsRNA comprising a first (anti-sense) strand that is complementary to a portion of a target gene and a second (sense) strand that is fully or partially complementary to the first anti-sense strand is introduced into an organism. After introduction into the organism, the target gene-specific dsRNA is processed into relatively small fragments (siRNAs) and can subsequently become distributed throughout the organism, decrease messenger RNA of target gene, leading to a phenotype that may come to closely resemble the phenotype arising from a complete or partial deletion of the target gene.

    [0064] Certain dsRNAs in cells can undergo the action of Dicer enzyme, a ribonuclease III enzyme. Dicer can process the dsRNA into shorter pieces of dsRNA, i.e. siRNAs. RNAi also involves an endonuclease complex known as the RNA induced silencing complex (RISC). Following cleavage by Dicer, siRNAs enter the RISC complex and direct cleavage of a single stranded RNA target having a sequence complementary to the anti-sense strand of the siRNA duplex. The other strand of the siRNA is the passenger strand. Cleavage of the target RNA takes place in the middle of the region complementary to the anti-sense strand of the siRNA duplex. siRNAs can thus down regulate or knock down gene expression by mediating RNA interference in a sequence-specific manner.

    [0065] As used herein, “target gene” or “target sequence” refers to a gene or gene sequence whose corresponding RNA is targeted for degradation through the RNAi pathway using dsRNAs or siRNAs as described herein. To target a gene, for example using an siRNA, the siRNA comprises an anti-sense region complementary to, or substantially complementary to, at least a portion of the target gene or sequence, and sense strand complementary to the anti-sense strand. Once introduced into a cell, the siRNA directs the RISC complex to cleave an RNA comprising a target sequence, thereby degrading the RNA.

    Gene Targets

    [0066] In some embodiments, the immune cells have reduced or eliminated expression or function of a target gene. Exemplary target genes are described below.

    MHC Class I Genes and Polypeptides

    [0067] The major histocompatibility complex (MHC) is a locus in the vertebrate genome that encodes a set of polypeptides required for the adaptive immune system. Among these are MHC class I polypeptides that include HLA-A, HLA-B, and HLA-C and alleles thereof. MHC class I alleles are highly polymorphic and expressed in all nucleated cells. MHC class I polypeptides encoded by HLA-A, HLA-B, and HLA-C and alleles thereof form heterodimers with β2 microglobulin (B2M) and present in complex with antigens on the surface of cells. In some embodiments, the immune cells of the disclosure are inactivated by an inhibitor ligand comprising an MHC class I polypeptide, e.g. HLA-A, HLA-B, and HLA-C and alleles thereof. HLA-A alleles can be, for example and without limitation, HLA-A*02, HLA-A*02:01, HLA-A*02:01:01, HLA-A*02:01:01:01, and/or any gene that encodes protein identical or similar to HLA-A*02 protein. Thus, to prevent autocrine signaling/binding as described herein, it is desirable to eliminate or reduce expression of polypeptides encoded by HLA-A, HLA-B, and HLA-C and alleles thereof in the immune cells.

    [0068] In some embodiments, the immune cells described herein are modified to inactivate, or reduce or eliminate expression or function of an endogenous gene encoding an allele of an endogenous MHC class I polypeptide. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A, HLA-B, and/or HLA-C. HLA-A, HLA-B and HLA-C are encoded by the HLA-A, HLA-B and HLA-C loci. Each of HLA-A, HLA-B and HLA-C includes many variant alleles, all of which are envisaged as within the scope of the instant disclosure. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02:01. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02:01:01. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02:01:01:01.

    Target Gene Sequences

    [0069] The disclosure provides an immune cell comprising an inhibitory receptor comprising a ligand binding domain specific to a class I major histocompatibility complex (MHC-I) molecule, or a peptide-MHC complex thereof, wherein expression and/or function of human leukocyte antigen (HLA) in said immune cell has been reduced or eliminated. In some embodiments, the immune cell comprises an interfering RNA, comprising a sequence complementary an RNA sequence transcribed from the HLA gene.

    [0070] In some embodiments, the target gene is an allele of an endogenous MHC class I polypeptide specifically bound by the inhibitory receptor. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A, HLA-B, HLA-C, or a combination thereof. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A. HLA-A is a polymorphic gene whose various alleles may also be target genes for modification. The alleles may also be referred to as genes, and can include, for example, the HLA-A*02, HLA-A*02:01, HLA-A*02:01:01, and/or the HLA-A*02:01:01:01 alleles. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02:01. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02:01:01. In some embodiments, the gene encoding the MHC class I polypeptide is HLA-A*02:01:01:01.

    [0071] Interfering RNAs of the disclosure target and bind to a target sequence through base pair complementarity. The interfering RNA has a complementary sequence to any region of a target gene sequence that is transcribed into RNA. In some embodiments, the target gene is HLA. Transcribed RNA can include intronic regions (introns), expressed regions (exons), untranslated regions (UTRs), coding sequences (CDS), or any other region of the target gene that undergoes transcription. Transcribed RNA can include primary transcripts, pre-mRNA, mature mRNA, and/or mRNA splice variants. RNA can include regulatory signals, such as polyA sites or polyA signal sequences. Transcribed RNA can include any non-coding region of the target gene that is not transcribed as part of an mRNA transcript, e.g. long noncoding RNA (lnRNA) or micro RNA (miRNA). Any transcribed region of the target gene may be targeted for the purpose of reducing or eliminating expression of the target gene in the immune cells described herein. Delivery of interfering RNA can be accomplished using any method known in the art to target gene transcripts that results in altered, disrupted, reduced, or eliminated expression or function the target gene or gene product.

    [0072] In some embodiments, the target gene is an HLA gene. In some embodiments, the HLA gene is the HLA-A gene. When used herein as a reference to a target gene or an associated transcript (e.g., mRNA), the HLA may refer to HLA-A, the HLA-A*02 allele, the HLA-A*02:01 allele, the HLA-A*02:01:01 allele, and/or the HLA-A*02:01:01:01 allele. In some embodiments, the HLA gene is the HLA-A*02 allele. In some embodiments, the HLA gene is the HLA-A*02:01 allele. In some embodiments, the HLA gene is the HLA-A*02:01:01 allele. In some embodiments, the HLA gene is the HLA-A*02:01:01:01 allele. In some embodiments, the interfering RNA is complementary to at least a portion of an mRNA transcribed from an HLA gene. In some embodiments, the mRNA is transcribed from an HLA-A*02 allele. In some embodiments, the mRNA is transcribed from an HLA-A*02:01 allele. In some embodiments, the mRNA is transcribed from an HLA-A*02:01:01 allele. In some embodiments, the mRNA is transcribed from an HLA-A*02:01:01:01 allele. In some embodiments, the mRNA comprises a coding sequence. In some embodiments, the mRNA sequence comprises an untranslated region.

    [0073] Gene sequences for the target genes described herein are known in the art. The sequences can be found at public databases, such as NCBI GenBank or the NCBI nucleotide database. Sequences may be found using gene identifiers, for example, the HLA-A gene has NCBI Gene ID: 3105, the HLA-B gene has NCBI Gene ID: 3106, and the HLA-C gene has NCBI Gene ID: 3107. Gene sequences may also be found by searching public databases using keywords. For example, HLA-A alleles may be found in the NCBI nucleotide database by searching keywords, “HLA-A*02”, “HLA-A*02:01”, “HLA-A*02:01:01”, or “HLA-A*02:01:01:01.” These sequences can be used for targeting in various gene editing techniques known in the art. Table 1 provides non-limiting illustrative sequences for the target HLA-A allele gene sequences targeted for modification as described herein.

    TABLE-US-00001 TABLE 1 Illustrative Target HLA-A Allele Gene Sequences Gene SEQ ID NO Identifier HLA-A*02 8795 GenBank: LK021978.1 HLA-A*02:01 8796 GenBank: MK953623.1 HLA-A*02:01:01 8797 GenBank: LT963297.1 HLA-A*02:01:01:01 8798 GenBank: HG794376.1 HLA-A*02:01:01:01 mRNA 8799

    Illustrative Interfering RNAs

    [0074] The disclosure provides interfering RNAs. The double stranded RNA molecule of the invention may be in the form of any type of RNA interference molecule known in the art. In some embodiments, the double stranded RNA molecule is a small interfering RNA (siRNA). In other embodiments, the double stranded RNA molecule is a short hairpin RNA (shRNA) molecule. In other embodiments, the double stranded RNA molecule is a Dicer substrate that is processed in a cell to produce an siRNA. In other embodiments the double stranded RNA molecule is part of a microRNA precursor molecule.

    [0075] In some embodiments, the shRNA is a length to be suitable as a Dicer substrate, which can be processed to produce a RISC active siRNA molecule. See, e.g., Rossi et al., US2005/0244858.

    [0076] A Dicer substrate double stranded RNA (e.g. a shRNA) can be of a length sufficient that it is processed by Dicer to produce an active siRNA, and may further include one or more of the following properties: (i) the Dicer substrate shRNA can be asymmetric, for example, having a 3′ overhang on the anti-sense strand, (ii) the Dicer substrate shRNA can have a modified 3′ end on the sense strand to direct orientation of Dicer binding and processing of the dsRNA to an active siRNA, for example the incorporation of one or more DNA nucleotides, and (iii) the first and second strands of the Dicer substrate ds RNA can from 21-30 bp in length.

    [0077] In some embodiments, the interfering RNAs comprise a sequence complementary to a sequence of a HLA-A*02 mRNA. In some embodiments, the interfering RNA is capable of inducing RNAi-mediated degradation of the HLA-A*02 mRNA. In some embodiments, the HLA-A*02 mRNA sequence comprises a coding sequence. In some embodiments, the HLA-A*02 mRNA sequence comprises an untranslated region.

    [0078] In some embodiments, the interfering RNA is a short hairpin RNA (shRNA). In some embodiments, the shRNA comprises a first sequence, having from 5′ to 3′ end a sequence complementary to the HLA-A*02 mRNA; and a second sequence, having from 5′ to 3′ end a sequence complementary to the first sequence, wherein the first sequence and second sequence form the shRNA.

    [0079] In some embodiments, the first sequence is 18, 19, 20, 21, or 22 nucleotides. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-8794. In some embodiments, the first sequence has GC content greater than or equal to 25% and less than 60%. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-3990. In some embodiments, the first sequence does not comprise four nucleotides of the same base or a run of seven C or G nucleotide bases. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-3508. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-678. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-485. Illustrative target HLA sequences complementary to the first sequence are shown in Table 2.

    TABLE-US-00002 TABLE 2 Illustrative target HLA sequences complementary to first sequence SEQ ID NO Sequence 400 CTTCTTCCTTCCCTATTAAAA 401 TCTCACTCCATGAGGTATTTC 402 CTCTCACTCCATGAGGTATTT 403 GAGGAGGAAGAGCTCAGATAG 404 GCTCTCACTCCATGAGGTATT 405 AGGATTACATCGCCCTGAAAG 406 ACACCGTCCAGAGGATGTATG 407 AGGGTCCTTCTTCCTGGATAC 408 CCTACGACGGCAAGGATTACA 409 TCACTCCATGAGGTATTTCTT 410 CTACGACGGCAAGGATTACAT 411 CTCACTCCATGAGGTATTTCT 412 GGAGGAAGAGCTCAGATAGAA 413 CACACCGTCCAGAGGATGTAT 414 CACGCTGTCTCTGACCATGAA 415 CTGGACAGGAGCAGAGATACA 416 TGGAGGAGGAAGAGCTCAGAT 417 GGCTCTCACTCCATGAGGTAT 418 CATCTCTGTCTCAACTTCATG 419 TACGACGGCAAGGATTACATC 420 GGATTACATCGCCCTGAAAGA 421 GATTACATCGCCCTGAAAGAG 422 CTCAGACCACCAAGCACAAGT 423 TCACACCGTCCAGAGGATGTA 424 ACTCCATGAGGTATTTCTTCA 425 CACTCCATGAGGTATTTCTTC 426 CCATGAGGTATTTCTTCACAT 427 ACTTCTTCCTTCCCTATTAAA 428 GTGTCTCTCACAGCTTGTAAA 429 CTGTGTTCGTGTAGGCATAAT 430 TGTGTTCGTGTAGGCATAATG 431 TAACTTCTTCCTTCCCTATTA 432 TCTGGACAGGAGCAGAGATAC 433 TTGCTGGCCTGGTTCTCTTTG 434 TGTCTCTCACAGCTTGTAAAG 435 ACTTGAAGAACCCTGACTTTG 436 GAAGAACCCTGACTTTGTTTC 437 TCTGTGTTCGTGTAGGCATAA 438 CATGGTGCACTGAGCTGTAAC 439 GTAACTTCTTCCTTCCCTATT 440 CATGTGCAGCATGAGGGTTTG 441 TTGTTCCTGCCCTTCCCTTTG 442 ACCCAGTTCTCACTCCCATTG 443 GGGTTTCCAGAGAAGCCAATC 444 TTCTCCCTCTCCCAACCTATG 445 GTCTCTCACAGCTTGTAAAGT 446 TGTGTCTCTCACAGCTTGTAA 447 GAGGAAGAGCTCAGATAGAAA 448 TGAAGAACCCTGACTTTGTTT 449 TTGAAGAACCCTGACTTTGTT 450 GTGTTCGTGTAGGCATAATGT 451 TGGTGCACTGAGCTGTAACTT 452 CTCCCTCTCCCAACCTATGTA 453 AGGAGGAAGAGCTCAGATAGA 454 ACCTATGTAGGGTCCTTCTTC 455 GGGTCCTTCTTCCTGGATACT 456 GGTCCTTCTTCCTGGATACTC 457 GTCCTTCTTCCTGGATACTCA 458 AAGCCAATCAGTGTCGTCGCG 459 AAGAGGACCTGCGCTCTTGGA 460 AAGTGTGAGACAGCTGCCTTG 461 AAGGCACCTGCATGTGTCTGT 462 AATCATCTTTCCTGTTCCAGA 463 AAAGGCACCTGCATGTGTCTG 464 AAAGAGGACCTGCGCTCTTGG 465 AAACGCATATGACTCACCACG 466 GGAAGAGCTCAGATAGAAA 467 GGGAGACACGGAAAGTGAA 468 CACCTGCCATGTGCAGCATGA 469 GGAGATCACACTGACCTGGCA 470 GGATTACATCGCCCTGAAAG 471 GCAGGAGGGTCCGGAGTATT 472 GGACGGGGAGACACGGAAAG 473 GAAAGTGAAGGCCCACTCA 474 GATACCTGGAGAACGGGAAG 475 GCTGTGGTGGTGCCTTCTGG 476 GCTACTACAACCAGAGCGAG 477 GTGGCTCCGCAGATACCTG 478 GCCAATCAGTGTCGTCGCG 479 GAGGACCTGCGCTCTTGGA 480 GTGTGAGACAGCTGCCTTG 481 GGCACCTGCATGTGTCTGT 482 TCATCTTTCCTGTTCCAGA 483 AGGCACCTGCATGTGTCTG 484 AGAGGACCTGCGCTCTTGG 485 ACGCATATGACTCACCACG

    [0080] In some cases, the first sequence may have 100% identity, i.e. complete identity, homology, complementarity to the target nucleic acid sequence. In other cases, there may be one or more mismatches between the first sequence and the target nucleic acid sequence. For example, there may be 1, 2, 3, 4, 5, 6, or 7 mismatches between the sense region and the target nucleic acid sequence.

    [0081] The sequences set forth in Table 2 are presented as DNA sequences. In all sequences set forth in Table 2, thymine (T) may be replaced by uracil (U) to arrive at the sequence of the target mRNA sequence. Illustrative RNA sequences corresponding to the sequences set forth in Table 2 are provided as SEQ ID NOS: 8831-8916.

    [0082] In some embodiments, the first and second sequence are present on a single stranded polynucleotide, wherein the first sequence and second sequence are separated by 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides, wherein the 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides form a loop region in the shRNA. In some embodiments, the loop region comprises a sequence selected from SEQ ID NOs: 8800-8813. Illustrative loop region sequences are shown in Table 3.

    TABLE-US-00003 TABLE 3 Illustrative loop region sequences SEQ ID NO Loop Region Sequence 8800 CGAA 8801 UUCAAGA 8802 AUAUUCA 8803 UGUGCUGUC 8804 CUCGAG 8805 CUUCCUGUCAGA 8806 CUUCCCUUUGUCAGA 8807 GUGUUAUUCUUG 8808 GUGUCUUAAUUG 8809 GUGUUAGUCUUG 8810 UCAAGAG 8811 GGACAUCCAGGG 8812 GUGAAGCCACAGAUG 8813 GAUUCUAAAA

    [0083] In some embodiments, the first sequence and second sequence comprise a linker, sometimes referred to as a loop. In some embodiments, both the first sequence and the second sequence are encoded by one single-stranded RNA or DNA vector. In some embodiments, the loop is between the first and second sequences. In these embodiments, and the first sequence and the second sequence hybridize to form a duplex region. The first sequence and second sequence are joined by a linker sequence, forming a “hairpin” or “stem-loop” structure. The shRNA can have complementary first sequences and second sequences at opposing ends of a single stranded molecule, so that the molecule can form a duplex region with the complementary sequence portions, and the strands are linked at one end of the duplex region by a linker (i.e. loop sequence). The linker, or loop sequence, can be either a nucleotide or non-nucleotide linker. The linker can interact with the first sequence, and optionally, second sequence through covalent bonds or non-covalent interactions.

    [0084] Any suitable nucleotide loop sequence is envisaged as within the scope of the disclosure. An shRNA of this disclosure may include a nucleotide, non-nucleotide, or mixed nucleotide/non-nucleotide linker that joins the first sequence of the shRNA to the second sequence of the shRNA. A nucleotide loop sequence can be >2 nucleotides in length, for example about 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides in length.

    [0085] Examples of a non-nucleotide linker include an abasic nucleotide, polyether, polyamine, polyamide, peptide, carbohydrate, lipid, polyhydrocarbon, or other polymeric agents, for example polyethylene glycols such as those having from 2 to 100 ethylene glycol units. Some examples are described in Seela et al., Nucleic Acids Research, 1987, Vol. 15, pp. 3113-3129; Cload et al., J. Am. Chem. Soc, 1991, Vol. 113, pp. 6324-6326; Jaeschke et al., Tetrahedron Lett., 1993, Vol. 34, pp. 301; Arnold et al., WO 1989/002439; Usman et al., WO 1995/006731; Dudycz et al., WO 1995/011910, and Ferentz et al., J. Am. Chem. Soc, 1991, Vol. 113, pp. 4000-4002.

    [0086] In some embodiments, the shRNA further comprises a 5′ flank sequence and a 3′ flank sequence. In some embodiments, wherein the 5′ flank sequence is joined to the 5′ end of the first sequence, and wherein the 3′ flank sequence is joined to the 3′ end of the second sequence.

    [0087] Without wishing to be bound by theory, it is thought that flanking shRNA stem loop sequence with 5′ and 3′ sequences similar to those found in microRNAs can target the shRNA for processing by the endogenous microRNA processing machinery, increasing the effectiveness of shRNA processing. Alternatively, or in addition, flanking sequences may increase shRNA compatibility with polymerase II or polymerase III promoters, leading to more effective regulation of shRNA expression.

    [0088] In some embodiments, the 5′ flank sequence is selected from SEQ ID NO. 8814-8816. In some embodiments, the 3′ flank sequence is selected from SEQ ID NO: 8817-8819. Illustrative flank sequence are shown in Table 4.

    TABLE-US-00004 TABLE 4 Illustrative flank sequences SEQ ID NO 5′ Flank Sequence NA GG 8814 ACACCAUGUUGCCAGUCUCUAGG 8815 UGAUAGCAAUGUCAGCAGUGCCU 8816 UAUUGCUGUUGACAGUGAGCGAC SEQ ID NO 3′ Flank Sequence 8817 UGGCGUCUGGCCCAACCACAC 8818 GUAAGGUUGACCAUACUCUAC 8819 UGCCUACUGCCUCGGACUUCA

    [0089] shRNAs of the disclosure may be generated exogenously by chemical synthesis, by in vitro transcription, or by cleavage of longer double-stranded RNA with Dicer or another appropriate nuclease with similar activity. Chemically synthesized siRNAs, produced from protected ribonucleoside phosphoramidites using a conventional DNA/RNA synthesizer, may be obtained from commercial suppliers such as Millipore Sigma (Houston, Tex.), Ambion Inc. (Austin, Tex.). Invitrogen (Carlsbad, Calif.), or Dharmacon (Lafayette, Colo.). siRNAs can be purified by extraction with a solvent or resin, precipitation, electrophoresis, chromatography, or a combination thereof, for example. Alternatively, siRNAs may be used with little if any purification to avoid losses due to sample processing.

    [0090] In some embodiments, shRNAs of the disclosure can be produced using an expression vector into which a nucleic acid encoding the double stranded RNA has been cloned, for example under control of a suitable promoter.

    Activators

    [0091] The disclosure provides a first ligand, an activator, and a first engineered receptor comprising the first ligand binding domain that binds to the first activator ligand.

    [0092] The disclosure provides a first engineered receptor comprising an extracellular region, the extracellular region comprising a first ligand binding domain capable of specifically binding a first ligand that activates or promotes activation of the receptor, which promotes activation of effector cells expressing the receptor. The disclosure further provides a second engineered receptor comprising a second ligand binding domain capable of binding a second ligand, wherein binding of the second ligand by the second ligand binding domain inhibits or reduces activation of effector cells even in the presence of the first receptor bound to the first ligand.

    [0093] As used herein, an “activator” or “activator ligand” refers to a first ligand that binds to a first, activator ligand binding domain (LBD) of an engineered receptor of the disclosure, such as a CAR or TCR, thereby mediating activation of a T cell expressing the engineered receptor. The activator is expressed by target cells, for example cancer cells, and may also be expressed more broadly than just the target cells. For example the activator can be expressed on some, or all types of normal, non-target cells.

    [0094] In some embodiments, the first ligand is a peptide ligand from any of the activator targets disclosed herein. In some embodiments, the first ligand is a peptide antigen complexed with a major histocompatibility (MHC) class I complex (peptide MHC, or pMHC), for example an MHC complex comprising human leukocyte antigen A*02 allele (HLA-A*02).

    [0095] Target cell-specific first activator ligands comprising peptide antigens complexed with pMHC comprising any of human leukocyte antigen (HLA) HLA-A, HLA-B, HLA-C, HLA-E, HLA-F, and HLA-G are envisaged as within the scope of the disclosure. In some embodiments, the first ligand comprises a pMHC comprising HLA-A. HLA-A receptors are heterodimers comprising a heavy a chain and smaller β chain. The α chain is encoded by a variant of HLA-A, while the β chain (β2-microglobulin) is an invariant. There are several thousand HLA-A gene variants, all of which fall within the scope of the instant disclosure. In some embodiments, the MHC-I comprises a human leukocyte antigen A*02 allele (HLA-A*02).

    [0096] In some embodiments, the first activator ligand comprises a pMHC comprising HLA-B. Hundreds of versions (alleles) of the HLA-B gene are known, each of which is given a particular number (such as HLA-B*27).

    [0097] In some embodiments, the first activator ligand comprises a pMHC comprising HLA-C. HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). Over one hundred HLA-C alleles are known in the art.

    [0098] In some embodiments, the first activator ligand comprises a pMHC comprising HLA-A. In some embodiments, the first activator ligand comprises a pMHC comprising HLA-B. In some embodiments, the first activator ligand comprises a pMHC comprising HLA-C. In some embodiments, the first activator ligand comprises a pMHC comprising HLA-E. In some embodiments, the first activator ligand comprises a pMHC comprising HLA-F. In some embodiments, the first activator ligand comprises a pMHC comprising HLA-G.

    [0099] In some embodiments, the first activator ligand comprises HLA-A. In some embodiments, the first activator ligand comprises HLA-B. In some embodiments, the first activator ligand comprises HLA-C. In some embodiments, the first activator ligand comprises HLA-E. In some embodiments, the first activator ligand comprises HLA-F. In some embodiments, the first activator ligand comprises HLA-G. In some embodiments, the first activator ligand comprises HLA-A, HLA-B, HLA-C, HLA-E, HLA-F or HLA-G.

    [0100] In some embodiments, the first, activator ligand binding domain comprises an scFv domain.

    [0101] In some embodiments, the first, activator ligand binding domain comprises a Vβ-only ligand binding domain.

    [0102] In some embodiments, the first, activator ligand binding domain comprises an antigen binding domain isolated or derived from a T cell receptor (TCR). For example, the first, activator ligand binding domain comprises TCR α and β chain variable domains.

    [0103] In some embodiments, the first, activator ligand and the second, inhibitor ligand are not the same.

    [0104] In some embodiments, the first, activator ligand is expressed by target cells and is not expressed by non-target cells (i.e. normal cells not targeted by the adoptive cell therapy). In some embodiments, the target cells are cancer cells and the non-target cells are non-cancerous cells.

    [0105] In some embodiments, the activator ligand has high cell surface expression on the target cells. This high cell surface expression confers the ability to deliver large activation signals. Methods of measuring cell surface expression will be known to the person of ordinary skill in the art and include, but are not limited to, immunohistochemistry using an appropriate antibody against the activator ligand, followed by microscopy or fluorescence activated cell sorting (FACS).

    [0106] In some embodiments, the activator ligand is encoded by a gene with an essential cellular function. Essential cellular functions are functions required for a cell to live, and include protein and lipid synthesis, cell division, replication, respiration, metabolism, ion transport, and providing structural support for tissues. Selecting activator ligands encoded by genes with essential cellular functions prevents loss of the activator ligand due to aneuploidy in cancer cells, and makes gene encoding the activator ligand less likely to undergo mutagenesis during the evolution of the cancer. In some embodiments, the activator ligand is encoded by a gene that is haploinsufficient, i.e. loss of copies of the gene encoding the activator ligand are not tolerated by the cell and lead to cell death or a disadvantageous mutant phenotype.

    [0107] In some embodiments, the activator ligand is present on all target cells. In some embodiments, the target cells are cancer cells.

    [0108] In some embodiments, the activator ligand is present on a plurality of target cells. In some embodiments, the target cells are cancer cells. In some embodiments, the activator ligand is present on at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.5% or at least 99.9% of target cells. In some embodiments, the activator ligand is present on at least 95% target cells. In some embodiments, the activator ligand is present on at least 99% target cells.

    [0109] In some embodiments, the activator ligand is present on all cells (ubiquitous activator ligands). Activator ligands can be expressed on all cells, if, for example, the second inhibitor ligand is also expressed on all cells except the target cells.

    [0110] In some embodiments, the first, activator ligand is expressed by a plurality of target cells and a plurality of non-target cells. In some embodiments, the plurality of non-target cells expresses both the first, activator ligand and the second inhibitor ligand.

    [0111] In some embodiments, and the first, activator ligand and second, inhibitor ligand are present on the plurality of non-target target cells at a ratio of about 1:100 to about 100:1 of the first ligand to the second ligand. In some embodiments, and the first, activator ligand and second, inhibitor ligand are present on the plurality of non-target target cells at a ratio of about 1:50 to about 50:1 of the first ligand to the second ligand. In some embodiments, and the first, activator ligand and second, inhibitor ligand are present on the plurality of non-target target cells at a ratio of about 1:25 to about 25:1 of the first ligand to the second ligand. In some embodiments, and the first, activator ligand and second, inhibitor ligand are present on the plurality of non-target target cells at a ratio of about 1:10 to about 10:1 of the first ligand to the second ligand. In some embodiments, and the first, activator ligand and second, inhibitor ligand are present on the plurality of non-target target cells at a ratio of about 1:5 to about 5:1 of the first ligand to the second ligand. In some embodiments, and the first, activator ligand and second, inhibitor ligand are present on the plurality of non-target target cells at a ratio of about 1:3 to about 3:1 of the first ligand to the second ligand. In some embodiments, and the first, activator ligand and second, inhibitor ligand are present on the plurality of non-target target cells at a ratio of about 1:2 to about 2:1 of the first ligand to the second ligand. In some embodiments, and the first, activator ligand and second, inhibitor ligand are present on the plurality of non-target target cells at a ratio of about 1:1.

    [0112] The first, activator ligand is recognized by a first ligand binding domain (sometimes referred to herein as the activator LBD).

    [0113] Exemplary activator ligands include ligands selected from the group consisting of cell adhesion molecules, cell-cell signaling molecules, extracellular domains, molecule involved in chemotaxis, glycoproteins, G protein-coupled receptors, transmembrane proteins, receptors for neurotransmitters and voltage gated ion channels. In some embodiments, the first, activator ligand is transferrin receptor (TFRC) or a peptide antigen thereof. Human transferrin receptor is described in NCBI record No. AAA61153.1, the contents of which are incorporated herein by reference.

    [0114] In some embodiments, the activator ligand is a tumor specific antigen (TSA). In some embodiments, the tumor specific antigen is mesothelin (MSLN), CEA cell adhesion molecule 5 (CEACAM5, or CEA), epidermal growth factor receptor (EGFR) or a peptide antigen thereof. In some embodiments, the TSA is MSLN, CEA, EGFR, delta like canonical Notch ligand 4 (DLL4), mucin 16, cell surface associated (MUC 16 also known as CA125), ganglioside GD2 (GD2), receptor tyrosine kinase like orphan receptor 1 (ROR1), erb-b2 receptor tyrosine kinase 2 (HER2/NEU) or a peptide antigen thereof. Exemplary mouse and humanized scFv antigen binding domains targeting TSAs are shown in Table 5 below:

    TABLE-US-00005 TABLE 5 Exemplary scFv antigen binding domains that target tumor specific antigens (TSAs) MSLN binding domains QVQLVQSGAEVEKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGWINP DNA NSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYYCASGWDFDYWG Sequence: SEQ QGTLVTVSSGGGGSGGGGSGGGGSGGDIVMTQSSSLSASVGDRVTITCRASQS ID NO: 87 IRYYLSWYQQKPGKAPKLLIYTASILQNGVPSRFSGSGSGTDFTLTISSLQPE DFATYYCLQTYTTPDFGPGTKVEIK (SEQ ID NO: 86) QVQLVQSGAEVRAPGASVKISCKASGFTFRGYYIHWVRQAPGQGLEWMGIINP DNA SGGSRAYAQKFQGRVTMTRDTSTSTVYMELSSLRSDDTAMYYCARTASCGGDC Sequence: SEQ YYLDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPPTLSASVGDRVT ID NO: 89 ITCRASENVNIWLAWYQQKPGKAPKLLIYKSSSLASGVPSRFSGSGSGAEFTL TISSLQPDDFATYYCQQYQSYPLTFGGGTKVEIK (SEQ ID NO: 88) QVQLVQSGAEVKKPGASVKVSCKASGYSFTGYTMNWVRQAPGQRLEWMGLIT DNA PYNGASSYNQKFRGRVTITRDTSASTAYMELSSLRSEDTAVYYCARGGYDGR Sequence: SEQ GFDYWGQGTTVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDRVT ID NO: 91 ITCSASSSVSYMHWYQQKPGKAPKRLIYDTSKLASGVPSRFSGSGSGTEFTL TISSLQPEDFATYYCQQWSGYPLTFGQGTKLEIK (SEQ ID NO: 90) QVQLQQSGPELEKPGASVKISCKASGYSFTGYTMNWVKQSHGKSLEWIGLIT C-002360 PYNGASSYNQKFRGKATLTVDKSSSTAYMDLLSLTSEDSAVYFCARGGYDGR MSLN_(S5M) GFDYWGQGTTVTVSSGGGGSGGGGSGGGGSGGDIELTQSPAIMSASPGEKVT DNA MTCSASSSVSYMHWYQQKSGTSPKRWIYDTSKLASGVPGRFSGSGSGNSYSL Sequence: SEQ TISSVEAEDDATYYCQQWSGYPLTFGAGTKLEIK (SEQ ID NO: 92) ID NO: 93 QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIGY ND IYYSGSTYYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCAREDVVK GAFDIWGQGTMVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDRV TITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDF TLTISSLQPEDFATYYCQQSYSTPLTFGGGTKVEIK (SEQ ID NO: 8917) CEACAM5 binding domains QVQLQQSGAELVRSGTSVKLSCTASGFNIKDSYMHWLRQGPEQGLEWIGWID DNA PENGDTEYAPKFQGKATFTTDTSSNTAYLQLSSLTSEDTAVYYCNEGTPTGP Sequence: SEQ YYFDYWGQGTTVTVSSGGGGSGGGGSGGGGSGGENVLTQSPAIMSASPGEKV ID NO: 95 TITCSASSSVSYMHWFQQKPGTSPKLWIYSTSNLASGVPARFSGSGSGTSYS LTISRMEAEDAATYYCQQRSSYPLTFGAGTKLELK (SEQ ID NO: 94) QVQLVQSGAEVKKPGASVKVSCKASGFNIKDSYMHWVRQAPGQGLEWMGWID DNA PENGDTEYAPKFQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCNEGTPTGP Sequence: SEQ YYFDYWGQGTTVTVSSGGGGSGGGGSGGGGSGGEIVLTQSPATLSLSPGERA ID NO: 97 TLSCSASSSVSYMHWYQQKPGLAPRLLIYSTSNLASGIPDRFSGSGSGTDFT LTISRLEPEDFAVYYCQQRSSYPLTFGQGTKLEIK (SEQ ID NO: 96) EVQLAESGGGLVQPGGSLRLSCAASGFTFSSDAMSWVRQAPGKGLEWVSAIS DNA GSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKSNEFLF Sequence: SEQ DYWGQGTLVTVSSGGGGSGGGGSGGGGSGGSSELTQDPAVSVALGQTVRITC ID NO: 99 QGDSLRSSYASWYRQRPGQAPVLVIYGKNNRPSGIPDRFSGSSSGNTASLTI TGAQAEDEADYYWNSSYAWLPYWFGGGTKLTVLG (SEQ ID NO: 98) QVQLEQSGAGVVKPGASVKLSCKASGFNIKDSYMHWLRQGPGQRLEWIGWID DNA PENGDTEYAPKFQGKATFTTDTSANTAYLGLSSLRPEDTAVYYCNEGTPTGP Sequence: SEQ YYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGENVLTQSPSSMSVSVGDRV ID NO: 101 NIACSASSSVPYMHWLQQKPGKSPKLLIYLTSNLASGVPSRFSGSGSGTDYS LTISSVQPEDAATYYCQQRSSYPLTFGGGTKLEIK (SEQ ID NO: 100) QVQLVQSGSELKKPGASVKVSCKASGYTFTEFGMNWVRQAPGQGLEWMGWIN DNA TKTGEATYVEEFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCARWDFAYY Sequence: SEQ VEAMDYWGQGTTVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDR ID NO: 283 VTITCKASQNVGTNVAWYQQKPGKAPKLLIYSASYRYSGVPSRFSGSGSGTD FTLTISSLQPEDFATYYCHQYYTYPLFTFGQGTKLEIK (SEQ ID NO: 282) QVQLVQSGAEVKKPGASVKVSCKASGYTFTEFGMNWVRQAPGQGLEWMGWIN DNA Sequence: TKTGEATYVEEFKGRVTFTTDTSTSTAYMELRSLRSDDTAVYYCARWDFAYY SEQ ID NO: 285 VEAMDYWGQGTTVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDR VTITCKASAAVGTYVAWYQQKPGKAPKLLIYSASYRKRGVPSRFSGSGSGTD FTLTISSLQPEDFATYYCHQYYTYPLFTFGQGTKLEIK (SEQ ID NO: 284) QVQLVQSGSELKKPGASVKVSCKASGYTFTEFGMNWVRQAPGQGLEWMGWIN DNA Sequence: TKTGEATYVEEFKGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCARWDFAHY SEQ ID NO: 287 FQTMDYWGQGTTVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDR VTITCKASAAVGTYVAWYQQKPGKAPKLLIYSASYRKRGVPSRFSGSGSGTD FTLTISSLQPEDFATYYCHQYYTYPLFTFGQGTKLEIK (SEQ ID NO: 286) EGFR binding domains QVQLVESGGGVVQPGRSLRLSCAASGFTFSTYGMHWVRQAPGKGLEWVAVIW DNA DDGSYKYYGDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDGITMV Sequence: SEQ RGVMKDYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGAIQLTQSPSSLSAS ID NO: 103 VGDRVTITCRASQDISSALVWYQQKPGKAPKLLIYDASSLESGVPSRFSGSE SGTDFTLTISSLQPEDFATYYCQQFNSYPLTFGGGTKVEIK (SEQ ID NO: 102) AIQLTQSPSSLSASVGDRVTITCRASQDISSALVWYQQKPGKAPKLLIYDAS DNA SLESGVPSRFSGSESGTDFTLTISSLQPEDFATYYCQQFNSYPLTFGGGTKV Sequence: SEQ EIKGGGGSGGGGSGGGGSGGQVQLVESGGGVVQPGRSLRLSCAASGFTFSTY ID NO: 105 GMHWVRQAPGKGLEWVAVIWDDGSYKYYGDSVKGRFTISRDNSKNTLYLQMN SLRAEDTAVYYCARDGITMVRGVMKDYFDYWGQGTLVTVSS (SEQ ID NO: 104) QIQLVQSGPELKKPGETVKISCKASGYTFTEYPIHWVKQAPGKGFKWMGMIY DNA Sequence: TDIGKPTYAEEFKGRFAFSLETSASTAYLQINNLKNEDTATYFCVRDRYDSL SEQ ID NO: 107 FDYWGQGTTLTVSSGGGGSGGGGSGGGGSGGDVVMTQTPLSLPVSLGDQASI SCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSG TDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIK (SEQ ID NO: 106) DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLL DNA Sequence: IYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPWTFG SEQ ID NO: 109 GGTKLEIKGGGGSGGGGSGGGGSGGQIQLVQSGPELKKPGETVKISCKASGY TFTEYPIHWVKQAPGKGFKWMGMIYTDIGKPTYAEEFKGRFAFSLETSASTA YLQINNLKNEDTATYFCVRDRYDSLFDYWGQGTTLTVSS (SEQ ID NO: 108) EMQLVESGGGFVKPGGSLKLSCAASGFAFSHYDMSWVRQTPKQRLEWVAYIA DNA Sequence: SGGDITYYADTVKGRFTISRDNAQNTLYLQMSSLKSEDTAMFYCSRSSYGNN SEQ ID NO: 111 GDALDFWGQGTSVTVSSGGGGSGGGGSGGGGSGGDVVMTQTPLSLPVSLGDQ ASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGS GSGTDFTLKISRVEAEDLGVYFCSQSTHVLTFGSGTKLEIK (SEQ ID NO: 110) DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWYLQKPGQSPKLL DNA Sequence: IYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVLTFGS SEQ ID NO: 113 GTKLEIKGGGGSGGGGSGGGGSGGEMQLVESGGGFVKPGGSLKLSCAASGFA FSHYDMSWVRQTPKQRLEWVAYIASGGDITYYADTVKGRFTISRDNAQNTLY LQMSSLKSEDTAMFYCSRSSYGNNGDALDFWGQGTSVTVSS (SEQ ID NO: 112) QVQLKQSGPGLVQPSQSLSITCTVSGFSLTNYGVHWVRQSPGKGLEWLGVIW DNA Sequence: SGGNTDYNTPFTSRLSINKDNSKSQVFFKMNSLQSNDTAIYYCARALTYYDY SEQ ID NO: 115 EFAYWGQGTLVTVSAGGGGSGGGGSGGGGSGGDILLTQSPVILSVSPGERVS FSCRASQSIGTNIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFT LSINSVESEDIADYYCQQNNNWPTTFGAGTKLELK (SEQ ID NO: 114) QVQLVQSGAEVKKPGASVKVSCKASGYTFTSHWMHWVRQAPGQGLEWIGEFN DNA Sequence: PSNGRTNYNEKFKSKATMTVDTSTNTAYMELSSLRSEDTAVYYCASRDYDYD SEQ ID NO: 117 GRYFDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDR VTITCSASSSVTYMYWYQQKPGKAPKLLIYDTSNLASGVPSRFSGSGSGTDY TFTISSLQPEDIATYYCQQWSSHIFTFGQGTKVEIK (SEQ ID NO: 116) QVQLQESGPGLVKPSETLSLTCTVSGGSVSSGDYYWTWIRQSPGKGLEWIGH DNA Sequence: IYYSGNTNYNPSLKSRLTISIDTSKTQFSLKLSSVTAADTAIYYCVRDRVTG SEQ ID NO: 119 AFDIWGQGTMVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDRVT ITCQASQDISNYLNWYQQKPGKAPKLLIYDASNLETGVPSRFSGSGSGTDFT FTISSLQPEDIATYFCQHFDHLPLAFGGGTKVEIK (SEQ ID NO: 118) QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGDYYWSWIRQPPGKGLEWIG ND YIYYSGSTDYNPSLKSRVTMSVDTSKNQFSLKVNSVTAADTAVYYCARVSI FGVGTFDYWGQGTLVTVSSGGGGSGGGGSGGGGSGGEIVMTQSPATLSLSP GERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSG SGTDFTLTISSLEPEDFAVYYCHQYGSTPLTFGGGTKAEIK (SEQ ID NO: 391) CD19 Binding Domains DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHT DNA SRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGT Sequence: SEQ KLEITGGGGSGGGGSGGGGSEVKLQESGPGLVAPSQSLSVTCTVSGVSLPD ID NO: 276 YGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFLKM NSLQTDDTAIYYCAKHYYYGGSYAIVIDYWGQGTSVTVSS (SEQ ID NO: 275) DIQMTQTTSSLSASLGDRVTISCRASQDISKYLNWYQQKPDGTVKLLIYHT DNA SRLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPYTFGGGT Sequence: SEQ KLEITGGGGSGGGGSGGGGSGGEVKLQESGPGLVAPSQSLSVTCTVSGVSL ID NO: 278 PDYGVSWIRQPPRKGLEWLGVIWGSETTYYNSALKSRLTIIKDNSKSQVFL KMNSLQTDDTAIYYCAKHYYYGGSYAMDYWGQGTSVTVSS (SEQ ID NO: 277)

    [0115] In some embodiments, the activator ligand is MSLN or a peptide antigen thereof, and the activator ligand binding domain comprises a MSLN binding domain. In some embodiments, the MSLN ligand binding domain comprises an scFv domain. In some embodiments, the MSLN ligand binding domain comprises a sequence of SEQ ID NO: 86, SEQ ID NO: 88, SEQ ID NO: 90 or SEQ ID NO: 92. In some embodiments, the MSLN ligand binding domain comprises a sequence at least 90%, at least 95% or at least 99% identical to SEQ ID NO: 86, SEQ ID NO: 88, SEQ ID NO: 90 or SEQ ID NO: 92. In some embodiments, the MSLN ligand binding domain is encoded by a sequence comprising SEQ ID NO: 87, SEQ ID NO: 89, SEQ ID NO: 91 or SEQ ID NO: 93. In some embodiments, the MSLN ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity or at least 99% identity to a sequence of SEQ ID NO: 87, SEQ ID NO: 89, SEQ ID NO: 91 or SEQ ID NO: 93.

    [0116] In some embodiments, the activator ligand is CEA or a peptide antigen thereof, and the activator ligand binding domain comprises a CEA binding domain. In some embodiments, the CEA ligand binding domain comprises an scFv domain. In some embodiments, the CEA ligand binding domain comprises a sequence of SEQ ID NO: 94, SEQ ID NO: 96, SEQ ID NO: 98, SEQ ID NO: 100, SEQ ID NO: 282, SEQ ID NO: 284 or SEQ ID NO: 286. In some embodiments, the CEA ligand binding domain comprises a sequence at least 90%, at least 95% or at least 99% identical to SEQ ID NO: 94, SEQ ID NO: 96, SEQ ID NO: 98, SEQ ID NO: 100, SEQ ID NO: 282, SEQ ID NO: 284 or SEQ ID NO: 286. In some embodiments, the CEA ligand binding domain is encoded by a sequence comprising SEQ ID NO: 95, SEQ ID NO: 97, SEQ ID NO: 99, SEQ ID NO: 101, SEQ ID NO: 283, SEQ ID NO: 285 or SEQ ID NO: 287. In some embodiments, the CEA ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity or at least 99% identity to a sequence of SEQ ID NO: 95, SEQ ID NO: 97, SEQ ID NO: 99, SEQ ID NO: 101, SEQ ID NO: 283, SEQ ID NO: 285 or SEQ ID NO: 287.

    [0117] In some embodiments, the activator ligand is CEA or a peptide antigen thereof, and the activator ligand binding domain comprises a CEA binding domain. In some embodiments, the CEA ligand binding domain comprises a CDR-H1 of EFGMN (SEQ ID NO: 294), a CDR-H2 of WINTKTGEATYVEEFKG (SEQ ID NO: 295), a CDR-H3 of WDFAYYVEAMDY (SEQ ID NO: 296) or WDFAHYFQTMDY (SEQ ID NO: 297), a CDR-L1 of KASQNVGTNVA (SEQ ID NO: 298) or KASAAVGTYVA (SEQ ID NO: 299), a CDR-L2 of SASYRYS (SEQ ID NO: 300) or SASYRKR (SEQ ID NO: 301), and a CDR-L3 of HQYYTYPLFT (SEQ ID NO: 302) or sequences having at least 85% or at least 95% identity thereto. In some embodiments, a CEA scFv comprises a CDR-H1 of EFGMN (SEQ ID NO: 294), a CDR-H2 of WINTKTGEATYVEEFKG (SEQ ID NO: 295), a CDR-H3 of WDFAYYVEAMDY (SEQ ID NO: 296) or WDFAHYFQTMDY (SEQ ID NO: 297), a CDR-L1 of KASQNVGTNVA (SEQ ID NO: 298) or KASAAVGTYVA (SEQ ID NO: 299), a CDR-L2 of SASYRYS (SEQ ID NO: 300) or SASYRKR (SEQ ID NO: 301) and a CDR-L3 of HQYYTYPLFT (SEQ ID NO: 302). In some embodiments, a CEA binding domain comprises a CDR-H1 of EFGMN (SEQ ID NO: 294), a CDR-H2 of WINTKTGEATYVEEFKG (SEQ ID NO: 295), a CDR-H3 of WDFAYYVEAMDY (SEQ ID NO: 296), a CDR-L1 of KASQNVGTNVA (SEQ ID NO: 298), a CDR-L2 of SASYRYS (SEQ ID NO: 300) and a CDR-L3 of HQYYTYPLFT (SEQ ID NO: 302). In some embodiments, a CEA scFv comprises a CDR-H1 of EFGMN (SEQ ID NO: 294), a CDR-H2 of WINTKTGEATYVEEFKG (SEQ ID NO: 295), a CDR-H3 of WDFAYYVEAMDY (SEQ ID NO: 296), a CDR-L1 of KASAAVGTYVA (SEQ ID NO: 299), a CDR-L2 of SASYRKR, and a CDR-L3 of HQYYTYPLFT (SEQ ID NO: 302). In some embodiments, a CEA binding domain comprises a CDR-H1 of EFGMN (SEQ ID NO: 294), a CDR-H2 of WINTKTGEATYVEEFKG (SEQ ID NO: 295), a CDR-H3 of WDFAHYFQTMDY (SEQ ID NO: 297), a CDR-L1 of KASAAVGTYVA (SEQ ID NO: 299), a CDR-L2 of SASYRKR, and a CDR-L3 of HQYYTYPLFT (SEQ ID NO: 302).

    [0118] In some embodiments, the activator ligand is CEA or a peptide antigen thereof, and the activator receptor is a CEA CAR. In some embodiments, the CEA CAR comprises sequence at least 90%, at least 95% or at least 99% identical to SEQ ID NO: 288, SEQ ID NO: 290 or SEQ ID NO: 292. In some embodiments, the CEA CAR comprises or consists essentially of SEQ ID NO: 288, SEQ ID NO: 290 or SEQ ID NO: 292. In some embodiments, the CEA CAR is encoded by a sequence comprising or consisting essentially of SEQ ID NO: 289, SEQ ID NO: 291 or SEQ ID NO: 293. In some embodiments, the CEA CAR is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity or at least 99% identity to SEQ ID NO: 289, SEQ ID NO: 291 or SEQ ID NO: 293.

    [0119] In some embodiments, the activator ligand is EGFR or a peptide antigen thereof, and the activator ligand binding domain comprises an EGFR binding domain. In some embodiments, the EGFR ligand binding domain comprises an scFv domain. In some embodiments, the EGFR ligand binding domain comprises a sequence of SEQ ID NO: 102, SEQ ID NO: 104, SEQ ID NO: 106, SEQ ID NO: 108, SEQ ID NO: 110, SEQ ID NO: 112, SEQ ID NO: 114, SEQ ID NO: 116, SEQ ID NO: 118 or SEQ ID NO: 391. In some embodiments, the EGFR ligand binding domain comprises a sequence at least 90%, at least 95% or at least 99% identical to SEQ ID NO: 102, SEQ ID NO: 104, SEQ ID NO: 106, SEQ ID NO: 108, SEQ ID NO: 110, SEQ ID NO: 112, SEQ ID NO: 114, SEQ ID NO: 116, SEQ ID NO: 118 or SEQ ID NO: 391. In some embodiments, the EGFR ligand binding domain is encoded by a sequence comprising SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 107, SEQ ID NO: 109, SEQ ID NO: 111, SEQ ID NO: 113, SEQ ID NO: 115, SEQ ID NO: 117 or SEQ ID NO: 119. In some embodiments, the EGFR ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity or at least 99% identity to a sequence of SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 107, SEQ ID NO: 109, SEQ ID NO: 111, SEQ ID NO: 113, SEQ ID NO: 115, SEQ ID NO: 117 or SEQ ID NO: 119.

    [0120] In some embodiments, the activator ligand is EGFR or a peptide antigen thereof, and the activator ligand binding domain comprises an EGFR ligand binding domain. In some embodiments, the EGFR binding domain comprises a VH and/or a VL domain selected from the group disclosed in Table 6 or a sequence having at least 90% identity thereto. In some embodiments, the EGFR ligand binding domain comprises a VH domain selected from the group consisting of SEQ ID NO: 120, SEQ ID NO: 122, SEQ ID NO: 124, SEQ ID NO: 126, SEQ ID NO: 128 and SEQ ID NO: 130. In some embodiments, the EGFR ligand binding domain comprises a VH selected from the group consisting of SEQ ID NO: 120, SEQ ID NO: 122, SEQ ID NO: 124, SEQ ID NO: 126, SEQ ID NO: 128 and SEQ ID NO: 130 or a sequence having at least 90%, at least 95% or at least 99% identity thereto. In some embodiments, the EGFR ligand binding domain comprises a VL domain selected from the group consisting of SEQ ID NO: 121, SEQ ID NO: 123, SEQ ID NO: 125, SEQ ID NO: 127, SEQ ID NO: 129 and SEQ ID NO: 131. In some embodiments, the EGFR ligand binding domain comprises a VH selected from the group consisting of SEQ ID NO: 121, SEQ ID NO: 123, SEQ ID NO: 125, SEQ ID NO: 127, SEQ ID NO: 129 and SEQ ID NO: 131 or a sequence having at least 90%, at least 95% or at least 99% identity thereto.

    TABLE-US-00006 TABLE 6 EGFR Variable Heavy (VH) and Variable Light (VL) domains EGFR VH EGFR VL CT478, CT479: CT478, CT479: QVQLVESGGGVVQPG AIQLTQSPSSLSASV RSLRLSCAASGFTFS GDRVTITCRASQDIS TYGMHWVRQAPGKGL SALVWYQQKPGKAPK EWVAVIWDDGSYKYY LLIYDASSLESGVPS GDSVKGRFTISRDNS RFSGSESGTDFTLTI KNTLYLOMNSLRAED SSLQPEDFATYYCQQ TAVYYCARDGITMVR FNSYPLTFGGGTKVE GVMKDYFDYWGQGTL IK VTVSS (SEQ ID NO: 121) (SEQ ID NO: 120) CT480, CT481: CT480, CT481: QIQLVQSGPELKKPG DVVMTQTPLSLPVSL ETVKISCKASGYTFT GDQASISCRSSQSLV EYPIHWVKQAPGKGF HSNGNTYLHWYLQKP KWMGMIYTDIGKPTY GQSPKLLIYKVSNRF AEEFKGRFAFSLETS SGVPDRFSGSGSGTD ASTAYLQINNLKNED FTLKISRVEAEDLGV TATYFCVRDRYDSLF YFCSQSTHVPWTFGG DYWGQGTTLTVSS GTKLEIK (SEQ ID NO: 122) (SEQ ID NO: 123) CT482, CT483: CT482, CT483: EMQLVESGGGFVKPG DVVMTQTPLSLPVSL GSLKLSCAASGFAFS GDQASISCRSSQSLV HYDMSWVROTPKQRL HSNGNTYLHWYLQKP EWVAYIASGGDITYY GQSPKLLIYKVSNRF ADTVKGRFTISRDNA SGVPDRFSGSGSGTD QNTLYLQMSSLKSED FTLKISRVEAEDLGV TAMFYCSRSSYGNNG YFCSQSTHVLTFGSG DALDFWGQGTSVTVS TKLEIK S (SEQ ID NO: 125) (SEQ ID NO: 124) CT486: CT486: QVQLKQSGPGLVQPS DILLTQSPVILSVSP QSLSITCTVSGFSLT GERVSFSCRASQSIG NYGVHWVRQSPGKGL TNIHWYQQRTNGSPR EWLGVIWSGGNTDYN LLIKYASESISGIPS TPFTSRLSINKDNSK RFSGSGSGTDFTLSI SQVFFKMNSLQSNDT NSVESEDIADYYCQQ AIYYCARALTYYDYE NNNWPTTFGAGTKLE FAYWGQGTLVTVSA LK (SEQ ID NO: 126) (SEQ ID NO: 127) CT487: CT487: QVQLVQSGAEVKKPG DIQMTQSPSSLSASV ASVKVSCKASGYTFT GDRVTITCSASSSVT SHWMHWVRQAPGQGL YMYWYQQKPGKAPKL EWIGEFNPSNGRTNY LIYDTSNLASGVPSR NEKFKSKATMTVDTS FSGSGSGTDYTFTIS TNTAYMELSSLRSED SLQPEDIATYYCQQW TAVYYCASRDYDYDG SSHIFTFGQGTKVEI RYFDYWGQGTLVTVS K S (SEQ ID NO: 129) (SEQ ID NO: 128) CT488: CT488: QVQLQESGPGLVKPS DIQMTQSPSSLSASV ETLSLTCTVSGGSVS GDRVTITCQASQDIS SGDYYWTWIRQSPGK NYLNWYQQKPGKAPK GLEWIGHIYYSGNTN LLIYDASNLETGVPS YNPSLKSRLTISIDT RFSGSGSGTDFTFTI SKTQFSLKLSSVTAA SSLQPEDIATYFCQH DTAIYYCVRDRVTGA FDHLPLAFGGGTKVE FDIWGQGTMVTVSS IK (SEQ ID NO: 130) (SEQ ID NO: 131)

    [0121] In some embodiments, the activator ligand is EGFR or a peptide antigen thereof, and the activator ligand binding domain is an EGFR ligand binding domain. In some embodiments, the EGFR binding domain comprises complementarity determining region (CDRs) selected from the group of CDRs disclosed in Table 7. In some embodiments, the EGFR ligand binding domain comprises CDRs having at least 9500 sequence identity to CDRs disclosed in Table 7. In some embodiments, the EGFR ligand binding domain comprises CDRs selected from SEQ ID NOs: 131-166. In some embodiments, the EGFR ligand binding domain comprises a heavy chain CDR 1 (CDR H1) selected from the group consisting of SEQ ID NOs: 132-137. In some embodiments, the EGFR ligand binding domain comprises a heavy chain CDR 2 (CDR H-2) selected from the group consisting of SEQ ID NOs: 138-143. In some embodiments, the EGFR ligand binding domain comprises a heavy chain CDR 3 (CDR H-3) selected from the group consisting of SEQ ID NOs: 144-149. In some embodiments, the EGFR ligand binding domain comprises a light chain CDR 1 (CDR L1) selected from the group consisting of SEQ ID NOs: 150-155. In some embodiments, the EGFR ligand binding domain comprises a light chain CDR 2 (CDR L2) selected from the group consisting of SEQ ID NOs: 156-160. In some embodiments, the EGFR ligand binding domain comprises a light chain CDR 3 (CDR L3) selected from the group consisting of SEQ ID NOs: 161-166. In some embodiments, the EGFR ligand binding domain comprises a CDR H1 selected from SEQ ID NOs: 132-137, a CDR H2 selected from SEQ ID NOs: 138-143, a CDR H3 selected from SEQ ID NOs: 144-149, a CDR L1 selected from SEQ ID NOs: 150-155, a CDR L2 selected from SEQ ID NOs: 156-160, and a CDR L3 selected from SEQ ID NOs: 156-160.

    TABLE-US-00007 TABLE 7 EGFR antigen binding domain CDRs CDR H1 CDR H2 CDR H3 CDR L1 CDR L2 CDR L3 TYGMH VIWDD DGITM RASQD DASSL QQFNS (SEQ GSYKY VRGVM ISSAL ES YPLT ID YGDSV KDYFD V (SEQ (SEQ NO: KG Y (SEQ ID ID 132) (SEQ (SEQ ID NO: NO: ID ID NO: 156) 161) NO: NO: 150) 138) 144) EYPIH MIYTD DRYDS RSSQS KVSNR SQSTH (SEQ IGKPT LFDY LVHSN FS VPWT ID YAEEF (SEQ GNTYL (SEQ (SEQ NO: KG ID H ID ID 133) (SEQ NO: (SEQ NO: NO: ID 145) ID 157) 162) NO: NO: 139) 151) HYDMS YIASG SSYGN RSSQS KVSNR SQSTH (SEQ GDITY NGDAL LVHSN FS VLT ID YADTV DF GNTYL (SEQ (SEQ NO: KG (SEQ H ID ID 134) (SEQ ID (SEQ NO: NO: ID NO: ID 157) 163) NO: 146) NO: 140) 152) NYGVH VIWSG ALTYY RASQS YASES QQNNN (SEQ GNTDY DYEFA IGTNI IS WPTT ID NTPFT Y H (SEQ (SEQ NO: S (SEQ (SEQ ID ID 135) (SEQ ID ID NO: NO: ID NO: NO: 158) 164) NO: 147) 153) 141) SHWMH EFNPS RDYDY SASSS DTSNL QQWSS (SEQ NGRTN DGRYF VTYMY AS HIFT ID YNEKF DY (SEQ (SEQ NO: KS (SEQ (SEQ ID ID 136) (SEQ ID ID NO: NO: ID NO: NO: 159) 165) NO: 148) 154) 142) SGDYY HIYYS DRVTG QASQD DASNL QHFDH WT GNTNY AFDI ISNYL ET LPLA (SEQ NPSLK (SEQ N (SEQ (SEQ ID S ID (SEQ ID ID NO: (SEQ NO: ID NO: NO: 137) ID 149) NO: 160) 166) NO: 155) 143)

    [0122] In some embodiments, the activator ligand is a pan-HLA ligand, and the activator binding domain is a pan-HLA binding domain, i.e. a binding domain that binds to and recognizes an antigenic determinant shared among products of the HLA A, B and C loci. Various single variable domains known in the art or disclosed herein are suitable for use in embodiments. Such scFvs include, for example and without limitation, the following mouse and humanized pan-HLA scFv antibodies. An exemplary pan-HLA ligand is W6/32, which recognizes a conformational epitope, reacting with HLA class I alpha3 and alpha2 domains. Illustrative pan-HLA scFv binding domains derived from W6/32 are shown in Table 8.

    TABLE-US-00008 TABLE 8 Illustrative pan-HLA scFv binding domains derived from W6/32 Polynucleotide Protein Sequence Sequence scFv (mouse): scFv (mouse) SEQ QVQLKQSGPGLVQPSQSLSLTCTVSGFSLTSYGVHWVRQPPGKGLEWLGVIWSG ID NO: 168 GSTDYNAAFISRLSIRKDNSKSQVFFKMNSLQADDTAIYYCARTFTTSTSAWFAYW GQGTLVTVSAGGGGSGGGGSGGGGSGGSIVMTQTPKFLLVSAGDRVTITCKASQ SVSNDVAWYQQKPGQSPICLLIYYASNRYTGVPDRFTGSGYGTDFTFTISTVQAED LAVYFCQQDYSSPPWTFGGGTKLEIR (SEQ ID NO: 167) scFv (humanized): scFv (humanized) QVQLQESGPGLVKPSQTLSLTCTVSGFSLTSYGVHWIRQPPGKGLEWIGVIWSGG SEQ ID NO: 170 STDYNAAFISRVTISVDTSKNQFSLKLSSVTAADTAVYYCARTFTTSTSAWFAYWG QGTLVTVSSGGGGSGGGGSGGGGSGGDIVMTQSPDSLAVSLGERATINCKASQS VSNDVAWYQQKPGQPPKLLIYYASNRYTGVPDRFSGSGSGTDFTLTISSLQAEDV AVYYCQQDYSSPPWTFGGGTKVEIK (SEQ ID NO: 169) scFv (humanized): scFv (humanized) EVQLLESGGGLVQPGGSLRLSCAASGFSLTSYGVHWVRQAPGKGLEWVSVIWSG SEQ ID NO: 172 GSTDYNAAFISRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARTFTTSTSAWFAY WGQGTLVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDRVTITCKA SQSVSNDVAWYQQKPGKAPKLLIYYASNRYTGVPSRFSGSGSGTDFTFTISSLQPE DIATYYCQQDYSSPPWTFGGGTKVEIK (SEQ ID NO: 171) scFv (humanized): scFv (humanized) QVQLQESGPGLVKPSETLSLTCTVSGFSLTSYGVHWIRQPPGKGLEWIGVIWSGG SEQ ID NO: 174 STDYNAAFISRVTISRDTSKNQFSLKLSSVTAADTAVYYCARTFTTSTSAWFAYWG QGTLVTVSSGGGGSGGGGSGGGGSGGDIVMTQTPLSLSVTPGQPASISCKASQS VSNDVAWYLQKPGQSPQLLIYYASNRYTGVPDRFSGSGSGTDFTLKISRVEAEDV GVYYCQQDYSSPPWTFGGGTKVEIK (SEQ ID NO: 173) scFv (humanized): scFv (humanized) QVQLVESGGGVVQPGRSLRLSCAVSGFSLTSYGMHWVRQAPGKGLEWVAVIW SEQ ID NO: 176 SGGSTDYNAAFISRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKTFTTSTSAWFA YWGQGTLVTVSSGGGGSGGGGSGGGGSGGEIVLTQSPATLSLSPGERATLSCRA SQSVSNDLAWYQQKPGQAPRLLIYYASNRYTGVPDRFSGSGSGTDFTLTISSLEPE DFAVYYCQQDYSSPPWTFGQGTKVEIK (SEQ ID NO: 175) scFv (humanized): scFv (humanized) QVQLVESGGGVVQPGRSLRLSCAVSGFSLTSYGMHWVRQAPGKGLEWVAVIW SEQ ID NO: 178 SGGSTDYNAAFISRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARTFTTSTSAWFA YWGQGTLVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDRVTITCQ ASQSVSNDLNWYQQKPGKAPKLLIYYASNRYTGVPDRFSGSGSGTDFTFTISSLQP EDIATYYCQQDYSSPPWTFGGGTKVEIK (SEQ ID NO: 177)

    [0123] In some embodiments, the activator ligand is pan-HLA ligand, and the activator ligand binding domain comprises a pan-HLA ligand binding domain. In some embodiments, the pan-HLA ligand binding domain comprises an scFv domain. In some embodiments, the pan-HLA ligand binding domain comprises a sequence of SEQ ID NO: 167, SEQ ID NO: 169, SEQ ID NO: 171, SEQ ID NO: 173, SEQ ID NO: 175, or SEQ ID NO: 177. In some embodiments, the pan-HLA ligand binding domain comprises a sequence at least 90%, at least 9500 or at least 9900 identical to SEQ ID NO: 167, SEQ ID NO: 169, SEQ ID NO: 171, SEQ ID NO: 173, SEQ ID NO: 175, or SEQ ID NO: 177. In some embodiments, the pan-HLA ligand binding domain is encoded by a sequence comprising SEQ ID NO: 168, SEQ ID NO: 170, SEQ ID NO: 172, SEQ ID NO: 174, SEQ ID NO: 176, or SEQ ID NO: 178. In some embodiments, the pan-HLA ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity or at least 99% identity to a sequence of SEQ ID NO: 168, SEQ ID NO: 170, SEQ ID NO: 172, SEQ ID NO: 174, SEQ ID NO: 176, or SEQ ID NO: 178.

    [0124] In some embodiments, the activator ligand is CD19 molecule (CD19) or a peptide antigen thereof, and the activator ligand binding domain comprises a CD19 ligand binding domain. In some embodiments, the CD19 ligand binding domain comprises an scFv domain. In some embodiments, the CD19 ligand binding domain comprises a sequence at least 90%, at least 95% or at least 99% identical to SEQ ID NO: 275 or SEQ ID NO: 277. In some embodiments, the CD-19 ligand binding domain comprises a sequence of SEQ ID NO: 275 or SEQ ID NO: 277. In some embodiments, the CD19 ligand binding domain is encoded by a sequence comprising SEQ ID NO: 276, or SEQ ID NO: 278. In some embodiments, the CD19 ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity or at least 99% identity to a sequence of SEQ ID NO: 276 or SEQ ID NO: 278.

    [0125] In some embodiments, activator ligand is CD19 molecule (CD19) or a peptide antigen thereof, and the activator receptor is a CAR. In some embodiments, the CD19 CAR comprises a sequence at least 90%, at least 95% or at least 99% identical to SEQ ID NO: 279 or SEQ ID NO: 281. In some embodiments, the CD19 CAR comprises or consists essentially of SEQ ID NO: 279 or SEQ ID NO: 281. In some embodiments, the CD19 CAR is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity or at least 99% identity to a sequence of SEQ ID NO: 280 or SEQ ID NO: 390. In some embodiments, the CD19 CAR is encoded by a sequence comprising or consisting essentially of SEQ ID NO: 280 or SEQ ID NO: 390. It will be appreciated by the person of ordinary skill that first, activator ligand binding domains for the first receptor may be isolated or derived from any source known in the art, including, but not limited to, art recognized T cell receptors, chimeric antigen receptors and antibody binding domains. For example, the first ligand binding domain may be derived from any of the antibodies disclosed in Table 9, and bind to a first ligand selected from the antigens described in Table 9. Accordingly, the immune cells comprising the two receptor system described can be used to treat any of the diseases or disorders described in Table 9. Selection of an appropriate first, activator receptor ligand binding domain to treat any the cancers described herein will be apparent to those of skill in the art. Table 9. Exemplary Antibodies

    TABLE-US-00009 Antigen Antibody Exemplary Diseases and Disorders TNF receptor superfamily Urelumab, Utomilumab cancer, diffuse large B-cell lymphoma member 9 (4-1BB, CD137) 5′-nucleotidase Oleclumab pancreatic and colorectal cancer trophoblast glycoprotein Naptumomab non-small cell lung carcinoma, renal (5T4) cell carcinoma activin receptor-like Ascrinvacumab cancer kinase 1 alpha-fetoprotein Tacatuzumab cancer angiopoietin 2 Nesvacumab, Vanucizumab cancer TNF superfamily member Belimumab, Tabalumab, cancers and autoimmune disorders 13b (BAFF) Tibulizumab TNF receptor superfamily Belantamab multiple myeloma member 17 (BCMA) mucin 16, cell surface Igovomab, Oregovomab, ovarian cancer associated (CA-125) Sofituzumab C-C motif chemokine Mogamulizumab adult T-cell leukemia/lymphoma receptor 4 (CCR4) interleukin 3 receptor Talacotuzumab leukemia subunit alpha (CD123) TNF receptor superfamily Tavolimab, Vonlerolizumab cancer member 4 (CD134) cytotoxic T-lymphocyte Ipilimumab melanoma associated protein 4 (CD152) CD19 molecule (CD19) Duvortuxizumab, Blinatumomab, cancer Coltuximab, Denintuzumab, Inebilizumab, Loncastuximab, Taplitumomab membrane spanning 4- Ibritumomab, Obinutuzumab, cancers, multiple sclerosis, domains A1 (CD20) Ocaratuzumab, Ocrelizumab, autoimmune disorders Ofatumumab, Rituximab, Tositumomab, Veltuzumab CD200 molecule (CD200) Samalizumab cancer CD22 molecule (CD22) Bectumomab, Epratuzumab, cancer Inotuzumab, Moxetumomab, Pinatuzumab Fc fragment of IgE Gomiliximab, Lumiliximab chronic lymphocytic leukemia receptor II (CD23, IgE receptor) interleukin 2 receptor Camidanlumab, Basiliximab, leukemias and lymphomas subunit alpha (CD25) Inolimomab, Daclizumab CD27 molecule (CD27) Varlilumab solid tumors and hematologic malignancies CD276 molecule (CD276) Enoblituzumab, Omburtamab cancer TNF receptor superfamily Brentuximab, Iratumumab Hodgkin's lymphoma member 8 (CD30, TNFRSF8) CD33 molecule (CD33) Gemtuzumab, Lintuzumab, acute myelogenous leukemia Vadastuximab CD37 molecule (CD37) Lilotomab, Otlertuzumab, cancer Tetulomab CD38 molecule (CD38) Daratumumab, Isatuximab multiple myeloma CD44 molecule v6 (CD44 Bivatuzumab squamous cell carcinoma v6) integrin subunit alpha V Abituzumab, Intetumumab cancer (CD51) neural cell adhesion Lorvotuzumab cancer molecule 1 (CD56) CD6 molecule (CD6) Itolizumab psoriasis CD70 molecule (CD70) Cusatuzumab, Vorsetuzumab cancer CD74 molecule (CD74) Milatuzumab hematological malignancies CD79B molecule (CD79B) Polatuzumab, Iladatuzumab Hematological cancers CD80 molecule (CD80) Galiximab B-cell lymphoma CEA cell adhesion Altumomab, Arcitumomab, cancer, colorectal cancer molecule 5 (CEA) Labetuzumab, Cibisatamab Claudin 18 Isoform 2 Zolbetuximab gastric cancer Colony stimulating factor Lacnotuzumab cancer 1 (CSF1) colony stimulating factor 1 Cabiralizumab, Emactuzumab cancer receptor (CSF1R) Colony stimulating factor Gimsilumab, Lenzilumab, leukemias 2 (CSF2) Otilimab, Mavrilimumab cytotoxic T-lymphocyte Tremelimumab non-small cell lung, head & neck, associated protein 4 urothelial cancer (CTLA-4) CXCR4 (CD184) Ulocuplumab hematologic malignancies dendritic cell-associated Tepoditamab cancer lectin 2 delta like canonical Notch Rovalpituzumab small cell lung cancer ligand 3 (DLL3) delta like canonical Notch Demcizumab cancer ligand 4 (DLL4) TNF receptor superfamily Drozitumab cancer member 10b (DR5) EGF like domain multiple 7 Parsatuzumab cancer (EGFL7) epidermal growth factor Cetuximab, Depatuxizumab, cancer receptor (EGFR) Futuximab, Imgatuzumab, Laprituximab, Matuzumab, Necitumumab, Nimotuzumab, Panitumumab, Zalutumumab, Modotuximab, Amivantamab, Tomuzotuximab, Losatuxizumab epithelial cell adhesion Adecatumumab, Citatuzumab, cancer molecule (EpCAM) Edrecolomab, Oportuzumab, Solitomab, Tucotuzumab, Catumaxomab EPH receptor A3 (EPHA3) Ifabotuzumab glioblastoma multiforme erb-b2 receptor tyrosine Duligotuzumab, Elgemtumab, cancer kinase 3 (ERBB3, HER3) Lumretuzumab, Patritumab, Seribantumab, Zenocutuzumab fibroblast growth factor Aprutumab, Bemarituzumab cancer receptor (FGFR2) Frizzled receptor Vantictumab cancer GD2 ganglioside Dinutuximab neuroblastoma GD3 ganglioside Ecromeximab malignant melanoma GD3 ganglioside Mitumomab small cell lung carcinoma glypican 3 Codrituzumab cancer glycoprotein nmb Glembatumumab melanoma, breast cancer (GPNMB) epidermal growth factor Zatuximab cancer receptor (HER1) erb-b2 receptor tyrosine Ertumaxomab, Margetuximab, cancer, breast cancer kinase 2 (HER2) Timigutuzumab, Gancotamab, Pertuzumab, Trastuzumab hepatocyte growth factor Ficlatuzumab, Rilotumumab cancer (HGF) MET proto-oncogene, Telisotuzumab, Emibetuzumab cancer receptor tyrosine kinase (HGFR) IGF-1 receptor (CD221) Cixutumumab, Dalotuzumab, cancer Figitumumab, Ganitumab, Robatumumab, Teprotumumab Interleukin 3 receptor Flotetuzumab hematological malignancies Interleukin 1 alpha (IL1A) Bermekimab colorectal cancer Interleukin 2 (IL2) Cergutuzumab cancer integrin α5β1 Volociximab solid tumors integrin α.sub.vβ.sub.3 Etaracizumab melanoma, prostate cancer, ovarian cancer lymphocyte activating 3 Relatlimab melanoma (LAG3) C-C motif chemokine Carlumab cancer ligand 2 (MCP-1) mesothelin Amatuximab cancer Mucin 1 Clivatuzumab, Gatipotuzumab, cancer Pemtumomab, Cantuzumab, Pankomab NGNA ganglioside Racotumomab non-small cell lung cancer Notch 1 Brontictuzumab cancer Notch receptor Tarextumab cancer neuropilin 1 (NRP1) Vesencumab cancer programmed cell death 1 Camrelizumab, Cetrelimab, cancer (PD-1) Nivolumab, Pembrolizumab, Pidilizumab, Cemiplimab, Spartalizumab CD274 molecule (PD-L1) Atezolizumab, Avelumab, cancer Durvalumab receptor tyrosine kinase Cirmtuzumab leukemia like orphan receptor 1 (ROR1) tenascin C Tenatumomab cancer transforming growth Fresolimumab cancer factor beta 1 (TGF-β) VEGF-A Brolucizumab, Bevacizumab, cancer Ranibizumab, Varisacumab, Faricimab VEGFR-1 Icrucumab cancer VEGFR2 Alacizumab, Ramucirumab cancer

    Inhibitors

    [0126] The disclosure provides a second ligand, an inhibitor, and a second engineered receptor comprising a second ligand binding domain that binds to the inhibitor ligand.

    [0127] The disclosure provides a second engineered receptor comprising an extracellular region, the extracellular region comprising a second ligand binding domain capable of specifically binding to a second ligand that inhibits activation of effector cells expressing the first and second receptors, wherein the effector cells are activated by binding of the first ligand to the first engineered receptor.

    [0128] As used herein an “inhibitor” or “inhibitor ligand,” sometimes called a “blocker,” refers to a second ligand that binds to a second, ligand binding domain (inhibitor LBD) of an engineered receptor of the disclosure, but inhibits activation of an immune cell expressing the engineered receptor. The inhibitor is not expressed by the target cells. The inhibitor ligand is also expressed in a plurality of normal, non-target cells, including normal, non-target cells that express the activator ligand, thereby protecting these cells from the cytotoxic effects of the adoptive cell therapy. Without wishing to be bound by theory, inhibitor ligands can block activation of the effector cells through a variety of mechanisms. For example, binding of the inhibitor ligand to the inhibitor LBD can block transmission of a signal that occurs upon binding of the activator ligand to the activator LBD that would, in the absence of the inhibitor, lead to activation of the immune cell expressing the engineered receptors described herein.

    [0129] Alternatively, or in addition, binding of the inhibitor ligand to the second engineered receptor can cause loss of cell surface expression the first, activator receptor from the surface of the immune cells comprising the two receptor system described herein. Without wishing to be bound by theory, it is thought that immune cell engagement of activator and inhibitor ligands on normal cells causes the inhibitor receptor to cause removal of nearby activator receptor molecules from the immune cell surface. This process locally desensitizes the immune cell, reversibly raising its activation threshold. Immune cells that engage only the activator ligand on a target cell cause local activation signals which are unimpeded by signals from the second, inhibitory receptor. This local activation increases until release of cytotoxic granules leads to target cell selective cell death. However, modulation of surface receptor expression levels may not be the only mechanism by which blocker receptors inhibit activation of immune cells by the first activator receptor. Without wishing to be bound by theory, other mechanisms may come into play, including, but not limited to, cross-talk between activator and blocker receptor signaling pathways.

    [0130] In some embodiments, the second ligand is not expressed by the target cells, and is expressed by the non-target cells. In some embodiments, the target cells are cancer cells and the non-target cells are non-cancerous cells.

    [0131] In some embodiments, the second, inhibitor ligand binding domain comprises an scFv domain.

    [0132] In some embodiments, the second, inhibitor ligand binding domain comprises a Vβ-only ligand binding domain.

    [0133] In some embodiments, the second, inhibitor ligand binding domain comprises an antigen binding domain isolated or derived from a T cell receptor (TCR). For example, the second, inhibitor ligand binding domain comprises TCR α and β chain variable domains.

    Inhibitor Targets

    [0134] In some embodiments, the inhibitor ligand comprises a gene with high, homogeneous surface expression across tissues, or a peptide antigen thereof. Without wishing to be bound by theory, high, homogeneous surface expression across tissues allows the inhibitor ligand to deliver a large, even inhibitory signal. Alternatively, or in addition, expression of activator and inhibitor targets may be correlated, i.e. the two are expressed at similar levels on non-target cells.

    [0135] In some embodiments, the second, inhibitor ligand is a peptide ligand. In some embodiments, the second, inhibitor ligand is a peptide antigen complexed with a major histocompatibility (MHC) class I complex (peptide MHC, or pMHC). Inhibitor ligands comprising peptide antigens complexed with pMHC comprising any of HLA-A, HLA-B or HLA-C are envisaged as within the scope of the disclosure.

    [0136] In some embodiment, the inhibitor ligand is encoded by a gene that is absent or polymorphic in many tumors.

    [0137] Methods of distinguishing the differential expression of inhibitor ligands between target and non-target cells will be readily apparent to the person or ordinary skill in the art. For example, the presence or absence of inhibitor ligands in non-target and target cells can be assayed by immunohistochemistry with an antibody that binds to the inhibitor ligand, followed by microscopy or FACS, RNA expression profiling of target cells and non-target cells, or DNA sequencing of non-target and target cells to determine if the genomic locus of the inhibitor ligand comprises mutations in either the target or non-target cells.

    Alleles Lost Due to Loss of Heterozygosity (LOH)

    [0138] Homozygous deletions in primary tumors are rare and small, and therefore unlikely to yield target B candidates. For example, in an analysis of 2218 primary tumors across 21 human cancer types, the top four candidates were cyclin dependent kinase inhibitor 2A (CDKN2A), RB transcriptional corepressor 1 (RB1), phosphatase and tensin homolog (PTEN) and N3PB2. However, CDKN2A (P16) was deleted in only 5% homozygous deletion across all cancers. Homozygous HLA-A deletions were found in less than 0.2% of cancers (Cheng et al., Nature Comm. 8:1221 (2017)). In contrast, deletion of a single copy of a gene in cancer cells due to loss of hemizygosity occurs far more frequently.

    [0139] In some embodiments, the second, inhibitor ligand comprises an allele of a gene that is lost in target cells due to loss of heterozygosity. In some embodiments, the target cells comprises cancer cells. Cancer cells undergo frequent genome rearrangements, including duplication and deletions. These deletions can lead to the deletion of one copy of one or more genes in the cancer cells.

    [0140] As used herein, “loss of heterozygosity (LOH)” refers to a genetic change that occurs at high frequency in cancers, whereby one of the two alleles is deleted, leaving a single mono-allelic (hemizygous) locus.

    HLA Class I Alleles

    [0141] In some embodiments, the second, inhibitor ligand comprises an HLA class I allele. The major histocompatibility complex (MHC) class I is a protein complex that displays antigens to cells of the immune system, triggering immune response. The Human Leukocyte Antigens (HLAs) corresponding to MHC class I are HLA-A, HLA-B and HLA-C.

    [0142] In some embodiments, the second, inhibitor ligand comprises an HLA class I allele. In some embodiments, the second, inhibitor ligand comprises an allele of HLA class I that is lost in a target cell through LOH. HLA-A is a group of human leukocyte antigens (HLA) of the major histocompatibility complex (MHC) that are encoded by the HLA-A locus. HLA-A is one of three major types of human MHC class I cell surface receptors. The receptor is a heterodimer comprising a heavy a chain and smaller β chain. The α chain is encoded by a variant of HLA-A, while the R chain (β2-microglobulin) is invariant. There are several thousand HLA-A variants, all of which fall within the scope of the instant disclosure.

    [0143] In some embodiments, the second, inhibitor ligand comprises an HLA-B allele. The HLA-B gene has many possible variations (alleles). Hundreds of versions (alleles) of the HLA-B gene are known, each of which is given a particular number (such as HLA-B27).

    [0144] In some embodiments, the second, inhibitor ligand comprises an HLA-C allele. HLA-C belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). Over one hundred HLA-C alleles have been described.

    [0145] In some embodiments, the HLA class I allele has broad or ubiquitous RNA expression.

    [0146] In some embodiments, the HLA class I allele has a known, or generally high minor allele frequency.

    [0147] In some embodiments, the HLA class I allele does not require a peptide-MHC antigen, for example when the LA class I allele is recognized by a pan-LA ligand binding domain.

    [0148] In some embodiments, the second inhibitor ligand comprises an HLA-A allele. In some embodiments the HLA-A allele comprises HLA-A*02. Various single variable domains known in the art or disclosed herein that bind to and recognize HLA-A*02 are suitable for use in embodiments. Such scFvs include, for example and without limitation, the following mouse and humanized scFv antibodies that bind HLA-A*02 in a peptide-independent way shown in Table 10 below (complementarity determining regions underlined):

    TABLE-US-00010 TABLE 10 HLA-A*02 scFv binding domains HLA-A*02 antigen binding domains scFv (mouse): scFv (mouse) DVLMTQTPLSLPVSLGDQASISCRSSQSIVHSNGNTYLEWYLQKPGQSPKLLIYKVS DNA Sequence: NRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHVPRTSGGGTKLEIKGG SEQ ID NO: 179 GGSGGGGSGGGGSGGQVQLQQSGPELVKPGASVRISCKASGYTFTSYHIHWVKQ RPGQGLEWIGWIYPGNVNTEYNEKFKGKATLTADKSSSTAYMHLSSLTSEDSAVYF CAREEITYAMDYWGQGTSVTVSS (SEQ ID NO: 53) scFv (humanized): scFv QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYHIHWVRQAPGQGLEWMGWIYP (humanized) GNVNTEYNEKFKGKATITADKSTSTAYMELSSLRSEDTAVYYCAREEITYAMDYWG DNA Sequence: QGTTVTVSSGGGGSGGGGSGGGGSGGEIVLTQSPGTLSLSPGERATLSCRSSQSIV SEQ ID NO: 180 HSNGNTYLEWYQQKPGQAPRLLIYKVSNRFSGIPDRFSGSGSGTDFTLTISRLEPED FAVYYCFQGSHVPRTFGGGTKVEIK (SEQ ID NO: 54) scFv (humanized): scFv QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYHIHWVRQAPGQGLEWMGWIYP (humanized) GNVNTEYNEKFKGKATITADKSTSTAYMELSSLRSEDTAVYYCAREEITYAMDYWG DNA Sequence: QGTTVTVSSGGGGSGGGGSGGGGSGGDIVMTQTPLSLPVTPGEPASISCRSSQSIV SEQ ID NO: 181 HSNGNTYLEWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAED VGVYYCFQGSHVPRTFGGGTKVEIK (SEQ ID NO: 55) scFv (humanized): scFv EVQLVESGGGLVKPGGSLRLSCAASGYTFTSYHIHWVRQAPGKGLEWVGWIYPG (humanized) NVNTEYNEKFKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCAREEITYAMDYWG DNA Sequence: QGTTVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDRVTITCRSSQSI SEQ ID NO: 182 VHSNGNTYLEWYQQKPGKAPKLLIYKVSNRFSGVPSRFSGSGSGTDFTLTISSLQPE DFATYYCFQGSHVPRTFGGGTKVEIK (SEQ ID NO: 56) scFv (humanized): scFv QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYHIHWVRQAPGQGLEWIGWIYPG (humanized) NVNTEYNEKFKGKATITADESTNTAYMELSSLRSEDTAVYYCAREEITYAMDYWGQ DNA Sequence: GTLVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSTLSASVGDRVTITCRSSQSIV SEQ ID NO: 183 HSNGNTYLEWYQQKPGKAPKLLIYKVSNRFSGVPARFSGSGSGTEFTLTISSLQPDD FATYYCFQGSHVPRTFGQGTKVEVK (SEQ ID NO: 57) scFv (humanized): scFv QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYHMHWVRQAPGQGLEWIGYIYPG (humanized) NVNTEYNEKFKGKATLTADKSTNTAYMELSSLRSEDTAVYFCAREEITYAMDYWG DNA Sequence: QGTLVTVSSGGGGSGGGGSGGGGSGGDVQMTQSPSTLSASVGDRVTITCSSSQSI SEQ ID NO: 184 VHSNGNTYMEWYQQKPGKAPKLLIYKVSNRFSGVPDRFSGSGSGTEFTLTISSLQP DDFATYYCHQGSHVPRTFGQGTKVEVK (SEQ ID NO: 58) scFv (mouse): scFv (mouse) QVQLQQSGPELVKPGASVKMSCKASGYTFTSYHIQWVKQRPGQGLEWIGWIYPG DNA Sequence: DGSTQYNEKFKGKTTLTADKSSSTAYMLLSSLTSEDSAIYFCAREGTYYAMDYWGQ SEQ ID NO: 185 GTSVTVSSGGGGSGGGGSGGGGSGGDVLMTQTPLSLPVSLGDQVSISCRSSQSIV HSNGNTYLEWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAED LGVYYCFQGSHVPRTFGGGTKLEIK (SEQ ID NO: 59) scFv (humanized): scFv QLQLQESGPGLVKPSETLSLTCTVSGYTFTSYHIQWIRQPPGKGLEWIGWIYPGDG (humanized) STQYNEKFKGRATISVDTSKNQFSLNLDSVSAADTAIYYCAREGTYYAMDYWGKGS DNA Sequence: TVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSSLSASVGDRVTITCRSSQSIVHS SEQ ID NO: 186 NGNTYLEWYQQKPGKAPKLLIYKVSNRFSGVPSRFSGSGSGTDFTFTISSLQPEDIA TYYCFQGSHVPRTFGPGTKVDIK (SEQ ID NO: 60) scFv (humanized): scFv EVQLVQSGAELKKPGSSVKVSCKASGYTFTSYHIQWVKQAPGQGLEWIGWIYPGD (humanized) GSTQYNEKFKGKATLTVDKSTNTAYMELSSLRSEDTAVYYCAREGTYYAMDYWGQ DNA Sequence: GTLVTVSSGGGGSGGGGSGGGGSGGDIQMTQSPSTLSASVGDRVTITCRSSQSIV SEQ ID NO: 187 HSNGNTYLEWYQQKPGKAPKLLIYKVSNRFSGVPSRFSGSGSGTDFTLTISSLQPDD FATYYCFQGSHVPRTFGQGTKVEVK (SEQ ID NO: 61) scFv (humanized): scFv QVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYHIQWVRQAPGQGLEWMGWIYP (humanized) GDGSTQYNEKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCAREGTYYAMDYW DNA Sequence: GQGTTVTVSSGGGGSGGGGSGGGGSGGEIVLTQSPGTLSLSPGERATLSCRSSQSI SEQ ID NO: 188 VHSNGNTYLEWYQQKPGQAPRLLIYKVSNRFSGIPDRFSGSGSGTDFTLTISRLEPE DFAVYYCFQGSHVPRTFGGGTKVEIK (SEQ ID NO: 62) scFv (humanized): scFv QVTLKQSGAEVKKPGSSVKVSCTASGYTFTSYHVSWVRQAPGQGLEWLGRIYPGD (humanized) GSTQYNEKFKGKVTITADKSMDTSFMELTSLTSEDTAVYYCAREGTYYAMDLWGQ DNA Sequence: GTLVTVSSGGGGSGGGGSGGGGSGGEIVLTQSPGTLSLSPGERATLSCRSSQSIVHS SEQ ID NO: 189 NGNTYLAWYQQKPGQAPRLLISKVSNRFSGVPDRFSGSGSGTDFTLTISRLEPEDFA VYYCQQGSHVPRTFGGGTKVEIK (SEQ ID NO: 63) scFv (humanized): scFv QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYHMHWVRQAPGQRLEWMGWIY (humanized) PGDGSTQYNEKFKGKVTITRDTSASTAYMELSSLRSEDTAVYYCAREGTYYAMDY DNA Sequence: WGQGTLVTVSSGGGGSGGGGSGGGGSGGDIVMTQTPLSLPVTPGEPASISCRSS SEQ ID NO: 190 QSIVHSNGNTYLDWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRV EAEDVGVYYCMQGSHVPRTFGGGTKVEIK (SEQ ID NO: 64)

    [0149] Exemplary heavy chain and light chain CDRs (CDR-H1, CDR-H2 and CDR-H3, or CDR-L1, CDR-L2 and CDR-L3, respectively) for HLA-A*02 ligand binding domains are shown in Table 11 below.

    TABLE-US-00011 TABLE 11 CDRs corresponding to HLA-A*02 antigen binding domains CDR-L1 CDR-L2 CDR-L3 CDR-H1 CDR-H2 CDR-H3 RSSQSIVHSN KVSNRFSGVP FQGSHVPRT ASGYTFTSYHI WIYPGNVNT EEITYAMDY GNTYLE (SEQ DR (SEQ ID (SEQ ID NO: H (SEQ ID NO: EYNEKFKGK (SEQ ID NO: ID NO: 41) NO: 42) 43) 44) (SEQ ID NO: 46) 45) RSSQSIVHSN KVSNRFSGVP MQGSHVPRT SGYTFTSYHM WIYPGDGST EGTYYAMDY GNTYLD (SEQ DR (SEQ ID (SEQ ID NO: H (SEQ ID NO: QYNEKFKG (SEQ ID NO: ID NO: 47) NO: 48) 49) 50) (SEQ ID NO: 52) 51)

    [0150] In some embodiments, the scFv comprises the complementarity determined regions (CDRs) of any one of SEQ ID NOS: 41-52. In some embodiments, the scFv comprises a sequence at least 95% identical to any one of SEQ ID NOS: 41-52. In some embodiments, the scFv comprises a sequence identical to any one of SEQ ID NOS: 41-52. In some embodiments, the heavy chain of the antibody comprises the heavy chain CDRs of any one of SEQ ID NOS: 53-64, and wherein the light chain of the antibody comprises the light chain CDRs of any one of SEQ ID NOS: 53-64. In some embodiments, the heavy chain of the antibody comprises a sequence at least 95% identical to the heavy chain portion of any one of SEQ ID NOS: 53-64, and wherein the light chain of the antibody comprises a sequence at least 95% identical to the light chain portion of any one of SEQ ID NOS: 53-64.

    [0151] In some embodiments, the heavy chain of the antibody comprises a sequence identical to the heavy chain portion of any one of SEQ ID NOS: 53-64, and wherein the light chain of the antibody comprises a sequence identical to the light chain portion of any one of SEQ ID NOS: 53-64.

    [0152] In some embodiments, the scFv comprises a sequence at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical or identical to any one of SEQ ID NOS: 53-64.

    [0153] In some embodiments, the second, inhibitory ligand is HLA-A*02, and the inhibitory ligand binding domain comprises an HLA-A*02 ligand binding domain. In some embodiments, the second ligand binding domain binds HLA-A*02 independent of the peptide in a pMHC complex comprising HLA-A*02. In some embodiments, the HLA-A*02 ligand binding domain comprises an scFv domain. In some embodiments, the HLA-A*02 ligand binding domain comprises a sequence of any one of SEQ ID NOs: 53-64. In some embodiments, the HLA-A*02 ligand binding domain comprises a sequence at least 90%, at least 95% or at least 99% identical to a sequence of any one of SEQ ID NOs: 53-64. In some embodiments, the HLA-A*02 ligand binding domain is encoded by a sequence comprising any one of SEQ ID NOs: 180-190. In some embodiments, the HLA-A*02 ligand binding domain is encoded by a sequence having at least 80% identity, at least 85% identity, at least 90% identity, at least 95% identity or at least 99% identity to a sequence of any one of SEQ ID NOs: 180-190.

    Minor Histocompatibility Antigens

    [0154] In some embodiments, the second, inhibitor ligand comprises a minor histocompatibility antigen (MiHA). In some embodiments, the second, inhibitor ligand comprises an allele of a MiHA that is lost in a target cell through LOH.

    [0155] MiHAs are peptides derived from proteins that contain nonsynonymous differences between alleles and are displayed by common HLA alleles. The non-synonymous differences can arise from SNPs, deletions, frameshift mutations or insertions in the coding sequence of the gene encoding the MiHA. Exemplary MiHAs can be about 9-12 amino acids in length and can bind to MHC class I and MHC class II proteins. Binding of the TCR to the MHC complex displaying the MiHA can activate T cells. The genetic and immunological properties of MiHAs will be known to the person of ordinary skill in the art. Candidate MiHAs are known peptides presented by known HLA class I alleles, are known to elicit T cell responses in the clinic (for example, in graft versus host disease, or transplant rejection, and allow for patient selection by simple SNP genotyping.

    [0156] In some embodiments, the MiHA has broad or ubiquitous RNA expression.

    [0157] In some embodiments, the MiHA has high minor allele frequency.

    [0158] In some embodiments, the MiHA comprises a peptide derived from a Y chromosome gene.

    [0159] In some embodiments, the second inhibitor ligand comprises a MiHA selected from the group of MiHAs disclosed in Tables 12 and 13.

    [0160] Exemplary, but non-limiting, examples of MiHAs that are envisaged as within the scope of the instant invention are disclosed in Table 12 below. Columns in Table 12 indicate, from left to right, the name of the MiHA, the gene which from which it is derived, MHC class I variant which can display the MiHA and the sequences of the peptide variants [A/B variants indicated in brackets).

    TABLE-US-00012 TABLE 12 HLA Class I Autosomal MiHAs MiHA Gene HLA Peptide A/B LB-CYBA-1Y cytochrome b-245 alpha chain A*01:01 STMERWGQK[Y/H] (SEQ ID NO: (CYBA) 303) LB-OAS1-1R 2′-5′-oligoadenylate synthetase 1 A*01:01 ETDDPR[R/T]YQKY (SEQ ID NO: 304) (OAS1) HA-1/A2 Rho GTPase activating protein 45 A*02:01 VL[H/R]DDLLEA (SEQ ID NO: 8830) (HMHA1) HA-2 myosin IG (MYO1G) A*02:01 YIGEVLVS[V/M] (SEQ ID NO: 305) HA-8 pumilio RNA binding family A*02:01 [R/P]TLDKVLEV (SEQ ID NO: 306) member 3 (KIAA0020, PUM3) HA-3 A-kinase anchoring protein 13 A*01:01 V[T/M]EPGTAQY (SEQ ID NO: 307) (AKAP13) HwA11-S chromosome 19 open reading A*02:01 CIPPD[S/T]LLFPA (SEQ ID NO: 308) frame 48 (C19ORF48) LB-ADIR-1F torsin family 3 member A (TOR3A) A*02:01 SVAPALAL[F/S]PA (SEQ ID NO: 309) LB-HIVEP1-1S HIVEP zinc finger 1 (HIVEP1) A*02:01 SLPKH[S/N]VTI (SEQ ID NO: 310) LB-NISCH-1A nischarin (NISCH) A*02:01 ALAPAP[A/V]EV (SEQ ID NO: 311) LB-SSR1-1S signal sequence receptor subunit 1 A*02:01 [S/L]LAVAQDLT (SEQ ID NO: 312) (SSR1) LB-WNK1-1I WNK lysine deficient protein kinase A*02:01 RTLSPE[I/M]ITV (SEQ ID NO: 313) 1 (WNK1) T4A tripartite motif containing 4 A*02:01 GLYTYWSAG[A/E] (SEQ ID NO: 314) (TRIM42) UTA2-1 retroelement silencing factor 1 A*02:01 QL[L/P]NSVLTL (SEQ ID NO: 315) (KIAA1551) LB-CLYBL-1Y citramalyl-CoA lyase (CLYBL) A*02:01 SLAA(Y/D)IPRL (SEQ ID NO: 316) TRIM22 tripartite motif containing 22 A*02:01 MAVPPC[C/R]IGV (SEQ ID NO: 317) (TRIM22) PARP10-1L poly(ADP-ribose) polymerase A*02:01 GL[L/P]GQEGLVEI (SEQ ID NO: 318) family member 10 (PARP10) FAM119A-1T methyltransferase like 21A A*02:01 AMLERQF[T/I]V (SEQ ID NO: 319) (FAM119A) GLRX3-1S glutaredoxin 3 (GLRX3) A*02:01 FL[S/P]SANEHL (SEQ ID NO: 320) HNF4G-1M hepatocyte nuclear factor 4 gamma A*02:01 M[M/I]YKDILLL (SEQ ID NO: 321) (HNF4G) HMMR-IV hyaluronan mediated motility A*02:01 SLQEK[V/A]AKA (SEQ ID NO: 322) receptor (HMMR) BCL2A1 BCL2 related protein A1 (BCL2A1) A*02:01 VLQ[N/K]VAFSV (SEQ ID NO: 323) CDC26-1F cell division cycle 26 (CDC26) A*02:01 [F/S]VAGTQEVFV (SEQ ID NO: 324) APOBEC3F- apolipoprotein B mRNA editing A*02:01 FL[S/A]EHPNVTL (SEQ ID NO: 325) 1S/A enzyme catalytic subunit 3F (APOBEC3F) LB-PRCP-1D prolylcarboxypeptidase (PRCP) A*02:01 FMWDVAE[D/E]L (9mer) (SEQ ID NO: 326), FMWDVAE[D/E]LKA (11mer) (SEQ ID NO: 327) LB-CCL4-1T C-C motif chemokine ligand 4 A*02:01 CADPSE[T/S]WV (SEQ ID NO: 328) (CCL4) LB-NCAPD3- non-SMC condensin II complex A*02:01 WL[Q/R]GVVPVV (SEQ ID NO: 329) 1Q subunit D (NCAPD3) LB-NDC80-1P NDC80 kinetochore complex A*02:01 HLEEQI[P/A]KV (SEQ ID NO: 330) component (NDC80) LB-TTK-1D TTK protein kinase (TTK) A*02:01 RLH[D/E]GRVFV (SEQ ID NO: 331) WDR27-1L WD repeat domain 27 (WDR27) A*02:01 S[L/P]DDHVVAV (SEQ ID NO: 332) MIIP migration and invasion inhibitory A*02:01 SEESAVP[K/E]RSW (11mer) (SEQ ID protein (MIIP) NO: 333), EESAVP[K/E]RSW (10mer) (SEQ ID NO: 334) HER-2/NEU E erb-b2 receptor tyrosine kinase 2 A*02:01 not reported (RBB2) LB-DHX33-1C DEAH-box helicase 33 (DHX33) A*02:01, YLYEGGIS[C/R] (SEQ ID NO: 335) C*03:03 PANE1 centromere protein M (CENPM) A*03:01 RVWDLPGVLK (SEQ ID NO: 336) SP110 SP110 nuclear body protein (SP110) A*03:01 SLP[R/G]GTSTPK (SEQ ID NO: 337) ACC-1C/Y BCL2 related protein A1 (BCL2A1) A*24:02 DYLQ[Y/C]VLQI (SEQ ID NO: 338) P2RX7 purinergic receptor P2X 7 (P2RX7) A*29:02 WFHHC[H/R]PKY (SEQ ID NO: 339) ACC-4 cathepsin H (CTSH) A*31:01 ATLPLLCA[R/G] (SEQ ID NO: 340) ACC-5 CTSH A*33:03 WATLPLLCA[R/G] (SEQ ID NO: 341) AKAP13 A-kinase anchoring protein 13 B*07:02 APAGVREV[M/T] (SEQ ID NO: 342) (AKAP13) LB- apolipoprotein B mRNA editing B*07:02, [K/E]PQYHAEMCF (SEQ ID NO: 343) APOBEC3B- enzyme catalytic subunit 3B B*08:01 1K (APOBEC3B) APOBEC3H apolipoprotein B mRNA editing B*07:02 KPQQ[K/E]GLRL (SEQ ID NO: 344) enzyme catalytic subunit 3H (APOBEC3H) LB-ARHGDIB- Rho GDP dissociation inhibitor beta B*07:02 LPRACW[R/P]EA (SEQ ID NO: 345) 1R (ARHGDIB) LB-BCAT2-1R BCAT2—branched chain amino B*07:02 QP[R/T]RALLFVIL (SEQ ID NO: 346) acid transaminase 2 (BCAT2) BFAR bifunctional apoptosis regulator B*07:02 APNTGRANQQ[M/R] (SEQ ID NO: (BFAR) 347) C14orf169 ribosomal oxygenase 1 (C14orf169 B*07:02 RPR[A/V]PTEELAL (SEQ ID NO: 348) or RIOX1) LB-C16ORF- C16ORF B*07:02 [R/W]PCPSVGLSFL (SEQ ID NO: 349) 1R C18orf21 chromosome 18 open reading B*07:02 NPATP[A/T]SKL (SEQ ID NO: 350) frame 21 (C18orf21) LB-EBI3-1I Epstein-Barr virus induced 3 (EBI3) B*07:02 RPRARYY[I/V]QV (SEQ ID NO: 351) POP1 POP1 homolog, ribonuclease B*07:02 LPQKKS[N/K]AL (SEQ ID NO: 352) P/MRP subunit (POP1) SCRIB scribble planar cell polarity protein B*07:02 LPQQPP[L/P]SL (SEQ ID NO: 353) (SCRIB) MTRR 5-methyltetrahydrofolate- B*07:02 SPAS[S/L]RTDL (SEQ ID NO: 354) homocysteine methyltransferase reductase (MTRR) LLGL2 LLGL scribble cell polarity complex B*07:02 SPSL[R/H]ILAI(SEQ ID NO: 355) component 2 (LLGL2) LB-ECGF-1H thymidine phosphorylase (TYMP) B*07:02 RP[H/R]AIRRPLAL (SEQ ID NO: 356) LB-ERAP1-1R endoplasmic reticulum B*07:02 HP[R/P]QEQIALLA (11mer) (SEQ ID aminopeptidase 1 (ERAP1) NO: 357), HP[R/P]QEQIAL (9mer) (SEQ ID NO: 358) LB-FUCA2-1V alpha-L-fucosidase 2 (FUCA2) B*07:02 RLRQ[V/M]GSWL (SEQ ID NO: 359) LB-GEMIN4- gem nuclear organelle associated B*07:02, FPALRFVE[V/E] (SEQ ID NO: 360) 1V protein 4 (GEMIN4) B*08:01 HDGF heparin binding growth factor B*07:02 LPMEVEKNST[L/P] (SEQ ID NO: 361) (HDGF) LB-PDCD11- programmed cell death 11 B*07:02 GPDSSKT[F/L]LCL (SEQ ID NO: 362) 1F (PDCD11) LB-PFAS-1P phosphoribosylformylglycinamidine B*07:02 A[P/S]GHTRRKL (SEQ ID NO: 363) synthase (PFAS) LB-TEP1-1S telomerase associated protein 1 B*07:02 APDGAKVA[S/P]L (SEQ ID NO: 364) (TEP1) LB-TMEM8A- post-glycosylphosphatidylinositol B*07:02 RPRSVT[I/V]QPLL (SEQ ID NO: 365) 1I attachment to proteins 6 (TMEM8A or PGAP6) LB-USP15-1I ubiquitin specific peptidase 15 B*07:02 MPSHLRN[I/T]LL (SEQ ID NO: 366) (USP15) LRH-1 purinergic receptor P2X 5 (P2RX5) B*07:02 TPNQRQNVC (SEQ ID NO: 367) LB-MOB3A- MOB kinase activator 3A (MOB3A) B*07:02 [C/S]PRPGTWTC (SEQ ID NO: 368) 1C LB-ZDHHC6- zinc finger DHHC-type B*07:02 RPR[Y/H]WILLVKI (SEQ ID NO: 369) 1Y palmitoyltransferase 6 (ZDHHC6) ZAPHIR zinc finger protein 419 (ZNF419) B*07:02 IPRDSWWVEL (SEQ ID NO: 370) HEATR1 HEAT repeat containing 1 (HEATR1) B*08:01 ISKERA[E/G]AL (SEQ ID NO: 371) LB-GSTP1-1V glutathione S-transferase pi 1 B*08:01 DLRCKY[V/I]SL (SEQ ID NO: 372) (GSTP1) HA-1/B60 Rho GTPase activating protein 45 B*40:01 KECVL[H/R]DDL (SEQ ID NO: 373) (HMHA1) LB-SON-1R SON DNA and RNA binding protein B*40:01 SETKQ[R/C]TVL (SEQ ID NO: 374) (SON) LB-SWAP70- switching B cell complex subunit B*40:01 MEQLE[Q/E]LEL (SEQ ID NO: 375) 1Q SWAP70 (SWAP70) LB-TRIP10- thyroid hormone receptor B*40:01 G[E/G][P/S]QDL[C/G]TL (SEQ ID NO: 1EPC interactor 10 (TRIP10) 376) LB-NUP133- nucleoporin 133 (NUP133) B*40:01 SEDLILC[R/Q]L (SEQ ID NO: 377) 1R LB-ZNFX1-1Q zinc finger NFXl-type containing 1 B*40:01 NEIEDVW[Q/H]LDL (SEQ ID NO: (ZNFX1) 378) SLC1A5 solute carrier family 1 member 5 B*40:02 AE[A/P]TANGGLAL (SEQ ID NO: 379) (SLC1A5) ACC-2 BCL2A1 B*44:02, KEFED[D/G]IINW (SEQ ID NO: 380) B*44:03 ACC-6 histocompatibility minor serpin B*44:03 MEIFIEVFSHF (SEQ ID NO: 381) domain containing (HMSD) HB-1H/Y histocompatibility minor HB-1 B*44:03 EEKRGSL[H/Y]VW (SEQ ID NO: 382) (HMHB1) DPH1 diphthamide biosynthesis 1 (DPH1) B*57:01 S[V/L]LPEVDVW (SEQ ID NO: 383) UGT2B17/A02 UDP glucuronosyltransferase family A*02:06 CVATMIFMI (SEQ ID NO: 384) 2 member B17 (UGT2B17) UGT2B17/A29 UGT2B17 A*29:02 AELLNIPFLY (SEQ ID NO: 385) UGT2B17/B44 UGT2B17 B*44:03 AELLNIPFLY (SEQ ID NO: 386)

    [0161] Exemplary, but non-limiting, examples of MiHAs that are envisaged as within the scope of the instant invention are disclosed in Table 13 below. Columns in Table 13 indicate, from left to right, the name of the MiHA, the gene which from which it is derived, MHC class I variant which can display the MiHA and the sequences of the peptide variants [A/B variants indicated in brackets).

    TABLE-US-00013 TABLE 13 HLA Class I Y linked MiHAs MiHA Gene HLA Peptide A/B DFFRY ubiquitin specific peptidase 9 Y- A*01:01 IVD[C/S]LTEMY (SEQ ID NO: 387) linked (DFFRY) SMCY lysine demethylase 5 (SMCY) A*02:01 FIDSYICQV (SEQ ID NO: 388) TMSB4Y thymosin beta 4 Y-linked (TMSB4Y) A*33:03 EVLLRPGLHFR (SEQ ID NO: 389) SMCY SMCY B*07:02 SP[S/A]VDKA[R/Q]AEL (SEQ ID NO: 34) UTY ubiquitously transcribed B*08:01 LPHN[H/R]T[D/N]L (SEQ ID NO: 25) tetratricopeptide repeat containing, Y-linked (UTY) RPS4Y ribosomal protein S4 Y-linked 1 B*52:01 TIRYPDP[V/L]I (SEQ ID NO: 24) (RPS4Y) UTY UTY B*60:01 [R/G]ESEE[E/A]S[V/P]SL (SEQ ID NO: 23)

    [0162] In some embodiments, the MiHA comprises HA-1. HA-1 is a peptide antigen having a sequence of VL[H/R]DDLLEA (SEQ ID NO: 8830), and is derived from the Rho GTPase activating protein 45 (HA-1) gene.

    [0163] Exemplary ligand binding domains that selectively bind to HA-1 variant H peptide (VLHDDLLEA (SEQ ID NO: 191)) are shown in Table 14 below. TCR alpha and TCR beta sequences in SEQ ID NO: 193 are separated by a P2A self-cleaving polypeptide of sequence ATNFSLLKQAGDVEENPGP (SEQ ID NO: 192) with an N terminal GSG linker.

    TABLE-US-00014 TABLE 14 Ftcr HA-1(H) Inhibitory Receptor Sequences HA-1H TCRalpha T48C P2A KP7 HA-1H TCRbeta S57C: HA-1H MVKIRQFLLAILWLQLSCVSAAKNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHP TCRalpha GGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSVSGAGSYQLTF T48C P2A GKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLD KP7 HA-1H MRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLN TCRbeta FQNLSVIGFRILLLKVAGFNLLMTLRLWSSGSGATNFSLLKQAGDVEENPGPMGTSLLCW S57C DNA MALCLLGADHADTGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEFLTY Sequence: FQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSIDSFNEQFFGPGTRL SEQ ID NO: TVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVC 194 TDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAK PVTQIVSAEAWGRADCGFTSESYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKD SRG (SEQ ID NO: 193) HA-1H TCRalpha: HA-1H TCR MVKIRQFLLAILWLQLSCVSAAKNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHP alpha DNA GGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSVSGAGSYQLTF Sequence: GKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLD SEQ ID NO: MRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLN 201 FQNLS (SEQ ID: 199) HA-1(H) TCRbeta: HA-1H MGTSLLCWMALCLLGADHADTGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTL TCRbeta GQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSIDSFNE DNA QFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVN Sequence: GKEVHSGVCTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSEND SEQ ID NO: EWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLS (SEQ ID NO: 200) 202 HA-1H FTCRalpha LIR1 TICD: HA-1H MVKIRQFLLAILWLQLSCVSAAKNEVEQSPQNLTAQEGEFITINCSYSVGISALHWLQQHP FTCRalpha GGGIVSLFMLSSGKKKHGRLIATINIQEKHSSLHITASHPRDSAVYICAVRSVSGAGSYQLTF LIR1 TICD GKGTKLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLD DNA MRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLN Sequence: FQNLSVVIGILVAVILLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGL SEQ ID NO: QWRSSPAADAQEENLYAAVKHTQPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREM 196 ASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSLTLRREATEPPPSQE GPSPAVPSIYATLAIH (SEQ ID NO: 195) HA-1H FTCRbeta LIR1 TICD: HA-1H MGTSLLCWMALCLLGADHADTGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTL FTCRbeta GQGPEFLTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSIDSFNE LIR1 TICD QFFGPGTRLTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVN DNA GKEVHSGVCTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSEND Sequence: EWTQDRAKPVTQIVSAEAWGRADCGFTSESYQQGVLSVVIGILVAVILLLLLLLLLFLILRHR SEQ ID NO: RQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQPE 198 DGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMD TEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH (SEQ ID NO: 197)

    [0164] In some embodiments, the second, inhibitory ligand comprises HA-1(H). In some embodiments, the second, inhibitory ligand binding is isolated or derived from a TCR. In some embodiments, the second, inhibitory ligand binding domain comprises TCR alpha and TCR beta variable domains. In some embodiments, the TCR alpha and TCR beta variable domains are separated by a self-cleaving polypeptide sequence. In some embodiments, the TCR alpha and TCR beta variable domains separated by a self-cleaving polypeptide sequence comprise SEQ ID NO: 193. In some embodiments, the TCR alpha and TCR beta variable domains separated by a self-cleaving polypeptide sequence comprise SEQ ID NO: 193, or a sequence having at least 9000, at least 9500, or at least 9900 identity thereto. In some embodiments, the TCR alpha and TCR beta variable domains are encoded by a sequence of SEQ ID NO: 194, or a sequence having at least 800% identity, at least 9000, at least 9500, or at least 9900 identity thereto. In some embodiments, the TCR alpha variable domain comprises SEQ ID NO: 199 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto. In some embodiments, the TCR beta variable domain comprises SEQ ID NO: 200 or a sequence having at least 90%, at least 95%, or at least 99% identity thereto.

    Loss of Y Chromosome Antigens

    [0165] In some embodiments, the second, inhibitor ligand comprises a Y chromosome gene, i.e. peptide encoded by a gene on the Y chromosome. In some embodiments, the second, inhibitor ligand comprises a peptide encoded by a Y chromosome gene that is lost in target cells through loss of Y chromosome (LoY). For example, about a third of the characterized MiHAs come from the Y chromosome. The Y chromosome contains over 200 protein coding genes, all of which are envisaged as within the scope of the instant disclosure.

    [0166] As used herein, “loss of Y”, or “LoY” refers a genetic change that occurs at high frequency in tumors whereby one copy of part or all of the Y chromosome is deleted, leading to a loss of Y chromosome encoded gene(s).

    [0167] Loss of Y chromosome is known to occur in certain cancers. For example, there is a reported 40% somatic loss of Y chromosome in renal clear cell cancers (Arseneault et al., Sci. Rep. 7: 44876 (2017)). Similarly, clonal loss of the Y chromosome was reported in 5 out of 31 in male breast cancer subjects (Wong et al., Oncotarget 6(42):44927-40 (2015)). Loss of the Y chromosome in tumors from male patients has been described as a “consistent feature” of head and neck cancer patients (el-Naggar et al., Am J Clin Pathol 105(1):102-8 (1996)). Further, Y chromosome loss was associated with X chromosome disomy in four of seven male patients with gastric cancer (Saal et al., Virchows Arch B Cell Pathol (1993)). Thus, Y chromosome genes can be lost in a variety of cancers, and can be used as inhibitor ligands with the engineered receptors of the instant disclosure targeting cancer cells.

    Antigen Binding Domains

    [0168] The disclosure provides a first ligand binding domain that activates a first engineered receptor, thereby activating immune cells expressing the first engineered receptor, and a second ligand binding domain that activates a second engineered receptor that inhibits activation of immune cells expressing the second engineered receptor, even in the presence of the first engineered receptor bound to the first ligand.

    [0169] Any type of ligand binding domain that can regulate the activity of a receptor in a ligand dependent manner is envisaged as within the scope of the instant disclosure. In some embodiments, the ligand binding domain is an antigen binding domain. Exemplary antigen binding domains include, inter alia, scFv, sdAb, Vβ-only domains, and TCR antigen binding domains derived from the TCR α and β chain variable domains.

    [0170] In some embodiments, the first, activator LBD comprises an antigen binding domain. In some embodiments, the second, inhibitor LBD comprises an antigen binding domain. Any type of antigen binding domain is envisaged as within the scope of the instant disclosure.

    [0171] For example, the first, activator LBD and/or the second, inhibitor LBD can comprise an antigen binding domain that can be expressed as part of a contiguous polypeptide chain including, for example, a single domain antibody fragment (sdAb) or heavy chain antibodies HCAb, a single chain antibody (scFv) derived from a murine, humanized or human antibodies (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, N.Y.; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, N.Y.; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-5883; Bird et al., 1988, Science 242:423-426). In some aspects, the first, activator LBD and/or the second, inhibitor LBD comprises an antigen binding domain that comprises an antibody fragment. In further aspects, the activator LBD comprises an antibody fragment that comprises a scFv or an sdAb. In further aspects, the inhibitor LBD comprises an antibody fragment that comprises a scFv or an sdAb.

    [0172] The term “antibody,” as used herein, refers to a protein, or polypeptide sequences derived from an immunoglobulin molecule, which specifically binds to an antigen. Antibodies can be intact immunoglobulins of polyclonal or monoclonal origin, or fragments thereof and can be derived from natural or from recombinant sources.

    [0173] The terms “antibody fragment” or “antibody binding domain” refer to at least one portion of an antibody, or recombinant variants thereof, that contains the antigen binding domain, i.e., an antigenic determining variable region of an intact antibody, that is sufficient to confer recognition and specific binding of the antibody fragment to a target, such as an antigen and its defined epitope. Examples of antibody fragments include, but are not limited to, Fab, Fab′, F(ab′)2, and Fv fragments, single-chain (sc)Fv (“scFv”) antibody fragments, linear antibodies, single domain antibodies (abbreviated “sdAb”) (either VL or VH), camelid VHH domains, and multi-specific antibodies formed from antibody fragments.

    [0174] The term “scFv” refers to a fusion protein comprising at least one antibody fragment comprising a variable region of a light chain and at least one antibody fragment comprising a variable region of a heavy chain, wherein the light and heavy chain variable regions are contiguously linked via a short flexible polypeptide linker, and capable of being expressed as a single polypeptide chain, and wherein the scFv retains the specificity of the intact antibody from which it is derived.

    [0175] “Heavy chain variable region” or “VH” (or, in the case of single domain antibodies, e.g., nanobodies, “VHH”) with regard to an antibody refers to the fragment of the heavy chain that contains three CDRs interposed between flanking stretches known as framework regions, these framework regions are generally more highly conserved than the CDRs and form a scaffold to support the CDRs.

    [0176] Unless specified, as used herein a scFv may have the VL and VH variable regions in either order, e.g., with respect to the N-terminal and C-terminal ends of the polypeptide, the scFv may comprise VL-linker-VH or may comprise VH-linker-VL.

    [0177] The term “antibody light chain,” refers to the smaller of the two types of polypeptide chains present in antibody molecules in their naturally occurring conformations. Kappa (“K”) and lambda (“V”) light chains refer to the two major antibody light chain isotypes.

    [0178] The term “recombinant antibody” refers to an antibody that is generated using recombinant DNA technology, such as, for example, an antibody expressed by a bacteriophage or yeast expression system. The term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using recombinant DNA or amino acid sequence technology which is available and well known in the art.

    [0179] The term “Vβ domain”, “Vβ-only domain”, “β chain variable domain” or “single variable domain TCR (svd-TCR)” refers to an antigen binding domain that consists essentially of a single T Cell Receptor (TCR) beta variable domain that specifically binds to an antigen in the absence of a second TCR variable domain. In some embodiments, the first, activator LBD comprises or consists essentially of a Vβ-only domain. In some embodiments, the second, inhibitor LBD comprises or consists essentially of a Vβ-only domain.

    [0180] In some embodiments, the Vβ-only domain may include additional elements besides the TCR variable domain, including additional amino acid sequences, additional protein domains (covalently associated, non-covalently associated or covalently and non-covalently associated with the TCR variable domain), fusion or non-covalent association of the TCR variable domain with other types of macromolecules (for example polynucleotides, polysaccharides, lipids, or a combination thereof), fusion or non-covalent association of the TCR variable domain with one or more small molecules, compounds, or ligands, or a combination thereof. Any additional element, as described, may be combined provided that the TCR variable domain is configured to specifically bind the epitope in the absence of a second TCR variable domain.

    [0181] In other embodiments, the Vβ-only domain as described herein functions independently of an a chain that lacks a Vα segment. For example, in some embodiments the one or more Vβ-only domains are fused to transmembrane (e.g., CD3ζ and CD28) and intracellular domain proteins (e.g., CD3ζ, CD28, and/or 4-1BB) that are capable of activating T cells in response to antigen.

    [0182] In some embodiments, the Vβ-only domain engages antigen using complementarity-determining regions (CDRs). Each s Vβ-only domain contains three complement determining regions (CDR1, CDR2, and CDR3).

    [0183] In some embodiments, the first Vβ-only domain comprises a TCR Vβ domain or an antigen-binding fragment thereof.

    [0184] In humans, the TCR variable regions of the α and γ chains are each encoded by a V and a J segment, whereas the variable region of β and δ chains are each additionally encoded by a D segment. There are multiple Variable (V), Diversity (D) and Joining (J) gene segments (e.g. 52 Vβ gene segments, 2 Dβ gene segments and 13 Jβ gene segments) (Janeway et al. (eds.), 2001, Immunobiology: The Immune System in Health and Disease. 5th Edition, New York, FIG. 4.13) which can be recombined in different V(D)J arrangements using the enzymes RAG-1 and RAG-2, which recognize recombination signal sequences (RSSs) adjacent to the coding sequences of the V, D and J gene segments. The RSSs consist of conserved heptamers and nonamers separated by spacers of 12 or 23 bp. The RSSs are found at the 3′ side of each V segment, on both the 5′ and 3′ sides of each D segment, and at the 5′ of each J segment. During recombination, RAG-1 and RAG-2 cause the formation of DNA hairpins at the coding ends of the joint (the coding joint) and removal of the RSSs and intervening sequence between them (the signal joint). The variable regions are further diversified at the junctions by deletion of a variable number of coding end nucleotides, the random addition of nucleotides by terminal deoxynucleotidyl transferase (TdT), and palindromic nucleotides that arise due to template-mediated fill-in of the asymmetrically cleaved coding hairpins.

    [0185] Patent applications WO 2009/129247 (herein incorporated by reference in its entirety) discloses an in vitro system, referred to as the HuTarg system, which utilizes V(D)J recombination to generate de novo antibodies in vitro. This same system was used to generate the variable regions of the Vβ-only domain as in patent application WO 2017/091905 (herein incorporated by reference in its entirety) by using TCR-specific V, D and J elements. In natural in vivo systems, the nucleic acid sequences which encode CDR1 and CDR2 are contained within the V (α, β, γ or δ) gene segment and the sequence encoding CDR3 is made up from portions of V and J segments (for Vα or Vγ) or a portion of the V segment, the entire D segment and a portion of the J segment (for Vβ or Vδ), but with random insertions and deletions of nucleotides at the V-J and V-D-J recombination junctions due to action of TdT and other recombination and DNA repair enzymes. The recombined T-cell receptor gene comprises alternating framework (FR) and CDR sequences, as does the resulting T-cell receptor expressed therefrom (i.e. FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4). Using in vitro V(D)J recombination (i.e. V-J or V-D-J recombination), randomized insertions and deletions may be added in or adjacent to CDR1, CDR2 and/or CDR3 (i.e. not just CDR3), additional insertions may be added using flanking sequences in recombination substrates before and/or after CDR1, CDR2 and/or CDR3, and additional deletions may be made by deleting sequences in recombination substrates in or adjacent to CDR1, CDR2 and/or CDR3.

    Engineered Receptors

    [0186] The disclosure provides a first engineered receptor comprising a first activator ligand binding domain and a second engineered receptor comprising a second inhibitor ligand binding domain described herein.

    Chimeric Antigen Receptors (CARs)

    [0187] In some embodiments, either the first or the second engineered receptor is a chimeric antigen receptor (CAR). In some embodiments, the first and second engineered receptors are chimeric antigen receptors. All CAR architectures are envisaged as within the scope of the instant disclosure.

    Extracellular Domains

    [0188] In some embodiments, the first or second ligand binding domain is fused to the extracellular domain of the CAR.

    [0189] In some embodiments, the extracellular domain of the receptor comprises a signal sequence. In some embodiments, the signal sequence is an N terminal signal sequence. In some embodiments, the signal sequence comprises a sequence of MDMRVPAQLLGLLLLWLRGARC (SEQ ID NO: 8919).

    Hinge Region

    [0190] In some embodiments, the CARs of the present disclosure comprise an extracellular hinge region. Incorporation of a hinge region can affect cytokine production from CAR-T cells and improve expansion of CAR-T cells in vivo. Exemplary hinges can be isolated or derived from IgD and CD8 domains, for example IgG1.

    [0191] In some embodiments, the hinge is isolated or derived from CD8α or CD28. In some embodiments, the CD8α hinge comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 1). In some embodiments, the CD8α hinge comprises SEQ ID NO: 1. In some embodiments, the CD8α hinge consists essentially of SEQ ID NO: 1. In some embodiments, the CD8α hinge is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00015 (SEQ ID NO: 2) ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGT CGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGG CGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT.

    [0192] In some embodiments, the CD8α hinge is encoded by SEQ ID NO: 2.

    [0193] In some embodiments, the CD28 hinge comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of CTIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 3). In some embodiments, the CD28 hinge comprises or consists essentially of SEQ ID NO: 3. In some embodiments, the CD28 hinge is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00016 (SEQ ID NO: 4) TGTACCATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGA GCAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCC CCTATTTCCCGGACCTTCTAAGCCC. 

    [0194] In some embodiments, the CD28 hinge is encoded by SEQ ID NO: 4.

    Transmembrane Domain

    [0195] The CARs of the present disclosure can be designed to comprise a transmembrane domain that is fused to the extracellular domain of the CAR. In some embodiments, the transmembrane domain that naturally is associated with one of the domains in the CAR is used. For example, a CAR comprising a CD28 co-stimulatory domain might also use a CD28 transmembrane domain. In some instances, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.

    [0196] The transmembrane domain may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein. Transmembrane regions may be isolated or derived from (i.e. comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, or from an immunoglobulin such as IgG4. Alternatively the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. In some embodiments, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain. Optionally, a short oligo- or polypeptide linker, preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR. A glycine-serine doublet provides a particularly suitable linker.

    [0197] In some embodiments of the CARs of the disclosure, the CARs comprise a CD28 transmembrane domain. In some embodiments, the CD28 transmembrane domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 5). In some embodiments, the CD28 transmembrane domain comprises or consists essentially of SEQ ID NO: 5. In some embodiments, the CD28 transmembrane domain is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00017 (SEQ ID NO: 6) TTCTGGGTGCTGGTCGTTGTGGGCGGCGTGCTGGCCTGCTACAGCCTGC TGGTGACAGTGGCCTTCATCATCTTTTGGGTG.

    [0198] In some embodiments, the CD28 transmembrane domain is encoded by SEQ ID NO: 6.

    [0199] In some embodiments of the CARs of the disclosure, the CARs comprise an IL-2Rbeta transmembrane domain. In some embodiments, the IL-2Rbeta transmembrane domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of IPWLGHLLVGLSGAFGFIILVYLLI (SEQ ID NO: 7). In some embodiments, the IL-2Rbeta transmembrane domain comprises or consists essentially of SEQ ID NO: 7. In some embodiments, the IL-2Rbeta transmembrane domain is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00018 (SEQ ID NO: 8) ATTCCGTGGC TCGGCCACCT CCTCGTGGGC CTCAGCGGGG CTTTTGGCTT CATCATCTTA GTGTACTTGC TGATC.

    [0200] In some embodiments, the IL-2Rbeta transmembrane domain is encoded by SEQ ID NO: 8.

    Cytoplasmic Domain

    [0201] The cytoplasmic domain or otherwise the intracellular signaling domain of the CARs of the instant invention is responsible for activation of at least one of the normal effector functions of the immune cell in which the CAR has been placed. The term “effector function” refers to a specialized function of a cell. Effector functions of a regulatory T cell, for example, include the suppression or downregulation of induction or proliferation of effector T cells. Thus the term “intracellular signaling domain” refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function. While usually the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire domain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal. In some cases, multiple intracellular domains can be combined to achieve the desired functions of the CAR-T cells of the instant disclosure. The term intracellular signaling domain is thus meant to include any truncated portion of one or more intracellular signaling domains sufficient to transduce the effector function signal.

    [0202] Examples of intracellular signaling domains for use in the CARs of the instant disclosure include the cytoplasmic sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any synthetic sequence that has the same functional capability. Accordingly, the intracellular domain of CARs of the instant disclosure comprises at least one cytoplasmic activation domain. In some embodiments, the intracellular activation domain ensures that there is T-cell receptor (TCR) signaling necessary to activate the effector functions of the CAR T-cell. In some embodiments, the at least one cytoplasmic activation is a CD247 molecule (CD3ζ) activation domain, a stimulatory killer immunoglobulin-like receptor (KIR) KIR2DS2 activation domain, or a DNAX-activating protein of 12 kDa (DAP12) activation domain. In some embodiments, the CD3ζ activation domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00019 (SEQ ID NO: 9) RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATK DTYDALHMQALPPR.

    [0203] In some embodiments, the CD3ζ activation domain comprises or consists essentially of SEQ ID NO: 9. In some embodiments, the CD3ζ activation domain is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00020 (SEQ ID NO: 10) AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACAAGCAGGGCC AGAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGA TGTTTTGGACAAGCGTAGAGGCCGGGACCCTGAGATGGGGGGAAAGCCG AGAAGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATA AGATGGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAG GGGCAAGGGGCACGATGGCCTTTACCAGGGACTCAGTACAGCCACCAAG GACACCTACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGC.

    [0204] In some embodiments, the CD3ζ activation domain is encoded by SEQ ID NO: 10.

    [0205] It is known that signals generated through the TCR alone are often insufficient for full activation of the T cell and that a secondary or co-stimulatory signal is also required. Thus, T cell activation can be said to be mediated by two distinct classes of cytoplasmic signaling sequence: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences) and those that act in an antigen-independent manner to provide a secondary or co-stimulatory signal (secondary cytoplasmic signaling sequences).

    [0206] Primary cytoplasmic signaling sequences regulate primary activation of the TCR complex either in a stimulatory way, or in an inhibitory way. Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs. In some embodiments, the ITAM contains a tyrosine separated from a leucine or an isoleucine by any two other amino acids (YxxL) (SEQ ID NO: 21).

    [0207] In some embodiments, the cytoplasmic domain contains 1, 2, or 3 ITAMs. In some embodiments, the cytoplasmic domain contains 1 ITAM. In some embodiments, the cytoplasmic domain contains 2 ITAMs. In some embodiments, the cytoplasmic domain contains 3 ITAMs. In some embodiments, the cytoplasmic domain contains 4 ITAMs. In some embodiments, the cytoplasmic domain contains 5 ITAMs.

    [0208] In some embodiments, the cytoplasmic domain is a CD3ζ activation domain. In some embodiments, CD3ζ activation domain comprises a single ITAM. In some embodiments, CD3ζ activation domain comprises two ITAMs. In some embodiments, CD3ζ activation domain comprises three ITAMs.

    [0209] In some embodiments, the CD3ζ activation domain comprising a single ITAM comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLHMQALPPR (SEQ ID NO: 11). In some embodiments, the CD3ζ activation domain comprises SEQ ID NO: 11. In some embodiments, the CD3ζ activation domain comprising a single ITAM consists essentially of an amino acid sequence of RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLHMQALPPR (SEQ ID NO: 11). In some embodiments, the CD3ζ activation domain comprising a single ITAM is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00021 (SEQ ID NO: 12) AGAGTGAAGT TCAGCAGGAG CGCAGACGCC CCCGCGTACC AGCAGGGCCA GAACCAGCTC TATAACGAGC TCAATCTAGG ACGAAGAGAG GAGTACGATG TTTTGCACAT GCAGGCCCTG CCCCCTCGC.

    [0210] In some embodiments, the CD3ζ activation domain is encoded by SEQ ID NO: 12.

    [0211] Further examples of ITAM containing primary cytoplasmic signaling sequences that can be used in the CARs of the instant disclosure include those derived from TCRζ, FcRγ, FcRβ, CD3γ, CD3δ, CD3ε, CD3ζ, CD5, CD22, CD79a, CD79b, and CD66d. It is particularly preferred that cytoplasmic signaling molecule in the CAR of the instant invention comprises a cytoplasmic signaling sequence derived from CD3ζ.

    Co-Stimulatory Domain

    [0212] In some embodiments, the cytoplasmic domain of the CAR can be designed to comprise the CD3ζ signaling domain by itself or combined with any other desired cytoplasmic domain(s) useful in the context of the CAR of the instant disclosure. For example, the cytoplasmic domain of the CAR can comprise a CD3ζ chain portion and a co-stimulatory domain. The co-stimulatory domain refers to a portion of the CAR comprising the intracellular domain of a costimulatory molecule. A costimulatory molecule is a cell surface molecule other than an antigen receptor or its ligands that is required for an efficient response of lymphocytes to an antigen. Examples of such molecules include the co-stimulatory domain is selected from the group consisting of IL-2Rβ, Fc Receptor gamma (FcRγ), Fc Receptor beta (FcRβ), CD3g molecule gamma (CD3γ), CD3δ, CD3ε, CD5 molecule (CD5), CD22 molecule (CD22), CD79a molecule (CD79a), CD79b molecule (CD79b), carcinoembryonic antigen related cell adhesion molecule 3 (CD66d), CD27 molecule (CD27), CD28 molecule (CD28), TNF receptor superfamily member 9 (4-1BB), TNF receptor superfamily member 4 (OX40), TNF receptor superfamily member 8 (CD30), CD40 molecule (CD40), programmed cell death 1 (PD-1), inducible T cell costimulatory (ICOS), lymphocyte function-associated antigen-1 (LFA-1), CD2 molecule (CD2), CD7 molecule (CD7), TNF superfamily member 14 (LIGHT), killer cell lectin like receptor C2 (NKG2C) and CD276 molecule (B7-H3) c-stimulatory domains, or functional fragments thereof.

    [0213] The cytoplasmic domains within the cytoplasmic signaling portion of the CARs of the instant disclosure may be linked to each other in a random or specified order. Optionally, a short oligo- or polypeptide linker, for example between 2 and 10 amino acids in length may form the linkage. A glycine-serine doublet provides an example of a suitable linker.

    [0214] In some embodiments, the intracellular domains of CARs of the instant disclosure comprise at least one co-stimulatory domain. In some embodiments, the co-stimulatory domain is isolated or derived from CD28. In some embodiments, the CD28 co-stimulatory domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00022 (SEQ ID NO: 13) RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS.

    [0215] In some embodiments, the CD28 co-stimulatory domain comprises or consists essentially of SEQ ID NO: 13. In some embodiments, the CD28 co-stimulatory domain is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00023 (SEQ ID NO: 14) AGGAGCAAGCGGAGCAGACTGCTGCACAGCGACTACATGAACATGACCC CCCGGAGGCCTGGCCCCACCCGGAAGCACTACCAGCCCTACGCCCCTCC CAGGGATTTCGCCGCCTACCGGAGC.

    [0216] In some embodiments, the CD28 co-stimulatory domain is encoded by SEQ ID NO: 14.

    [0217] In some embodiments, the intracellular domain of the CARs of the instant disclosure comprises an interleukin-2 receptor beta-chain (IL-2Rbeta or IL-2R-beta) cytoplasmic domain. In some embodiments, the IL-2Rbeta domain is truncated. In some embodiments, the IL-2Rbeta cytoplasmic domain comprises one or more STAT5-recruitment motifs. In some embodiments, the CAR comprises one or more STAT5-recruitment motifs outside the IL-2Rbeta cytoplasmic domain.

    [0218] In some embodiments, the IL-2-Rbeta intracellular domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00024 (SEQ ID NO: 15) NCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDVQKWLSSPFPSSSFSP GGLAPEISPLEVLERDKVTQLLPLNTDAYLSLQELQGQDPTHLV.

    [0219] In some embodiments, the IL2R-beta intracellular domain comprises or consists essentially of SEQ ID NO: 15. In some embodiments, the IL-2R-beta intracellular domain is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00025 (SEQ ID NO: 16) 1 AACTGCAGGA ACACCGGGCC ATGGCTGAAG AAGGTCCTGA AGTGTAACAC CCCAGACCCC 61 TCGAAGTTCT TTTCCCAGCT GAGCTCAGAG CATGGAGGCG ACGTCCAGAA GTGGCTCTCT 121 TCGCCCTTCC CCTCATCGTC CTTCAGCCCT GGCGGCCTGG CACCTGAGAT CTCGCCACTA 181 GAAGTGCTGG AGAGGGACAA GGTGACGCAG CTGCTCCCCC TGAACACTGA TGCCTACTTG 241 TCTCTCCAAG AACTCCAGGG TCAGGACCCA ACTCACTTGG TG.

    [0220] In some embodiments, the IL-2R-beta intracellular domain is encoded by SEQ ID NO: 16.

    [0221] In an embodiment, the IL-2R-beta cytoplasmic domain comprises one or more STAT5-recruitment motifs. Exemplary STAT5-recruitment motifs are provided by Passerini et al. (2008) STAT5-signaling cytokines regulate the expression of FOXP3 in CD4+CD25+ regulatory T cells and CD4+CD25+ effector T cells. International Immunology, Vol. 20, No. 3, pp. 421-431, and by Kagoya et al. (2018) A novel chimeric antigen receptor containing a JAK-STAT signaling domain mediates superior antitumor effects. Nature Medicine doi:10.1038/nm.4478.

    [0222] In some embodiments, the STAT5-recruitment motif(s) consists of the sequence Tyr-Leu-Ser-Leu (SEQ ID NO: 17).

    Inhibitory Domains

    [0223] In some embodiments, for example in the second engineered receptors of the disclosure which provide an inhibitory signal, the inhibitory signal is transmitted through the intracellular domain of the receptor. In some embodiments, the engineered receptor comprises an inhibitory intracellular domain. In some embodiments, the second engineered receptor is a CAR comprising an inhibitory intracellular domain (an inhibitory CAR).

    [0224] In some embodiments, the inhibitory intracellular domain comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM). In some embodiments, the inhibitory intracellular domain comprising an ITIM can be isolated or derived from an immune checkpoint inhibitor such as CTLA-4 and PD-1. CTLA-4 and PD-1 are immune inhibitory receptors expressed on the surface of T cells, and play a pivotal role in attenuating or terminating T cell responses.

    [0225] Inhibitory domains can be isolated from human tumor necrosis factor related apoptosis inducing ligand (TRAIL) receptor and CD200 receptor 1.

    [0226] In some embodiments, the inhibitory domain comprises an intracellular domain, a transmembrane or a combination thereof. In some embodiments, the inhibitory domain comprises an intracellular domain, a transmembrane domain, a hinge region or a combination thereof. In some embodiments, the inhibitory domain comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM). In some embodiments, the inhibitory domain comprising an ITIM can be isolated or derived from an immune checkpoint inhibitor such as CTLA-4 and PD-1.

    [0227] Inhibitory domains can be isolated from human tumor necrosis factor related apoptosis inducing ligand (TRAIL) receptor and CD200 receptor 1. In some embodiments, the inhibitory domain is isolated or derived from a human protein, for example a human TRAIL receptor, CTLA-4, or PD-1 protein. In some embodiments, the TRAIL receptor comprises TR10A, TR10B or TR10D.

    [0228] Endogenous TRAIL is expressed as a 281-amino acid type II trans-membrane protein, which is anchored to the plasma membrane and presented on the cell surface. TRAIL is expressed by natural killer cells, which, following the establishment of cell-cell contacts, can induce TRAIL-dependent apoptosis in target cells. Physiologically, the TRAIL-signaling system was shown to be essential for immune surveillance, for shaping the immune system through regulating T-helper cell 1 versus T-helper cell 2 as well as “helpless” CD8+ T-cell numbers, and for the suppression of spontaneous tumor formation.

    [0229] In some embodiments, the inhibitory domain comprises an intracellular domain isolated or derived from a CD200 receptor. The cell surface glycoprotein CD200 receptor 1 (Uniprot ref: Q8TD46) represents another example of an inhibitory intracellular domain of the present invention. This inhibitory receptor for the CD200/OX2 cell surface glycoprotein limits inflammation by inhibiting the expression of proinflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli.

    [0230] In some embodiments, the engineered receptor comprises an inhibitory domain isolated or derived from killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2 (KIR3DL2), killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3 (KIR3DL3), leukocyte immunoglobulin like receptor B1 (LIR1, also called LIR-1 and LILRB1), programmed cell death 1 (PD-1), Fc gamma receptor IIB (FcgRIIB), killer cell lectin like receptor K1 (NKG2D), CTLA-4, a domain containing a synthetic consensus ITIM, a ZAP70 SH2 domain (e.g., one or both of the N and C terminal SH2 domains), or ZAP70 KI_K369A (kinase inactive ZAP70).

    [0231] In some embodiments, the inhibitory domain is isolated or derived from a human protein.

    [0232] In some embodiments, the second, inhibitory receptor comprises a cytoplasmic domain and transmembrane domain isolated or derived from the same protein, for example an ITIM containing protein. In some embodiments, the second, inhibitory receptor comprises a cytoplasmic domain, a transmembrane domain, and an extracellular domain or a portion thereof isolated or derived isolated or derived from the same protein, for example an ITIM containing protein. In some embodiments, the second, inhibitory receptor comprises a hinge region isolated or derived from isolated or derived from the same protein as the intracellular domain and/or transmembrane domain, for example an ITIM containing protein.

    [0233] In some embodiments, the second, inhibitory engineered receptor comprises an inhibitory domain. In some embodiments, the second, inhibitory engineered receptor comprises an inhibitory intracellular domain and/or an inhibitory transmembrane domain. In some embodiments, the second engineered receptor is a CAR comprising an inhibitory domain (an inhibitory CAR). In some embodiments, the inhibitory intracellular domain is fused to the intracellular domain of a CAR. In some embodiments, the inhibitory intracellular domain is fused to the transmembrane domain of a CAR.

    T Cell Receptors (TCRs)

    [0234] In some embodiments, the first or second engineered receptor is a T Cell Receptor (TCR). In some embodiments, the first and second engineered receptors are T Cell Receptors (TCR).

    [0235] As used herein, a “TCR”, sometimes also called a “TCR complex” or “TCR/CD3 complex” refers to a protein complex comprising a TCR alpha chain, a TCR beta chain, and one or more of the invariant CD3 chains (zeta, gamma, delta and epsilon), sometimes referred to as subunits. The TCR alpha and beta chains can be disulfide-linked to function as a heterodimer to bind to peptide-MHC complexes. Once the TCR alpha/beta heterodimer engages peptide-MHC, conformational changes in the TCR complex in the associated invariant CD3 subunits are induced, which leads to their phosphorylation and association with downstream proteins, thereby transducing a primary stimulatory signal. In an exemplary TCR complex, the TCR alpha and TCR beta polypeptides form a heterodimer, CD3 epsilon and CD3 delta form a heterodimer, CD3 epsilon and CD3 gamma for a heterodimer, and two CD3 zeta form a homodimer.

    Extracellular Domains

    [0236] The disclosure provides a first engineered receptor comprising a first extracellular ligand binding domain and a second engineered receptor comprising a second extracellular ligand binding domain. Either the first engineered receptor, the second engineered receptor, or both, may be a TCR. Any suitable ligand binding domain may be fused to an extracellular domain, hinge domain or transmembrane of the engineered TCRs described herein.

    [0237] In some embodiments, the first and/or second ligand binding domain is fused to an extracellular domain of a TCR subunit. The TCR subunit can be TCR alpha, TCR beta, CD3 delta, CD3 epsilon or CD3 gamma. In some embodiments, both the first and second ligand binding domains are fused to the same TCR subunit in different TCR receptors. In some embodiments, the first and second ligand binding domains are fused to different TCR subunits in different TCR receptors. In some embodiments, the first, activator ligand binding domain is fused to a first TCR subunit in a first engineered receptor and the second, inhibitor ligand binding domain is fused to a second TCR subunit in a second engineered receptor. In some embodiments, the first and second TCR subunits are not the same subunit. In some embodiments, the first and second TCR subunits are the same subunit. For example, the first ligand binding domain can be fused to TCR alpha, and the second ligand binding domain can be fused to TCR beta. As a further example, the first ligand binding is fused to TCR beta and the second ligand binding domain used fused to TCR alpha.

    [0238] In some embodiments, the first, activator LBD comprises an scFv domain and the second, inhibitor LBD comprises a Vβ-only domain. In some embodiments, the first, activator LBD comprises a Vβ-only domain and the second, inhibitor LBD comprises an scFv domain. In some embodiments, both the first, activator LBD and the second, inhibitor LBD are scFv domains. In some embodiments, both the first, activator LBD and the second, inhibitor LBD are Vβ-only domains.

    [0239] In some embodiments, the first engineered TCR of the disclosure comprises an extracellular domain comprising a Vβ-only domain, a transmembrane domain and an intracellular domain. In some embodiments, the intracellular domain comprises one or more exogenous domains.

    [0240] In some embodiments, the first engineered TCR of the disclosure comprises an extracellular domain comprising an scFv domain, a transmembrane domain and an intracellular domain. In some embodiments, the intracellular domain comprises one or more exogenous domains.

    [0241] In some embodiments, the second engineered TCR of the disclosure comprises an extracellular domain comprising a Vβ-only domain, a transmembrane domain and an inhibitory intracellular domain.

    [0242] In some embodiments, the second engineered TCR of the disclosure comprises an extracellular domain comprising an scFv domain, a transmembrane domain and an inhibitory intracellular domain.

    [0243] TCR subunits include TCR alpha, TCR beta, CD3 zeta, CD3 delta, CD3 gamma and CD3 epsilon. Any one or more of TCR alpha, TCR beta chain, CD3 gamma, CD3 delta or CD3 epsilon, or fragments or derivative thereof, can be fused to one or more domains capable of providing a stimulatory signal of the disclosure, thereby enhancing TCR function and activity. Any one or more of TCR alpha, TCR beta chain, CD3 gamma, CD3 delta or CD3 epsilon, or fragments or derivative thereof, can be fused to an inhibitory intracellular domain of the disclosure.

    [0244] In some embodiments, for example those embodiments wherein the first engineered receptor or second engineered receptor comprises a first and a second polypeptide, the antigen binding domain is isolated or derived from a T cell receptor (TCR) extracellular domain or an antibody.

    [0245] In some embodiments, the first engineered receptor and second engineered receptor comprise a first antigen binding domain and a second antigen binding domain. The antigen-binding domain or domains of the engineered receptor may be provided on the same or a different polypeptide as the intracellular domain.

    [0246] In some embodiments, the antigen-binding domain of the first and/or second engineered receptor comprises a single chain variable fragment (scFv).

    [0247] In some embodiments, the first and/or second engineered receptor comprises a second polypeptide. The disclosure provides receptors having two polypeptides each having a part of a ligand-binding domain (e.g. cognates of a heterodimeric LDB, such as a TCRα/β- or Fab-based LBD). The disclosure further provides receptors having two polypeptides, each having a part of a ligand-binding domain (e.g. cognates of a heterodimeric LDB, such as a TCRα/β- or Fab-based LBD) and one part of the ligand binding domain is fused to a hinge or transmembrane domain, while the other part of the ligand binding domain has no intracellular domain. Further variations include receptors where each polypeptide has a hinge domain, and where each polypeptide has a hinge and transmembrane domain. In some embodiments, the hinge domain is absent. In other embodiments, the hinge domain is a membrane proximal extracellular region (MPER), such as the LILRB1 D3D4 domain.

    [0248] In some embodiments, for example those embodiments where the first and/or second engineered receptor comprises at least two polypeptides, the first polypeptide comprises a first chain of an antibody and the second polypeptide comprise a second chain of said antibody.

    [0249] In some embodiments, the receptor comprises a Fab fragment of an antibody. In embodiments, a first polypeptide comprises an antigen-binding fragment of the heavy chain of the antibody and an intracellular domain, and a second polypeptide comprises an antigen-binding fragment of the light chain of the antibody. In some embodiments, the first polypeptide comprises an antigen-binding fragment of the light chain of the antibody and the intracellular domain, and the second polypeptide comprises an antigen-binding fragment of the heavy chain of the antibody.

    [0250] In some embodiments, the first and/or second engineered receptor comprises an extracellular fragment of a T cell receptor (TCR). In some embodiments, a first polypeptide comprises an antigen-binding fragment of the alpha chain of the TCR and the intracellular domain, and a second polypeptide comprises an antigen-binding fragment of the beta chain of the TCR. In some embodiments, a first polypeptide comprises an antigen-binding fragment of the beta chain of the TCR and the intracellular domain, and the second polypeptide comprises an antigen-binding fragment of the alpha chain of the TCR.

    Transmembrane Domains

    [0251] The disclosure provide a first fusion protein comprising a first, activator LBD and a second fusion protein comprising a second, inhibitor LBD and an inhibitor intracellular domain. In some embodiments, the first and second fusion proteins comprise transmembrane domains.

    [0252] The disclosure provides polypeptides comprising a transmembrane domain, and an intracellular domain capable of providing a stimulatory signal or an inhibitory signal. In some embodiments, the engineered TCR comprises multiple intracellular domains capable of providing a stimulatory signal.

    [0253] A “transmembrane domain”, as used herein, refers to a domain of a protein that spans membrane of the cell. Transmembrane domains typically consist predominantly of non-polar amino acids, and may traverse the lipid bilayer once or several times. Transmembrane domains usually comprise alpha helices, a configuration which maximizes internal hydrogen bonding.

    [0254] Transmembrane domains isolated or derived from any source are envisaged as within the scope of the fusion proteins of the disclosure.

    [0255] In some embodiments, the transmembrane domain is one that is associated with one of the other domains of the fusion protein, or isolated or derived from the same protein as one of the other domains of the fusion protein. In some embodiments, the transmembrane domain and the second intracellular domain are from the same protein, for example a TCR complex subunit such as TCR alpha, TCR beta, CD3 delta, CD3 epsilon or CD3 gamma. In some embodiments, the extracellular domain (svd-TCR), the transmembrane domain and the second intracellular domain are from the same protein, for example a TCR complex subunit such as TCR alpha, TCR beta, CD3 delta, CD3 epsilon or CD3 gamma. In other embodiments, the extracellular domain (comprising one or more ligand binding domains, such as Vo-only domain and scFv domains), the transmembrane domain and the intracellular domain(s) are from different proteins. For example, in some embodiments the engineered svd-TCR comprises a CD28 transmembrane domain with a CD28, 4-1BB and CD3ζ intracellular domain.

    [0256] The transmembrane domain may be derived either from a natural or from a recombinant source. Where the source is natural, the domain may be derived from any membrane-bound or transmembrane protein.

    [0257] In some embodiments, the transmembrane domain is capable of signaling to the intracellular domain(s) whenever the TCR complex has bound to a target. A transmembrane domain of particular use in this invention may include at least the transmembrane region(s) of e.g., the alpha, beta or zeta chain of the TCR, CD3 delta, CD3 epsilon or CD3 gamma, CD28, CD3 epsilon, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.

    [0258] In some embodiments, the transmembrane domain can be attached to the extracellular region of the fusion protein, e.g., the antigen binding domain of the TCR alpha or beta chain, via a hinge, e.g., a hinge from a human protein. For example, in one embodiment, the hinge can be a human immunoglobulin (Ig) hinge, e.g., an IgG4 hinge, or a CD8α hinge.

    [0259] In some embodiments, the hinge is isolated or derived from CD8α or CD28. In some embodiments, the CD8α hinge comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 1). In some embodiments, the CD8α hinge comprises SEQ ID NO: 1. In some embodiments, the CD8α hinge consists essentially of SEQ ID NO: 1. In some embodiments, the CD8α hinge is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of:

    TABLE-US-00026 (SEQ ID NO: 2) ACCACGACGCCAGCGCCGCGACCACCAACACCGGCGCCCACCATCGCGTC GCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGGGCG CAGTGCACACGAGGGGGCTGGACTTCGCCTGTGAT.

    [0260] In some embodiments, the CD8α hinge is encoded by SEQ ID NO: 2.

    [0261] In some embodiments, the CD28 hinge comprises an amino acid sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of CTIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 3. In some embodiments, the CD28 hinge comprises or consists essentially of SEQ ID NO: 3. In some embodiments, the CD28 hinge is encoded by a nucleotide sequence having at least 80% identity, at least 90% identity, at least 95% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00027 (SEQ ID NO: 4) TGTACCATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAG CAATGGAACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCC TATTTCCCGGACCTTCTAAGCCC.

    [0262] In some embodiments, the CD28 hinge is encoded by SEQ ID NO: 4.

    [0263] In some embodiments, the transmembrane domain comprises a TCR alpha transmembrane domain. In some embodiments, the TCR alpha transmembrane domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of: VIGFRILLLKVAGFNLLMTLRLW (SEQ ID NO: 26). In some embodiments, the TCR alpha transmembrane domain comprises, or consists essentially of, SEQ ID NO: 26. In some embodiments, the TCR alpha transmembrane domain is encoded by a sequence of

    TABLE-US-00028 (SEQ ID NO: 27) GTGATTGGGTTCCGAATCCTCCTCCTGAAAGTGGCCGGGTTTAATCTGCT CATGACGCTGCGGCTGTGG.

    [0264] In some embodiments, the transmembrane domain comprises a TCR beta transmembrane domain. In some embodiments, the TCR beta transmembrane domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of: TILYEILLGKATLYAVLVSALVL (SEQ ID NO: 28). In some embodiments, the TCR beta transmembrane domain comprises, or consists essentially of, SEQ ID NO: 28. In some embodiments, the TCR beta transmembrane domain is encoded by a sequence of

    TABLE-US-00029 (SEQ ID NO: 20) ACCATCCTCTATGAGATCTTGCTAGGGAAGGCCACCTTGTATGCCGTGCT GGTCAGTGCCCTCGTGCTG.

    [0265] In some embodiments, the transmembrane comprises a CD3 zeta transmembrane domain. In some embodiments, the CD3 zeta transmembrane domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of: LCYLLDGILFIYGVILTALFL (SEQ ID NO: 29). In some embodiments, the CD3 zeta transmembrane domain comprises, or consists essentially of, SEQ ID NO: 29.

    [0266] A transmembrane domain can include one or more additional amino acids adjacent to the transmembrane region, e.g., one or more amino acid associated with the extracellular region of the protein from which the transmembrane was derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 15 amino acids of the extracellular region) and/or one or more additional amino acids associated with the intracellular region of the protein from which the transmembrane protein is derived (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or up to 15 amino acids of the intracellular region).

    [0267] In some embodiments, the transmembrane domain can be selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins, e.g., to minimize interactions with other members of the receptor complex.

    [0268] When present, the transmembrane domain may be a natural TCR transmembrane domain, a natural transmembrane domain from a heterologous membrane protein, or an artificial transmembrane domain. The transmembrane domain may be a membrane anchor domain. Without limitation, a natural or artificial transmembrane domain may comprise a hydrophobic a-helix of about 20 amino acids, often with positive charges flanking the transmembrane segment. The transmembrane domain may have one transmembrane segment or more than one transmembrane segment. Prediction of transmembrane domains/segments may be made using publicly available prediction tools (e.g. TMHMM, Krogh et al. Journal of Molecular Biology 2001; 305(3):567-580; or TMpred, Hofmann & Stoffel Biol. Chem. Hoppe-Seyler 1993; 347: 166). Non-limiting examples of membrane anchor systems include platelet derived growth factor receptor (PDGFR) transmembrane domain, glycosylphosphatidylinositol (GPI) anchor (added post-translationally to a signal sequence) and the like.

    Intracellular Domain

    [0269] The disclosure provides fusion proteins comprising an intracellular domain. An “intracellular domain,” as the term is used herein, refers to an intracellular portion of a protein.

    [0270] In some embodiments, the intracellular domain comprises one or more domains capable of providing a stimulatory signal to a transmembrane domain. In some embodiments, the intracellular domain comprises a first intracellular domain capable of providing a stimulatory signal and a second intracellular domain capable of providing a stimulatory signal. In other embodiments, the intracellular domain comprises a first, second and third intracellular domain capable of providing a stimulatory signal. The intracellular domains capable of providing a stimulatory signal are selected from the group consisting of a CD28 molecule (CD28) domain, a LCK proto-oncogene, Src family tyrosine kinase (Lck) domain, a TNF receptor superfamily member 9 (4-1BB) domain, a TNF receptor superfamily member 18 (GITR) domain, a CD4 molecule (CD4) domain, a CD8a molecule (CD8a) domain, a FYN proto-oncogene, Src family tyrosine kinase (Fyn) domain, a zeta chain of T cell receptor associated protein kinase 70 (ZAP70) domain, a linker for activation of T cells (LAT) domain, lymphocyte cytosolic protein 2 (SLP76) domain, (TCR) alpha, TCR beta, CD3 delta, CD3 gamma and CD3 epsilon intracellular domains.

    [0271] In some embodiments, an intracellular domain comprises at least one intracellular signaling domain. An intracellular signaling domain generates a signal that promotes a function a cell, for example an immune effector function of a TCR containing cell, e.g., a TCR-expressing T-cell. In some embodiments, the intracellular domain of the fusion proteins of the disclosure includes at least one intracellular signaling domain. For example, the intracellular domains of CD3 gamma, delta or epsilon comprise signaling domains.

    [0272] In some embodiments, the extracellular domain, transmembrane domain and intracellular domain are isolated or derived from the same protein, for example T-cell receptor (TCR) alpha, TCR beta, CD3 delta, CD3 gamma or CD3 epsilon.

    [0273] Examples of intracellular domains for use in the fusion proteins of the disclosure include the cytoplasmic sequences of the TCR alpha, TCR beta, CD3 zeta, and 4-1BB, and the intracellular signaling co-receptors that act in concert to initiate signal transduction following antigen receptor engagement, as well as any derivative or variant of these sequences and any recombinant sequence that has the same functional capability.

    [0274] In some embodiments, the intracellular signaling domain comprises a primary intracellular signaling domain. Exemplary primary intracellular signaling domains include those derived from the proteins responsible for primary stimulation, or antigen dependent stimulation.

    [0275] An intracellular signaling domain is generally responsible for activation of at least one of the normal effector functions of the immune cell in which the fusion protein has been introduced. The term “effector function” refers to a specialized function of a cell. Effector function of a T-cell, for example, may be cytolytic activity or helper activity including the secretion of cytokines. Thus the term “intracellular signaling domain” refers to the portion of a protein which transduces the effector function signal and directs the cell to perform a specialized function.

    [0276] While in some cases the entire intracellular signaling domain can be employed, in many cases it is not necessary to use the entire intracellular signaling domain. To the extent that a truncated portion of the intracellular signaling domain is used, such truncated portion may be used in place of the intact chain as long as it transduces the effector function signal. The term intracellular signaling domain is thus meant to include any truncated portion of the intracellular signaling domain sufficient to transduce the effector function signal.

    [0277] In some embodiments, the intracellular domain comprises a CD3 delta intracellular domain. In some embodiments, the CD3 delta intracellular domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00030 (SEQ ID NO: 30) GHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNKGGSRS KRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS.

    [0278] In some embodiments, the CD3 delta intracellular domain comprises or consists essentially of, SEQ ID NO: 30. In some embodiments, the CD3 delta intracellular domain is encoded by a sequence of

    TABLE-US-00031 (SEQ ID NO: 31) 1 GGACATGAGA CTGGAAGGCT GTCTGGGGCT GCCGACACAC AAGCTCTGTT GAGGAATGAC 61 CAGGTCTATC AGCCCCTCCG AGATCGAGAT GATGCTCAGT ACAGCCACCT TGGAGGAAAC 121 TGGGCTCGGA ACAAGGGCGG AAGCAGGAGC AAGCGGAGCA GACTGCTGCA CAGCGACTAC 181 ATGAACATGA CCCCCCGGAG GCCTGGCCCC ACCCGGAAGC ACTACCAGCC CTACGCCCCT 241 CCCAGGGATT TCGCCGCCTA CCGGAGCTA.

    [0279] In some embodiments, the intracellular domain comprises a CD3 epsilon intracellular domain. In some embodiments, the CD3 epsilon intracellular domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of: KNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRIGGS RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 32). In some embodiments, the CD3 epsilon intracellular domain comprises or consists essentially of, SEQ ID NO: 32. In some embodiments, the CD3 epsilon intracellular domain is encoded by a sequence of

    TABLE-US-00032 (SEQ ID NO: 19) 1 AAGAATAGAA AGGCCAAGGC CAAGCCTGTG ACACGAGGAG CGGGTGCTGG CGGCAGGCAA 61 AGGGGACAAA ACAAGGAGAG GCCACCACCT GTTCCCAACC CAGACTATGA GCCCATCCGG 121 AAAGGCCAGC GGGACCTGTA TTCTGGCCTG AATCAGCGCA GAATCGGCGG AAGCAGGAGC 181 AAGCGGAGCA GACTGCTGCA CAGCGACTAC ATGAACATGA CCCCCCGGAG GCCTGGCCCC 241 ACCCGGAAGC ACTACCAGCC CTACGCCCCT CCCAGGGATT TCGCCGCCTA CCGGAGCTAG.

    [0280] In some embodiments, the intracellular domain comprises a CD3 gamma intracellular domain. In some embodiments, the CD3 gamma intracellular domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of

    TABLE-US-00033 (SEQ ID NO: 33) GQDGVRQSRASDKQTLLPNDQLYQPLKDREDDQYSHLQGNQLRRNGGSRS KRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS.

    [0281] In some embodiments, the CD3 gamma intracellular domain comprises, or consists essentially of, SEQ ID NO: 33. In some embodiments, the CD3 gamma intracellular domain is encoded by a sequence of

    TABLE-US-00034 (SEQ ID NO: 22) 1 GGACAGGATG GAGTTCGCCA GTCGAGAGCT TCAGACAAGC AGACTCTGTT GCCCAATGAC 61 CAGCTCTACC AGCCCCTCAA GGATCGAGAA GATGACCAGT ACAGCCACCT TCAAGGAAAC 121 CAGTTGAGGA GGAATGGCGG AAGCAGGAGC AAGCGGAGCA GACTGCTGCA CAGCGACTAC 181 ATGAACATGA CCCCCCGGAG GCCTGGCCCC ACCCGGAAGC ACTACCAGCC CTACGCCCCT 241 CCCAGGGATT TCGCCGCCTA CCGGAGCTAG.

    [0282] In some embodiments, the intracellular domain comprises a CD3 zeta intracellular domain. In some embodiments, the CD3 zeta intracellular domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 9) or a subsequence thereof.

    [0283] In some embodiments, the CD3 zeta intracellular domain comprises, or consists essentially of, SEQ ID NO: 9.

    [0284] In some embodiments, the intracellular domain comprises a TCR alpha intracellular domain. In some embodiments, a TCR alpha intracellular domain comprises Ser-Ser. In some embodiments, a TCR alpha intracellular domain is encoded by a sequence of TCCAGC.

    [0285] In some embodiments, the intracellular domain comprises a TCR beta intracellular domain. In some embodiments, the TCR beta intracellular domain comprises an amino acid sequence having at least 80% identity, at least 90% identity, or is identical to a sequence of: MAMVKRKDSR (SEQ ID NO: 35). In some embodiments, the TCR beta intracellular domain comprises, or consists essentially of SEQ ID NO: 35. In some embodiments, the TCR beta intracellular domain is encoded by a sequence of

    TABLE-US-00035 (SEQ ID NO: 36) ATGGCCATGGTCAAGAGAAAGGATTCCAGA.

    [0286] In some embodiments, the intracellular signaling domain comprises at least one stimulatory intracellular domain. In some embodiments, the intracellular signaling domain comprises a primary intracellular signaling domain, such as a CD3 delta, CD3 gamma and CD3 epsilon intracellular domain, and one additional stimulatory intracellular domain, for example a co-stimulatory domain. In some embodiments, the intracellular signaling domain comprises a primary intracellular signaling domain, such as a CD3 delta, CD3 gamma and CD3 epsilon intracellular domain, and two additional stimulatory intracellular domains.

    [0287] Exemplary co-stimulatory intracellular signaling domains include those derived from proteins responsible for co-stimulatory signals, or antigen independent stimulation.

    [0288] The term “co-stimulatory molecule” refers to the cognate binding partner on a T-cell that specifically binds with a co-stimulatory ligand, thereby mediating a co-stimulatory response by the T-cell, such as, but not limited to, proliferation. Co-stimulatory molecules are cell surface molecules other than antigen receptors. Co-stimulatory molecules and their ligands are required for an efficient immune response. Co-stimulatory molecules include, but are not limited to an MHC class I molecule, BTLA, a Toll ligand receptor, as well as DAP10, DAP12, CD30, LIGHT, OX40, CD2, CD27, CDS, ICAM-1, LFA-1 (CD11a/CD18) 4-1BB (CD137, TNF receptor superfamily member 9), and CD28 molecule (CD28).

    [0289] A “co-stimulatory domain”, sometimes referred to as “a co-stimulatory intracellular signaling domain” can be the intracellular portion of a co-stimulatory protein. A co-stimulatory domain can be a domain of a co-stimulatory protein that transduces the co-stimulatory signal. A co-stimulatory protein can be represented in the following protein families: TNF receptor proteins, Immunoglobulin-like proteins, cytokine receptors, integrins, signaling lymphocytic activation molecules (SLAM proteins), and activating NK cell receptors. Examples of such molecules include CD27, CD28, 4-1BB (CD137), OX40, GITR, CD30, CD40, ICOS, BAFFR, HVEM, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, a ligand that specifically binds with CD83, CD4, and the like. The co-stimulatory domain can comprise the entire intracellular portion, or the entire native intracellular signaling domain, of the molecule from which it is derived, or a functional fragment thereof.

    [0290] In some embodiments, the stimulatory domain comprises a co-stimulatory domain. In some embodiments, the co-stimulatory domain comprises a CD28 or 4-1BB co-stimulatory domain. CD28 and 4-1BB are well characterized co-stimulatory molecules required for full T cell activation and known to enhance T cell effector function. For example, CD28 and 4-1BB have been utilized in chimeric antigen receptors (CARs) to boost cytokine release, cytolytic function, and persistence over the first-generation CAR containing only the CD3 zeta signaling domain. Likewise, inclusion of co-stimulatory domains, for example CD28 and 4-1BB domains, in engineered TCR can increase T cell effector function and specifically allow co-stimulation in the absence of co-stimulatory ligand, which is typically down-regulated on the surface of tumor cells.

    [0291] In some embodiments, the stimulatory domain comprises a CD28 intracellular domain. In some embodiments, the CD28 intracellular domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of: RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 37). In some embodiments, the CD28 intracellular domain comprises, or consists essentially of, RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 37). In some embodiments, a CD28 intracellular domain is encoded by a nucleotide sequence comprising:

    TABLE-US-00036 (SEQ ID NO: 38) AGGAGCAAGCGGAGCAGACTGCTGCACAGCGACTACATGAACATGACCCC CCGGAGGCCTGGCCCCACCCGGAAGCACTACCAGCCCTACGCCCCTCCCA GGGATTTCGCCGCCTACCGGAGC.

    [0292] In some embodiments, the stimulatory domain comprises a 4-1BB intracellular domain. In some embodiments, the 4-1BB intracellular domain comprises an amino acid sequence having at least 85% identity, at least 90% identity, at least 95% identity, at least 96% identity, at least 97% identity, at least 98% identity, at least 99% identity or is identical to a sequence of: KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 39). In some embodiments, the 4-1BB intracellular domain comprises, or consists essentially of, KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 39). In some embodiments, a 4-1BB intracellular domain is encoded by a nucleotide sequence comprising:

    TABLE-US-00037 (SEQ ID NO: 40) AAACGGGGCAGAAAGAAACTCCTGTATATATTCAAACAACCATTTATGAG GCCAGTACAAACTACTCAAGAGGAAGATGGCTGTAGCTGCCGATTTCCAG AAGAAGAAGAAGGAGGATGTGAACTG.

    [0293] In some embodiments, the intracellular domain of the activator receptor comprise a CD28 co-stimulatory domain, a 4-1BB co-stimulatory domain and a CD3 zeta cytoplasmic domain. In some embodiments, the intracellular domain comprises: RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSKRGRKKLLYIFKQPFMRP VQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYKQGQNQLYNELNLGRREEYDV LDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLY QGLSTATKDTYDALHMQALPPR (SEQ ID NO: 8918), or a sequence having at least 80% identity, at least 90% identity, at least 95% identity, or at least 99% identity thereto.

    Inhibitory Domains

    [0294] The disclosure provides inhibitory intracellular domains which can be fused to the transmembrane or intracellular domain of any of the TCR subunits to generate an inhibitory TCR. In those embodiments where the inhibitory receptor is an inhibitory CAR, the same intracellular domains described below to generate an inhibitory TCR can also be used to generate an inhibitory CAR.

    [0295] In some embodiments, the inhibitory intracellular domain comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM). In some embodiments, the inhibitory intracellular domain comprising an ITIM can be isolated or derived from an immune checkpoint inhibitor such as CTLA-4 and PD-1. CTLA-4 and PD-1 are immune inhibitory receptors expressed on the surface of T cells, and play a pivotal role in attenuating or terminating T cell responses.

    [0296] Inhibitory domains can be isolated from human tumor necrosis factor related apoptosis inducing ligand (TRAIL) receptor and CD200 receptor 1.

    [0297] In some embodiments, the inhibitory domain comprises an intracellular domain, a transmembrane or a combination thereof. In some embodiments, the inhibitory domain comprises an intracellular domain, a transmembrane domain, a hinge region or a combination thereof. In some embodiments, the inhibitory domain comprises an immunoreceptor tyrosine-based inhibitory motif (ITIM). In some embodiments, the inhibitory domain comprising an ITIM can be isolated or derived from an immune checkpoint inhibitor such as CTLA-4 and PD-1.

    [0298] Inhibitory domains can be isolated from human tumor necrosis factor related apoptosis inducing ligand (TRAIL) receptor and CD200 receptor 1. In some embodiments, the inhibitory domain is isolated or derived from a human protein, for example a human TRAIL receptor, CTLA-4, or PD-1 protein. In some embodiments, the TRAIL receptor comprises TR10A, TR10B or TR10D.

    [0299] Endogenous TRAIL is expressed as a 281-amino acid type II trans-membrane protein, which is anchored to the plasma membrane and presented on the cell surface. TRAIL is expressed by natural killer cells, which, following the establishment of cell-cell contacts, can induce TRAIL-dependent apoptosis in target cells. Physiologically, the TRAIL-signaling system was shown to be essential for immune surveillance, for shaping the immune system through regulating T-helper cell 1 versus T-helper cell 2 as well as “helpless” CD8+ T-cell numbers, and for the suppression of spontaneous tumor formation.

    [0300] In some embodiments, the inhibitory domain comprises an intracellular domain isolated or derived from a CD200 receptor. The cell surface glycoprotein CD200 receptor 1 (Uniprot ref: Q8TD46) represents another example of an inhibitory intracellular domain of the present invention. This inhibitory receptor for the CD200/OX2 cell surface glycoprotein limits inflammation by inhibiting the expression of proinflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli.

    [0301] In some embodiments, the engineered receptor comprises an inhibitory domain isolated or derived from killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 2 (KIR3DL2), killer cell immunoglobulin like receptor, three Ig domains and long cytoplasmic tail 3 (KIR3DL3), leukocyte immunoglobulin like receptor B1 (LIR1), programmed cell death 1 (PD-1), Fc gamma receptor IIB (FcgRIIB), killer cell lectin like receptor K1 (NKG2D), CTLA-4, a domain containing a synthetic consensus ITIM, a ZAP70 SH2 domain (e.g., one or both of the N and C terminal SH2 domains), or ZAP70 KI_K369A(kinase inactive ZAP70).

    [0302] In some embodiments, the inhibitory domain is isolated or derived from a human protein.

    [0303] In some embodiments, the second, inhibitory receptor comprises a cytoplasmic domain and transmembrane domain isolated or derived from the same protein, for example an ITIM containing protein. In some embodiments, the second, inhibitory receptor comprises a cytoplasmic domain, a transmembrane domain, and an extracellular domain or a portion thereof isolated or derived isolated or derived from the same protein, for example an ITIM containing protein. In some embodiments, the second, inhibitory receptor comprises a hinge region isolated or derived from isolated or derived from the same protein as the intracellular domain and/or transmembrane domain, for example an ITIM containing protein.

    [0304] In some embodiments, the second engineered receptor is a TCR comprising an inhibitory domain (an inhibitory TCR). In some embodiments, the inhibitory TCR comprises an inhibitory intracellular domain and/or an inhibitory transmembrane domain. In some embodiments, the inhibitory intracellular domain is fused to the intracellular domain of TCR alpha, TCR beta, CD3 delta, CD3 gamma or CD3 epsilon or a portion thereof a TCR. In some embodiments, the inhibitory intracellular domain is fused to the transmembrane domain of TCR alpha, TCR beta, CD3 delta, CD3 gamma or CD3 epsilon.

    [0305] In some embodiments, the second engineered receptor is a TCR comprising an inhibitory domain (an inhibitory TCR). In some embodiments, the inhibitory domain is isolated or derived from LILRB1.

    LILRB1 Inhibitory Receptors

    [0306] The disclosure provides a second, inhibitory receptor comprising a LILRB1 inhibitory domain, and optionally, a LILRB1 transmembrane and/or hinge domain, or functional variants thereof. The second, inhibitory receptor can be a CAR or TCR. The inclusion of the LILRB1 transmembrane domain and/or the LILRB1 hinge domain in the inhibitory receptor may increase the inhibitory signal generated by the inhibitory receptor compared to a reference inhibitory receptor having another transmembrane domain or another hinge domains. The second, inhibitory receptor comprising the LILRB1 inhibitory domain may be a CAR or TCR, as described herein. Any suitable ligand binding domain, as described herein, may be fused to the LILRB1-based second, inhibitory receptors.

    [0307] Leukocyte immunoglobulin-like receptor subfamily B member 1 (LILRB1), also known as Leukocyte immunoglobulin-like receptor B1, as well as ILT2, LIR1, MIR7, PIRB, CD85J, ILT-2 LIR-1, MIR-7 and PIR-B, is a member of the leukocyte immunoglobulin-like receptor (LIR) family. The LILRB1 protein belongs to the subfamily B class of LIR receptors. These receptors contain two to four extracellular immunoglobulin domains, a transmembrane domain, and two to four cytoplasmic immunoreceptor tyrosine-based inhibitory motifs (ITIMs). The LILRB1 receptor is expressed on immune cells, where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. LILRB1 is thought to regulate inflammatory responses, as well as cytotoxicity, and to play a role in limiting auto-reactivity. Multiple transcript variants encoding different isoforms of LILRB1 exist, all of which are contemplated as within the scope of the instant disclosure.

    [0308] In some embodiments of the inhibitory receptors described herein, the inhibitory receptor comprises one or more domains isolated or derived from LILRB1. In some embodiments of the receptors having one or more domains isolated or derived from LILRB1, the one or more domains of LILRB1 comprise an amino acid sequence that is at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or is identical to a sequence or subsequence of SEQ ID NO: 65. In some embodiments, the one or more domains of LILRB1 comprise an amino acid sequence that is identical to a sequence or subsequence of SEQ ID NO: 65. In some embodiments, the one or more domains of LILRB1 consist of an amino acid sequence that is at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or is identical to a sequence or subsequence of SEQ ID NO: 65. In some embodiments, the one or more domains of LILRB1 consist of an amino acid sequence that is identical to a sequence or subsequence of SEQ ID NO: 65.

    [0309] In some embodiments of the receptors having one or more domains isolated or derived from LILRB1, the one or more domains of LILRB1 are encoded by a polynucleotide sequence that is at least 80%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or is identical to a sequence or subsequence of SEQ ID NO: 66.

    [0310] In some embodiments of the receptors having one or more domains of LILRB1, the one or more domains of LILRB1 are encoded by a polynucleotide sequence that is identical to a sequence or subsequence of SEQ ID NO: 66.

    [0311] In various embodiments, an inhibitory receptor is provided, comprising a polypeptide, wherein the polypeptide comprises one or more of: an LILRB1 hinge domain or functional fragment or variant thereof; an LILRB1 transmembrane domain or a functional variant thereof; and an LILRB1 intracellular domain or an intracellular domain comprising at least one, or at least two immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0312] As used herein an “immunoreceptor tyrosine-based inhibitory motif” or “ITIM” refers to a conserved sequence of amino acids with a consensus sequence of S/I/V/LxYxxI/V/L (SEQ ID NO: 274), or the like, that is found in the cytoplasmic tails of many inhibitory receptors of the immune system. After ITIM-possessing inhibitory receptors interact with their ligand, the ITIM motif is phosphorylated, allowing the inhibitory receptor to recruit other enzymes, such as the phosphotyrosine phosphatases SHP-1 and SHP-2, or the inositol-phosphatase called SHIP.

    [0313] In some embodiments, the polypeptide comprises an intracellular domain comprising at least one immunoreceptor tyrosine-based inhibitory motif (ITIM), at least two ITIMs, at least 3 ITIMs, at least 4 ITIMs, at least 5 ITIMs or at least 6 ITIMs. In some embodiments, the intracellular domain has 1, 2, 3, 4, 5, or 6 ITIMs.

    [0314] In some embodiments, the polypeptide comprises an intracellular domain comprising at least one ITIM selected from the group of ITIMs consisting of NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0315] In further particular embodiments, the polypeptide comprises an intracellular domain comprising at least two immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0316] In some embodiments, the intracellular domain comprises both ITIMs NLYAAV (SEQ ID NO: 67) and VTYAEV (SEQ ID NO: 68). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 71. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 71.

    [0317] In some embodiments, the intracellular domain comprises both ITIMs VTYAEV (SEQ ID NO: 68) and VTYAQL (SEQ ID NO: 69). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 72. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 72.

    [0318] In some embodiments, the intracellular domain comprises both ITIMs VTYAQL (SEQ ID NO: 69) and SIYATL (SEQ ID NO: 70). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 73. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 73.

    [0319] In some embodiments, the intracellular domain comprises the ITIMs NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), and VTYAQL (SEQ ID NO: 69). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 74. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 74.

    [0320] In some embodiments, the intracellular domain comprises the ITIMs VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70). In some embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 75. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 75.

    [0321] In some embodiments, the intracellular domain comprises the ITIMs NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70). In embodiments, the intracellular domain comprises a sequence at least 95% identical to SEQ ID NO: 76. In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to SEQ ID NO: 76.

    [0322] In some embodiments, the intracellular domain comprises a sequence at least 95% identical to the LILRB1 intracellular domain (SEQ ID NO: 81). In some embodiments, the intracellular domain comprises or consists essentially of a sequence identical to the LILRB1 intracellular domain (SEQ ID NO: 81).

    [0323] LILRB1 intracellular domains or functional variants thereof of the disclosure can have at least 1, at least 2, at least 4, at least 4, at least 5, at least 6, at least 7, or at least 8 ITIMs. In some embodiments, the LILRB1 intracellular domain or functional variant thereof has 2, 3, 4, 5, or 6 ITIMs.

    [0324] In particular embodiments, the intracellular domain comprises two, three, four, five, or six immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0325] In particular embodiments, the intracellular domain comprises at least three immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0326] In particular embodiments, the intracellular domain comprises three immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0327] In particular embodiments, the intracellular domain comprises four immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0328] In particular embodiments, the intracellular domain comprises five immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0329] In particular embodiments, the intracellular domain comprises six immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0330] In particular embodiments, the intracellular domain comprises at least seven immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0331] The LILRB1 protein has four immunoglobulin (Ig) like domains termed D1, D2, D3 and D4. In some embodiments, the LILRB1 hinge domain comprises an LILRB1 D3D4 domain or a functional variant thereof. In some embodiments, the LILRB1 D3D4 domain comprises a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99% or identical to SEQ ID NO: 77. In some embodiments, the LILRB1 D3D4 domain comprises or consists essentially of SEQ ID NO: 77.

    [0332] In some embodiments, the polypeptide comprises the LILRB1 hinge domain or functional fragment or variant thereof. In embodiments, the LILRB1 hinge domain or functional fragment or variant thereof comprises a sequence at least 95%, at least 96%, at least 97%, at least 98%, at least 99% identical or identical to SEQ ID NO: 84, SEQ ID NO: 77, or SEQ ID NO: 78. In embodiments, the LILRB1 hinge domain or functional fragment or variant thereof comprises a sequence at least 95% identical to SEQ ID NO: 84, SEQ ID NO: 77, or SEQ ID NO: 78.

    [0333] In some embodiments, the LILRB1 hinge domain comprises a sequence identical to SEQ ID NO: 84, SEQ ID NO: 77, or SEQ ID NO: 78.

    [0334] In some embodiments, the LILRB1 hinge domain consists essentially of a sequence identical to SEQ ID NO: 84, SEQ ID NO: 77, or SEQ ID NO: 78.

    [0335] In some embodiments, the transmembrane domain is a LILRB1 transmembrane domain or a functional variant thereof. In some embodiments, the LLRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical or at least 99% to SEQ ID NO: 85. In some embodiments, the LILRB1 transmembrane domain or a functional variant thereof comprises a sequence at least 95% identical to SEQ ID NO: 85. In some embodiments, the LILRB1 transmembrane domain comprises a sequence identical to SEQ ID NO: 85. In embodiments, the LILRB1 transmembrane domain consists essentially of a sequence identical to SEQ ID NO: 85.

    [0336] In some embodiments, the transmembrane domain can be attached to the extracellular region of the second, inhibitory receptor, e.g., the antigen binding domain or ligand binding domain, via a hinge, e.g., a hinge from a human protein. For example, in some embodiments, the hinge can be a human immunoglobulin (Ig) hinge, e.g., an IgG4 hinge, a CD8α hinge or an LILRB1 hinge.

    [0337] In some embodiments, the second, inhibitory receptor comprises an inhibitory domain. In some embodiments, the second, inhibitory receptor comprises an inhibitory intracellular domain and/or an inhibitory transmembrane domain. In some embodiments, the inhibitory domain is isolated or derived from LILR1B.

    Inhibitory Receptors Comprising Combinations of LILRB1 Domains

    [0338] In some embodiments, the LLRB1-based inhibitory receptors of the disclosure comprise more than one LILRB1 domain or functional equivalent thereof. For example, in some embodiments, the inhibitory receptor comprises an LILRB1 transmembrane domain and intracellular domain, or an LILRB1 hinge domain, transmembrane domain and intracellular domain.

    [0339] In particular embodiments, the inhibitory receptor comprises an LILRB1 hinge domain or functional fragment or variant thereof, and the LILRB1 transmembrane domain or a functional variant thereof. In some embodiments, the polypeptide comprises a sequence at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical or identical to SEQ ID NO: 79. In some embodiments, the polypeptide comprises a sequence at least 95% identical to SEQ ID NO: 79. In some embodiments, the polypeptide comprises a sequence identical to SEQ ID NO: 79.

    [0340] In further embodiments, the inhibitory receptor comprises: the LILRB1 transmembrane domain or a functional variant thereof, and an LILRB1 intracellular domain and/or an intracellular domain comprising at least one immunoreceptor tyrosine-based inhibitory motif (ITIM), wherein the ITIM is selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70). In some embodiments, the polypeptide comprises the LILRB1 transmembrane domain or a functional variant thereof, and an LILRB1 intracellular domain and/or an intracellular domain comprising at least two ITIM, wherein each ITIM is independently selected from NLYAAV (SEQ ID NO: 67), VTYAEV (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 70).

    [0341] In some embodiments, the inhibitory receptor comprises a LILRB1 transmembrane domain and intracellular domain. In some embodiments, the polypeptide comprises a sequence at least 95% identical, at least 96% identical, at least 97% identical, at least 98% identical, at least 99% identical or identical to SEQ ID NO: 80. In some embodiments, the polypeptide comprises a sequence at least 95% identical to SEQ ID NO: 80. In some embodiments, the polypeptide comprises a sequence identical to SEQ ID NO: 80. In some embodiments, the inhibitory receptor comprises the LILRB1 transmembrane domain and intracellular domain of SEQ ID NO: 80 fused to an extracellular ligand binding domain. In some embodiments, the inhibitory receptor comprises a first polypeptide comprising SEQ ID NO: 80 fused to a TCR alpha variable domain, and a second polypeptide comprising SEQ ID NO: 80 fused to a TCR beta variable domain.

    [0342] In preferred embodiments, the inhibitory receptor comprises: an LILRB1 hinge domain or functional fragment or variant thereof, an LILRB1 transmembrane domain or a functional variant thereof; and an LILRB1 intracellular domain and/or an intracellular domain comprising at least two immunoreceptor tyrosine-based inhibitory motifs (ITIMs), wherein each ITIM is independently selected from LYAAV (SEQ ID NO: 67), VTYAE (SEQ ID NO: 68), VTYAQL (SEQ ID NO: 69), and SIYATL (SEQ ID NO: 11).

    [0343] In some embodiments, the inhibitory receptor comprises a sequence at least 95% identical to SEQ ID NO: 82 or SEQ ID NO: 83, or at least 99% identical to SEQ ID NO: 82 or SEQ ID NO: 83, or identical to SEQ ID NO: 82 or SEQ ID NO: 83.

    [0344] In some embodiments, the polypeptide comprises a sequence at least 99% identical to SEQ ID NO: 79, or at least 99% identical to SEQ ID NO: 79, or identical to SEQ ID NO: 79.

    [0345] In some embodiments, the polypeptide comprises a sequence at least 99% identical to SEQ ID NO: 80, or at least 99% identical to SEQ ID NO: 80, or identical to SEQ ID NO: 80.

    TABLE-US-00038 TABLE 13 Polypeptide sequences for illustrative LILRB1-based inhibitory receptors Name Sequence LILRB1 MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQ GGQETQEYRLYREKKTALWITRIPQELVKKGQFPIPSITWEHAGRYRCYY GSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVILQCDSQV AFDGFSLCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRC YAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGS DAGYNRFVLYKDGERDFLQLAGAQPQAGLSQANFTLGPVSRSYGGQY RCYGAHNLSSEWSAPSDPLDILIAGQFYDRVSLSVQPGPTVASGENVTLL CQSQGWMQTFLLTKEGAADDPWRLRSTYQSQKYQAEFPMGPVTSAH AGTYRCYGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPED QPLTPTGSDPQSGLGRHLGVVIGILVAVILLLLLLLLLFLILRHRRQGKHW TSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHT QPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFL DTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSLTLRREATEPPPSQE GPSPAVPSIYATLAIH SEQ ID NO: 65 LILRB1 hinge- YGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPT transmembrane- GSDPQSGLGRHLGVVIGILVAVILLLLLLLLLFLILRHRRQGKHWTSTQRK intracellular domain ADFQHPAGAVGPEPTDRGLQWRSSPAADAQEENLYAAVKHTQPEDG VEMDTRSPHDEDPQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQ AEEDRQMDTEAAASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAV PSIYATLAIH SEQ ID NO: 82 LILRB1 hinge- VVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGVVIGILV transmembrane- AVILLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGL intracellular domain (w/o QWRSSPAADAQEENLYAAVKHTQPEDGVEMDTRSPHDEDPQAVTYA YGSQSSKPYLLTHPSDPLEL) EVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQ DVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH SEQ ID NO: 83 LILRB1 hinge domain YGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPT GSDPQSGLGRHLG SEQ ID NO: 84 LILRB1 transmembrane VVIGILVAVILLLLLLLLLFLIL domain SEQ ID NO: 85 LILRB1 intracellular RHRRQGKHWTSTQRKADFQHPAGAVGPEPTDRGLQWRSSPAADAQ domain EENLYAAVKHTQPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMA SPPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSLTLRR EATEPPPSQEGPSPAVPSIYATLAIH SEQ ID NO: 81 ITIM1 NLYAAV SEQ ID NO: 67 ITIM2 VTYAEV SEQ ID NO: 68 ITIM3 VTYAQL SEQ ID NO: 69 ITIM4 SIYATL SEQ ID NO: 70 ITIM1-2 NLYAAVKHTQPEDGVEMDTRSPHDEDPQAVTYAEV SEQ ID NO: 71 ITIM2-3 VTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASE APQDVTYAQL SEQ ID NO: 72 ITIM3-4 VTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATL SEQ ID NO: 73 ITIM1-3 NLYAAVKHTQPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMAS PPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQL SEQ ID NO: 74 ITIM2-4 VTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAAASE APQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATL SEQ ID NO: 75 ITIM1-4 NLYAAVKHTQPEDGVEMDTRSPHDEDPQAVTYAEVKHSRPRREMAS PPSPLSGEFLDTKDRQAEEDRQMDTEAAASEAPQDVTYAQLHSLTLRR EATEPPPSQEGPSPAVPSIYATL SEQ ID NO: 76 D3D4 domain YGSQSSKPYLLTHPSDPLEL SEQ ID NO: 77 Short hinge VVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLG SEQ ID NO: 78 Hinge (iTIM hinge) YGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPT GSDPQSGLGRHLGV (SEQ ID NO: 8820) Short hinge 2 VVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGV (SEQ ID NO: 8821) Long hinge 1 AGSGGSGGSGGSPVPSTPPTPSPSTPPTPSPSGGSGNSSGSGGSPVPST PPTPSPSTPPTPSPSASV (SEQ ID NO: 8822) Long hinge 2 AGSGGSGGSGGSPVPSTPPTNSSSTPPTPSPSPVPSTPPTNSSSTPPTPS PSPVPSTPPTNSSSTPPTPSPSASV (SEQ ID NO: 8823) 2x Short hinge VVSGPSGGPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHVVSGPSG GPSSPTTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGV (SEQ ID NO: 8824) Hinge (truncated) TTGPTSTSGPEDQPLTPTGSDPQSGLGRHLGV (SEQ ID NO: 8825) Hinge-transmembrane YGSQSSKPYLLTHPSDPLELVVSGPSGGPSSPTTGPTSTSGPEDQPLTPT GSDPQSGLGRHLGVVIGILVAVILLLLLLLLLFLIL SEQ ID NO: 79 Transmembrane- VVIGILVAVILLLLLLLLLFLILRHRRQGKHWTSTQRKADFQHPAGAVGP intracellular domain. EPTDRGLQWRSSPAADAQEENLYAAVKHTQPEDGVEMDTRSPHDED PQAVTYAEVKHSRPRREMASPPSPLSGEFLDTKDRQAEEDRQMDTEAA ASEAPQDVTYAQLHSLTLRREATEPPPSQEGPSPAVPSIYATLAIH SEQ ID NO: 80

    Linkers

    [0346] In some embodiments, the engineered receptors comprise a linker linking two domains of the engineered receptor. Provided herein are linkers that, in some embodiments, can be used to link domains of the engineered receptors described herein.

    [0347] The terms “linker” and “flexible polypeptide linker” as used in the context of linking protein domains, for example intracellular domains or domains within an scFv, refers to a peptide linker that consists of amino acids such as glycine and/or serine residues used alone or in combination, to link two domains together.

    [0348] Any linker may be used and many fusion protein linker formats are known. For example, the linker may be flexible or rigid. Non-limiting examples of rigid and flexible linkers are provided in Chen et al. (Adv Drug Deliv Rev. 2013; 65(10):1357-1369).

    [0349] The antigen-binding domains described herein may be linked to each other in a random or specified order.

    [0350] The antigen-binding domains described herein may be linked to each other in any orientation of N to C terminus.

    [0351] Optionally, a short oligo- or polypeptide linker, for example, between 2 and 40 amino acids (e.g., 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids) in length may form the linkage between the domains.

    [0352] In some embodiments, the linker is a peptide of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more than 30 amino acid residues. Non-limiting examples of amino acids found in linkers include Gly, Ser, Glu, Gin, Ala, Leu, Iso, Lys, Arg, Pro, and the like. In some embodiments, the linker is [(Gly)n1Ser]n2, where n1 and n2 may be any number (e.g. n1 and n2 may independently be 1, 2, 4, 5, 6, 7, 8, 9, 10 or more than 10). In some embodiments, n1 is 4.

    [0353] In some embodiments, the flexible polypeptide linker is a Gly/Ser linker and comprises the amino acid sequence (Gly-Gly-Ser), (Gly-Gly-Gly-Ser, SEQ ID NO: 231), or (Gly-Gly-Gly-Gly-Ser, SEQ ID NO: 226) which can be repeated n times, where n is a positive integer equal to or greater than 1. For example, n=1, n=2, n=3, n=4, n=5, n=6, n=7, n=8, n=9 and n=10. In some embodiments, the flexible polypeptide linkers include, but are not limited to, GGS, GGGGS (SEQ ID NO: 226), GGGGS GGGGS (SEQ ID NO: 227), GGGGS GGGGS GGGGS (SEQ ID NO: 228), GGGGS GGGGS GGGGS GG (SEQ ID NO: 229) or GGGGS GGGGS GGGGS GGGGS (SEQ ID NO: 230).

    [0354] In some embodiments, the linkers include multiple repeats of (Gly Gly Ser), (Gly Ser) or (Gly Gly Gly Ser (SEQ ID NO: 231)). Also included within the scope of the invention are linkers described in WO2012/138475 (incorporated herein by reference).

    [0355] In some embodiments, the linker sequence comprises a long linker (LL) sequence. In some embodiments, the long linker sequence comprises GGGGS (SEQ ID NO: 226), repeated four times. In some embodiments, a GGGGS GGGGS GGGGS GGGGS (SEQ ID NO: 230) is used to link intracellular domains in a TCR alpha fusion protein of the disclosure.

    [0356] In some embodiments, the long linker sequence comprises GGGGS (SEQ ID NO: 226), repeated three times. In some embodiments, a GGGGS GGGGS GGGGS (SEQ ID NO: 228) is used to link intracellular domains in a TCR beta fusion protein of the disclosure.

    [0357] In some embodiments, the linker sequence comprises a short linker (SL) sequence. In some embodiments, the short linker sequence comprises GGGGS (SEQ ID NO: 226).

    [0358] In some embodiments, a glycine-serine doublet can be used as a suitable linker.

    [0359] In some embodiments, domains are fused directly to each other via peptide bonds without use of a linker.

    [0360] Additional antigen binding domains, activator and inhibitor targets, and receptors, and uses thereof, are described in WO2021/030149, published Feb. 18, 2021, WO2021/173674, published Aug. 2, 2021, WO2021/119489, published Jun. 17, 2021, WO2021/222576, published Nov. 4, 2021, WO2021/252635, published Dec. 16, 2021, WO2022/036065, published Mar. 17, 2022, WO2022/040454, published Feb. 24, 2022, WO2022/040444, published Feb. 24, 2022, WO2022/040470, published Feb. 24, 2022, and WO2021/096868, published May 20, 2021, the contents of each of which are incorporated by reference herein in their entireties.

    Assays

    [0361] Provided herein are assays that can be used to measure the activity of the engineered receptors of the disclosure.

    [0362] The activity of engineered receptors can be assayed using a cell line engineered to express a reporter of receptor activity such as a luciferase reporter. Exemplary cell lines include Jurkat T cells, although any suitable cell line known in the art may be used. For example, Jurkat cells expressing a luciferase reporter under the control of an NFAT promoter can be used as effector cells. Expression of luciferase by this cell line reflects TCR-mediated signaling.

    [0363] The reporter cells can be transfected with each of the various fusion protein constructs, combinations of fusion protein constructs or controls described herein.

    [0364] Expression of the fusion proteins in reporter cells can be confirmed by using fluorescently labeled MHC tetramers, for example Alexa Fluor 647-labeled NY-ESO-1-MHC tetramer, to detect expression of the fusion protein.

    [0365] To assay the activity of engineered receptors, target cells are loaded with antigen prior to exposure to the effector cells comprising the reporter and the engineered receptor. For example, target cells can be loaded with antigen at least 12, 14, 16, 18, 20, 22 or 24 hours prior to exposure to effector cells. Exemplary target cells include A375 cells, although any suitable cells known in the art may be used. In some cases, target cells can be loaded with serially diluted concentrations of an antigen, such as NY-ESO-1 peptide. The effector cells can then be co-cultured with target cells for a suitable period of time, for example 6 hours. Luciferase is then measured by luminescence reading after co-culture. Luciferase luminescence can be normalized to maximum and minimum intensity to allow comparison of activating peptide concentrations for each engineered receptor construct.

    [0366] Provided herein are methods of determining the relative EC50 of engineered receptors of the disclosure. As used herein, “EC50” refers to the concentration of an inhibitor or agent where the response (or binding) is reduced by half. EC50s of engineered receptors of the disclosure refer to concentration of antigen where binding of the engineered receptor to the antigen is reduced by half. Binding of the antigen, or probe to the engineered receptor can be measured by staining with labeled peptide or labeled peptide-MHC complex, for example MHC:NY-ESO-1 pMHC complex conjugated with fluorophore. EC50 can be obtained by nonlinear regression curve fitting of reporter signal with peptide titration. Probe binding and EC50 can be normalized to the levels of benchmark TCR without a fusion protein, e.g. NY-ESO-1 (clone 1G4).

    Polynucleotides

    [0367] The disclosure provides polynucleotides comprising the sequence(s) of the interfering RNA described herein. In some embodiments, the polynucleotides comprise the shRNA described herein. In some embodiments, the shRNA comprises a first sequence, having from 5′ end to 3′ end a sequence complementary to an HLA-A*02 mRNA; and a second sequence, having from 5′ end to 3′ end a sequence complementary to the first sequence. In some embodiments, the HLA-A*02 mRNA sequence comprises a coding sequence. In some embodiments, the HLA-A*02 mRNA sequence comprises an untranslated region. In some embodiments, the first and second sequence are present on a polynucleotide, wherein the first sequence and the second sequence are separated by 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides, wherein the 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides form a loop region in the shRNA. In some embodiments, the shRNA further comprises a 5′ flank sequence and a 3′ flank sequence, wherein the 5′ flank sequence is joined to the 5′ end of the first sequence, and wherein the 3′ flank sequence is joined to the 3′ end of the second sequence.

    [0368] In some embodiments, the polynucleotide encoding an shRNA has from 5′ end to 3′ end, a 5′ flank sequence, a first sequence, a loop sequence, a second sequence, a 3′ flank sequence. In some embodiments, the polynucleotide encoding an shRNA has from 5′ end to 3′ end, a 5′ flank sequence, a second sequence, a loop sequence, a first sequence, and a 3′ flank sequence.

    [0369] In some embodiments, the first sequences is 18, 19, 20, 21, or 22 nucleotides. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-8794. In some embodiments, the first sequence has GC content greater than or equal to 25% and less than 60%. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-3990. In some embodiments, the first sequence does not comprise four nucleotides of the same base or a run of seven C or G nucleotide bases. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-3508. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-678. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-485. Illustrative target HLA sequences complementary to the first sequence are shown in Table 2.

    [0370] In some embodiments, the polynucleotide encoding an shRNA further comprises a promoter sequence and a terminator sequence. In some embodiments, the shRNA is operably linked to the promoter. In some embodiments, the polynucleotide has from 5′ end to 3′ end, a promoter sequence, a 5′ flank sequence, a first sequence, a loop sequence, a second sequence, a 3′ flank sequence, and a terminator. In some embodiments, the polynucleotide encodes, from 5′ end to 3′ end, a promoter sequence, a 5′ flank sequence, a second sequence, a loop sequence, a first sequence, a 3′ flank sequence, and a terminator sequence.

    [0371] In some embodiments, the polynucleotides comprise a promoter operably linked to the shRNA, such as a mammalian, viral or synthetic promoter. In some embodiments, the promoter sequence is a U6 promoter sequence. In some embodiments, the promoter sequence shares at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identity to SEQ ID NO: 8826. In some embodiments, the promoter sequence is SEQ ID NO: 8826. In some embodiments, the promoter sequence is a H1 promoter sequence. In some embodiments, the promoter sequence shares at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identity to SEQ ID NO: 8827. In some embodiments, the promoter sequence is SEQ ID NO: 8827. In some embodiments, the promoter sequence is a 7SK promoter sequence. In some embodiments, the promoter sequence shares at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identity to SEQ ID NO: 8828. In some embodiments, the promoter sequence is SEQ ID NO: 8828. In some embodiments, the promoter sequence is a Ef1a promoter sequence. In some embodiments, the promoter sequence shares at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identity to SEQ ID NO: 8829. In some embodiments, the promoter sequence is SEQ ID NO: 8829. Illustrative promoter sequences are shown in Table 14.

    TABLE-US-00039 TABLE 14 Illustrative promoter sequences Promoter SEQ ID NO U6 Promoter 8826 H1 Promoter 8827 7SK Promoter 8828 Ef1a Promoter 8829

    Vectors

    [0372] The disclosure provides vectors comprising the polynucleotides described herein.

    [0373] The disclosure provides vectors encoding the interfering RNA described herein. In some embodiments, the vectors encode the shRNA described herein. In some embodiments, the shRNA comprises a first sequence, having from 5′ end to 3′ end a sequence complementary to the HLA-A*02 mRNA; and a second sequence, having from 5′ end to 3′ end a sequence complementary to the first sequence. In some embodiments, the first and second sequence are present on a polynucleotide, wherein the first sequence and the second sequence are separated by 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides, wherein the 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides form a loop region in the shRNA. In some embodiments, the shRNA further comprises a 5′ flank sequence and a 3′ flank sequence, wherein the 5′ flank sequence is joined to the 5′ end of the first sequence, and wherein the 3′ flank sequence is joined to the 3′ end of the second sequence.

    [0374] In some embodiments, the vectors encoding an shRNA has from 5′ end to 3′ end, a 5′ flank sequence, a first sequence, a loop sequence, a second sequence, a 3′ flank sequence. In some embodiments, the vectors encode, from 5′ end to 3′ end, and a 3′ flank sequence. In some embodiments, the vectors encode an shRNA has from 5′ end to 3′ end, a 5′ flank sequence, a second sequence, a loop sequence, a first sequence, and a 3′ flank sequence.

    [0375] In some embodiments, the vectors encoding an shRNA further comprises a promoter sequence and a terminator sequence. In some embodiments, the shRNA is operably linked to the promoter. In some embodiments, the vector has from 5′ end to 3′ end, a promoter sequence, a 5′ flank sequence, a first sequence, a loop sequence, a second sequence, a 3′ flank sequence, and a terminator. In some embodiments, the vector has from 5′ end to 3′ end, a promoter sequence, a 5′ flank sequence, a second sequence, a loop sequence, a first sequence, a 3′ flank sequence, and a terminator sequence.

    [0376] In some embodiments of the vectors of the disclosure, the promoter sequence is a U6 promoter sequence. In some embodiments, the promoter sequence shares at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identity to SEQ ID NO: 8826. In some embodiments, the promoter sequence is SEQ ID NO: 8826. In some embodiments, the promoter sequence is a H1 promoter sequence. In some embodiments, the promoter sequence shares at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identity to SEQ ID NO: 8827. In some embodiments, the promoter sequence is SEQ ID NO: 8827. In some embodiments, the promoter sequence is a 7SK promoter sequence. In some embodiments, the promoter sequence shares at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identity to SEQ ID NO: 8828. In some embodiments, the promoter sequence is SEQ ID NO: 8828. In some embodiments, the promoter sequence is a Ef1a promoter sequence. In some embodiments, the promoter sequence shares at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, at least 99% identity to SEQ ID NO: 8829. In some embodiments, the promoter sequence is SEQ ID NO: 8829. Illustrative promoter sequences are shown in Table 14.

    [0377] In some embodiments, the vector described herein is a viral vector. In some embodiments, the vector is a lentiviral vector.

    [0378] The disclosure provides vectors encoding an interfering RNA described herein and an inhibitory receptor. In some embodiments, the vector comprises an shRNA described herein and a polynucleotide encoding an inhibitor receptor comprising a ligand binding domain specific to a class I major histocompatibility complex (MHC-I) molecule, or a peptide-MHC complex thereof.

    [0379] The disclosure provides polynucleotides encoding the sequence(s) of the activator and inhibitory receptors described herein.

    [0380] In some embodiments, the sequence of the first and/or second receptor, or a fusion protein of the first and/or second receptor is operably linked to a promoter. In some embodiments, the sequence encoding the activator receptor, or a polypeptide thereof, is operably linked to a first promoter, and the sequence encoding a inhibitory receptor, or a fusion protein thereof, is operably linked to a second promoter.

    [0381] The disclosure provides vectors comprising the polynucleotides described herein.

    [0382] The disclosure provides vectors encoding the coding sequence or sequences of any of the receptors described herein. In some embodiments, the sequence of the first and/or second fusion protein is operably linked to a promoter. In some embodiments, the sequence encoding the first fusion protein is operably linked to a first promoter, and the sequence encoding a second fusion protein is operably linked to a second promoter.

    [0383] In some embodiments, the first engineered receptor is encoded by a first vector and the second engineered receptor is encoded by second vector. In some embodiments, both engineered receptors are encoded by a single vector.

    [0384] In some embodiments, the first and second receptors are encoded by a single vector. Methods of encoding multiple polypeptides using a single vector will be known to persons of ordinary skill in the art, and include, inter alia, encoding multiple polypeptides under control of different promoters, or, if a single promoter is used to control transcription of multiple polypeptides, use of sequences encoding internal ribosome entry sites (IRES) and/or self-cleaving peptides. Exemplary self-cleaving peptides include T2A, P2A, E2A and F2A self-cleaving peptides. In some embodiments, the T2A self-cleaving peptide comprises a sequence of EGRGSLLTCGDVEENPGP (SEQ ID NO: 271). In some embodiments, the P2A self-cleaving peptide comprises a sequence of ATNFSLLKQAGDVEENPGP (SEQ ID NO: 192). In some embodiments, the E2A self-cleaving peptide comprises a sequence of QCTNYALLKLAGDVESNPGP (SEQ ID NO: 272). In some embodiments, the F2A self-cleaving peptide comprises a sequence of VKQTLNFDLLKLAGDVESNPGP (SEQ ID NO: 273).

    [0385] The disclosure provides polynucleotides encoding the gene editing systems described herein.

    [0386] In some embodiments, the vector is an expression vector, i.e. for the expression of the fusion protein in a suitable cell.

    [0387] Vectors derived from retroviruses such as the lentivirus are suitable tools to achieve long-term gene transfer since they allow long-term, stable integration of a transgene and its propagation in daughter cells. Lentiviral vectors have the added advantage over vectors derived from onco-retroviruses such as murine leukemia viruses in that they can transduce non-proliferating cells, such as hepatocytes. They also have the added advantage of low immunogenicity.

    [0388] The expression of natural or synthetic nucleic acids encoding fusion proteins is typically achieved by operably linking a nucleic acid encoding the fusion protein or portions thereof to a promoter, and incorporating the construct into an expression vector. The vectors can be suitable for replication and integration eukaryotes. Typical cloning vectors contain transcription and translation terminators, initiation sequences, and promoters useful for regulation of the expression of the desired nucleic acid sequence.

    [0389] The polynucleotides encoding the fusion proteins can be cloned into a number of types of vectors. For example, the polynucleotides can be cloned into a vector including, but not limited to a plasmid, a phagemid, a phage derivative, an animal virus, and a cosmid. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.

    [0390] Further, the expression vector may be provided to cells, such as immune cells, in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication function in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers, (e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193).

    [0391] A number of viral based systems have been developed for gene transfer into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged in retroviral particles using techniques known in the art. The recombinant virus can then be isolated and delivered to cells of the subject either in vivo or ex vivo. A number of retroviral systems are known in the art. In some embodiments, adenovirus vectors are used. A number of adenovirus vectors are known in the art. In one embodiment, lentivirus vectors are used.

    [0392] Additional promoter elements, e.g., enhancers, regulate the frequency of transcriptional initiation. Typically, these are located in the region 30-110 basepairs (bp) upstream of the start site, although a number of promoters have recently been shown to contain functional elements downstream of the start site as well. The spacing between promoter elements frequently is flexible, so that promoter function is preserved when elements are inverted or moved relative to one another. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp apart before activity begins to decline. Depending on the promoter, it appears that individual elements can function either cooperatively or independently to activate transcription.

    [0393] One example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. This promoter sequence is a strong constitutive promoter sequence capable of driving high levels of expression of any polynucleotide sequence operatively linked thereto. Another example of a suitable promoter is Elongation Growth Factor-1α (EF-1α, Ef1α). However, other constitutive promoter sequences may also be used, including, but not limited to the simian virus 40 (SV40) early promoter, mouse mammary tumor virus (MMTV), human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, MoMuLV promoter, an avian leukemia virus promoter, an Epstein-Barr virus immediate early promoter, a Rous sarcoma virus promoter, as well as human gene promoters such as, but not limited to, the actin promoter, the myosin promoter, the hemoglobin promoter, and the creatine kinase promoter. Further, the invention should not be limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the invention. The use of an inducible promoter provides a molecular switch capable of turning on expression of the polynucleotide sequence which it is operatively linked when such expression is desired, or turning off the expression when expression is not desired. Examples of inducible promoters include, but are not limited to a metallothionine promoter, a glucocorticoid promoter, a progesterone promoter, and a tetracycline promoter.

    [0394] In order to assess the expression of a fusion protein, the expression vector to be introduced into a cell can also contain either a selectable marker gene or a reporter gene or both to facilitate identification and selection of expressing cells from the population of cells sought to be transfected or infected through viral vectors. In other aspects, the selectable marker may be carried on a separate piece of DNA and used in a co-transfection procedure. Both selectable markers and reporter genes may be flanked with appropriate regulatory sequences to enable expression in the host cells. Useful selectable markers include, for example, antibiotic-resistance genes, such as neo and the like.

    [0395] Reporter genes are used for identifying potentially transfected or transduced cells and for evaluating the functionality of regulatory sequences. In general, a reporter gene is a gene that is not present in or expressed by the recipient organism or tissue and that encodes a polypeptide whose expression is manifested by some easily detectable property, e.g., enzymatic activity. Expression of the reporter gene is assayed at a suitable time after the DNA has been introduced into the recipient cells. Suitable reporter genes may include genes encoding luciferase, beta-galactosidase, chloramphenicol acetyl transferase, secreted alkaline phosphatase, or the green fluorescent protein gene (e.g., Ui-Tei et al., 2000 FEBS Letters 479: 79-82). Suitable expression systems are well known and may be prepared using known techniques or obtained commercially. In general, the construct with the minimal 5′ flanking region showing the highest level of expression of reporter gene is identified as the promoter. Such promoter regions may be linked to a reporter gene and used to evaluate agents for the ability to modulate promoter-driven transcription.

    [0396] Methods of introducing and expressing genes into a cell are known in the art. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means.

    [0397] Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). One method for the introduction of a polynucleotide into a host cell is calcium phosphate transfection.

    [0398] Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.

    [0399] Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).

    [0400] Regardless of the method used to introduce exogenous nucleic acids into a host cell or otherwise expose a cell to the inhibitor of the present invention, in order to confirm the presence of the recombinant DNA sequence in the host cell, a variety of assays may be performed. Such assays include, for example, “molecular biological” assays well known to those of skill in the art, such as Southern and Northern blotting, RT-PCR and PCR; “biochemical” assays, such as detecting the presence or absence of a particular peptide, e.g., by immunological means (ELISAs and Western blots) or by assays described herein to identify agents falling within the scope of the invention.

    Immune Cells

    [0401] Provided herein are immune cells comprising the interfering RNAs, polynucleotides, vectors, fusion proteins and engineered receptors described herein.

    [0402] Provided herein are immune cells comprising the interfering RNAs, e.g. shRNAS, described herein. In some embodiments, the immune cells comprise the interfering RNAs. polynucleotides, vectors, fusion proteins or engineered receptors of the disclosure.

    [0403] In some embodiments, the immune cell is a T cell, B cell, or Natural Killer (NK) cell. In some embodiments, the immune cell is autologous to a subject. In some embodiments, the immune cell is allogeneic to a subject. In some embodiments, the immune cell is non-natural.

    [0404] In some embodiments, the immune cell is isolated. In some embodiments, the immune cell is for use as a medicament. In some embodiments, the medicament is for the treatment of cancer in a subject in need thereof.

    [0405] In some embodiments, the immune cell comprises an inhibitory receptor comprising a ligand binding domain specific to a class I major histocompatibility complex (MHC-I) molecule, or a peptide-MHC complex thereof, wherein expression and/or function of a human leukocyte antigen (HLA) polypeptide, or an allele thereof, in said immune cell has been reduced or eliminated. In some embodiments, the HLA allele is an HLA-A, HLA-B, HLA-C, and/or HLA-E allele. In some embodiments, the HLA-A allele is selected from HLA-A*02, HLA-A*02:01, HLA-A*02:01:01, and HLA-A*02:01:01:01. In some embodiments, the HLA-A allele is HLA-A*02.

    [0406] In some embodiments, the immune cell comprises an interfering RNA, comprising a sequence complementary to a sequence of a HLA-A*02 mRNA. In some embodiments, the interfering RNA is capable of inducing RNAi-mediated degradation of the HLA-A*02 mRNA. In some embodiments, the interfering RNA is a short hairpin RNA (shRNA).

    [0407] In some embodiments, the shRNA comprises a first sequence, having from 5′ to 3′ end a sequence complementary to the HLA-A*02 mRNA; and a second sequence, having from 5′ to 3′ end a sequence complementary to the first sequence, wherein the first sequence and second sequence form the shRNA.

    [0408] In some embodiments, the first sequences is 18, 19, 20, 21, or 22 nucleotides. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-8794. In some embodiments, the first sequence has GC content greater than or equal to 25% and less than 60%. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-3990. In some embodiments, the first sequence does not comprise four nucleotides of the same base or a run of seven C or G nucleotide bases. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-3508. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-678. In some embodiments, the first sequence is complementary to a sequence selected from SEQ ID NOs: 400-485. Illustrative target HLA-A sequences complementary to the first sequence are shown in Table 12.

    [0409] In some embodiments, the first and second sequence are present on a single stranded polynucleotide, wherein the first sequence and second sequence are separated by 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides, wherein the 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 nucleotides form a loop region in the shRNA. In some embodiments, the loop region comprises a sequence selected from SEQ ID NOs: 8800-8813. Illustrative loop region sequences are shown in Table 3.

    [0410] In some embodiments, the shRNA further comprises a 5′ flank sequence and a 3′ flank sequence, wherein the 5′ flank sequence is joined to the 5′ end of the first sequence, and wherein the 3′ flank sequence is joined to the 3′ end of the second sequence. In some embodiments, the 5′ flank sequence is selected from SEQ ID NO: 8814-8816. In some embodiments, the 3′ flank sequence is selected from SEQ ID NO: 8817-8819. Illustrative flank sequences are shown in Table 4.

    [0411] As used herein, the term “immune cell” refers to a cell involved in the innate or adaptive (acquired) immune systems. Exemplary innate immune cells include phagocytic cells such as neutrophils, monocytes and macrophages, Natural Killer (NK) cells, polymorphonuclear leukocytes such as neutrophils eosinophils and basophils and mononuclear cells such as monocytes, macrophages and mast cells. Immune cells with roles in acquired immunity include lymphocytes such as T-cells and B-cells.

    [0412] As used herein, a “T-cell” refers to a type of lymphocyte that originates from a bone marrow precursor that develops in the thymus gland. There are several distinct types of T-cells which develop upon migration to the thymus, which include, helper CD4+ T-cells, cytotoxic CD8+ T cells, memory T cells, regulatory CD4+ T-cells and stem memory T-cells. Different types of T-cells can be distinguished by the ordinarily skilled artisan based on their expression of markers. Methods of distinguishing between T-cell types will be readily apparent to the ordinarily skilled artisan.

    [0413] In some embodiments, the engineered immune cell expresses the first and second receptors at a ratio of about 100:1 to 1:100 of first receptor to second receptor. In some embodiments, the engineered immune cell expresses the first and second receptors at a ratio of about 50:1 to 1:50 of first receptor to second receptor. In some embodiments, the engineered immune cell expresses the first and second receptors at a ratio of about 10:1 to 1:10 of first receptor to second receptor. In some embodiments, the engineered immune cell expresses the first and second receptors at a ratio of about 5:1 to 1:5 of first receptor to second receptor. In some embodiments, the engineered immune cell expresses the first and second receptors at a ratio of about 3:1 to 1:3 of first receptor to second receptor. In some embodiments, the engineered immune cell expresses the first and second receptors at a ratio of about 2:1 to 1:2 of first receptor to second receptor. In some embodiments, the engineered immune cell expresses the first and second receptors at a ratio of about 1:1.

    [0414] In some embodiments, the engineered immune cell comprising the engineered receptors of the disclosure is a T cell. In some embodiments, the T cell is an effector T cell or a regulatory T cell.

    [0415] Methods transforming populations of immune cells, such as T cells, with the vectors of the instant disclosure will be readily apparent to the person of ordinary skill in the art. For example, CD3+ T cells can be isolated from PBMCs using a CD3+ T cell negative isolation kit (Miltenyi), according to manufacturer's instructions. T cells can be cultured at a density of 1×10{circumflex over ( )}6 cells/mL in X-Vivo 15 media supplemented with 5% human A/B serum and 1% Pen/strep in the presence of CD3/28 Dynabeads (1:1 cell to bead ratio) and 300 Units/mL of IL-2 (Miltenyi). After 2 days, T cells can be transduced with viral vectors, such as lentiviral vectors using methods known in the art. In some embodiments, the viral vector is transduced at a multiplicity of infection (MOI) of 5. Cells can then be cultured in IL-2 or other cytokines such as combinations of IL-7/15/21 for an additional 5 days prior to enrichment. Methods of isolating and culturing other populations of immune cells, such as B cells, or other populations of T cells, will be readily apparent to the person of ordinary skill in the art. Although this method outlines a potential approach it should be noted that these methodologies are rapidly evolving. For example excellent viral transduction of peripheral blood mononuclear cells can be achieved after 5 days of growth to generate a >99% CD3+ highly transduced cell population.

    [0416] Methods of activating and culturing populations of T cells comprising the engineered TCRs, CARs, fusion proteins or vectors encoding the fusion proteins of the instant disclosure, will be readily apparent to the person of ordinary skill in the art.

    [0417] Whether prior to or after genetic modification of T cells to express an engineered TCR, the T cells can be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 6,692,964; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,067,318; 7,172,869; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041, 10,040,846; and U.S. Pat. Appl. Pub. No. 2006/0121005.

    [0418] In some embodiments, T cells of the instant disclosure are expanded and activated in vitro. Generally, the T cells of the instant disclosure are expanded in vitro by contact with a surface having attached thereto an agent that stimulates a CD3/TCR complex associated signal and a ligand that stimulates a co-stimulatory molecule on the surface of the T cells. In particular, T cell populations may be stimulated as described herein, such as by contact with an anti-CD3 antibody. For co-stimulation of an accessory molecule on the surface of the T cells, a ligand that binds the accessory molecule is used. For example, a population of T cells can be contacted with an anti-CD3 antibody and an anti-CD28 antibody, under conditions appropriate for stimulating proliferation of the T cells. To stimulate proliferation of either CD4+ T cells or CD8+ T cells, an anti-CD3 antibody and an anti-CD28 antibody can be used. Examples of an anti-CD28 antibody include 9.3, B-T3, XR-CD28 (Diaclone, Besangon, France) can be used as can other methods commonly known in the art (Berg et al., Transplant Proc. 30(8):3975-3977, 1998; Haanen et al., J. Exp. Med. 190(9):13191328, 1999; Garland et al., J. Immunol Meth. 227(1-2):53-63, 1999).

    [0419] In some embodiments, the primary stimulatory signal and the co-stimulatory signal for the T cell may be provided by different protocols. For example, the agents providing each signal may be in solution or coupled to a surface. When coupled to a surface, the agents may be coupled to the same surface (i.e., in “cis” formation) or to separate surfaces (i.e., in “trans” formation). Alternatively, one agent may be coupled to a surface and the other agent in solution. In some embodiments, the agent providing the co-stimulatory signal is bound to a cell surface and the agent providing the primary activation signal is in solution or coupled to a surface. In certain embodiments, both agents can be in solution. In another embodiment, the agents may be in soluble form, and then cross-linked to a surface, such as a cell expressing Fc receptors or an antibody or other binding agent which will bind to the agents. In this regard, see for example, U.S. Patent Application Publication Nos. 20040101519 and 20060034810 for artificial antigen presenting cells (aAPCs) that are contemplated for use in activating and expanding T cells in the present invention.

    [0420] In some embodiments, the two agents are immobilized on beads, either on the same bead, i.e., “cis,” or to separate beads, i.e., “trans.” By way of example, the agent providing the primary activation signal is an anti-CD3 antibody or an antigen-binding fragment thereof and the agent providing the co-stimulatory signal is an anti-CD28 antibody or antigen-binding fragment thereof, and both agents are co-immobilized to the same bead in equivalent molecular amounts. In one embodiment, a 1:1 ratio of each antibody bound to the beads for CD4+ T cell expansion and T cell growth is used. In some embodiments, the ratio of CD3:CD28 antibody bound to the beads ranges from 100:1 to 1:100 and all integer values there between. In one aspect of the present invention, more anti-CD28 antibody is bound to the particles than anti-CD3 antibody, i.e., the ratio of CD3:CD28 is less than one. In certain embodiments of the invention, the ratio of anti CD28 antibody to anti CD3 antibody bound to the beads is greater than 2:1.

    [0421] Ratios of particles to cells from 1:500 to 500:1 and any integer values in between may be used to stimulate T cells or other target cells. As those of ordinary skill in the art can readily appreciate, the ratio of particles to cells may depend on particle size relative to the target cell. For example, small sized beads could only bind a few cells, while larger beads could bind many. In certain embodiments the ratio of cells to particles ranges from 1:100 to 100:1 and any integer values in-between and in further embodiments the ratio comprises 1:9 to 9:1 and any integer values in between, can also be used to stimulate T cells. In some embodiments, a ratio of 1:1 cells to beads is used. One of skill in the art will appreciate that a variety of other ratios may be suitable for use in the present invention. In particular, ratios will vary depending on particle size and on cell size and type.

    [0422] In further embodiments of the present invention, the cells, such as T cells, are combined with agent-coated beads, the beads and the cells are subsequently separated, and then the cells are cultured. In an alternative embodiment, prior to culture, the agent-coated beads and cells are not separated but are cultured together. In a further embodiment, the beads and cells are first concentrated by application of a force, such as a magnetic force, resulting in increased ligation of cell surface markers, thereby inducing cell stimulation.

    [0423] By way of example, cell surface proteins may be ligated by allowing paramagnetic beads to which anti-CD3 and anti-CD28 are attached to contact the T cells. In one embodiment the cells (for example, CD4+ T cells) and beads (for example, DYNABEADS CD3/CD28 T paramagnetic beads at a ratio of 1:1) are combined in a buffer. Again, those of ordinary skill in the art can readily appreciate any cell concentration may be used. In certain embodiments, it may be desirable to significantly decrease the volume in which particles and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and particles. For example, in one embodiment, a concentration of about 2 billion cells/ml is used. In another embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In yet another embodiment, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used. In some embodiments, cells that are cultured at a density of 1×10.sup.6 cells/mL are used.

    [0424] In some embodiments, the mixture may be cultured for several hours (about 3 hours) to about 14 days or any hourly integer value in between. In another embodiment, the beads and T cells are cultured together for 2-3 days. Conditions appropriate for T cell culture include an appropriate media (e.g., Minimal Essential Media or RPMI Media 1640 or, X-vivo 15, (Lonza)) that may contain factors necessary for proliferation and viability, including serum (e.g., fetal bovine or human serum), interleukin-2 (IL-2), insulin, IFN-7, IL-4, IL-7, GM-CSF, IL-10, IL-12, IL-15, TGFβ, and TNF-α or any other additives for the growth of cells known to the skilled artisan. Other additives for the growth of cells include, but are not limited to, surfactant, plasmanate, and reducing agents such as N-acetyl-cysteine and 2-mercaptoethanol. Media can include RPMI 1640, AIM-V, DMEM, MEM, α-MEM, F-12, X-Vivo 15, and X-Vivo 20, Optimizer, with added amino acids, sodium pyruvate, and vitamins, either serum-free or supplemented with an appropriate amount of serum (or plasma) or a defined set of hormones, and/or an amount of cytokine(s) sufficient for the growth and expansion of T cells. In some embodiments, the media comprises X-VIVO-15 media supplemented with 5% human A/B serum, 1% penicillin/streptomycin (pen/strep) and 300 Units/ml of IL-2 (Miltenyi).

    [0425] The T cells are maintained under conditions necessary to support growth, for example, an appropriate temperature (e.g., 37° C.) and atmosphere (e.g., air plus 5% CO2).

    [0426] In some embodiments, the T cells comprising engineered TCRs of the disclosure are autologous. Prior to expansion and genetic modification, a source of T cells is obtained from a subject. Immune cells such as T cells can be obtained from a number of sources, including peripheral blood mononuclear cells, bone marrow, lymph node tissue, cord blood, thymus tissue, tissue from a site of infection, ascites, pleural effusion, spleen tissue, and tumors. In certain embodiments of the present invention, any number of T cell lines available in the art, may be used. In certain embodiments of the present invention, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll™ separation.

    [0427] In some embodiments, cells from the circulating blood of an individual are obtained by apheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In some embodiments, the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In some embodiments, the cells are washed with phosphate buffered saline (PBS). In alternative embodiments, the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. As those of ordinary skill in the art would readily appreciate a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated “flow-through” centrifuge (for example, the Cobe 2991 cell processor, the Baxter CytoMate, or the Haemonetics Cell Saver 5) according to the manufacturer's instructions. After washing, the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca2+-free, Mg2+-free PBS, PlasmaLyte A, or other saline solution with or without buffer. Alternatively, the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.

    [0428] In some embodiments, immune cells such as T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL™ gradient or by counterflow centrifugal elutriation. Specific subpopulations of immune cells, such as T cells, B cells, or CD4+ T cells can be further isolated by positive or negative selection techniques. For example, in one embodiment, T cells are isolated by incubation with anti-CD4-conjugated beads, for a time period sufficient for positive selection of the desired T cells.

    [0429] Enrichment of an immune cell population, such as a T cell population, by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells. One method is cell sorting and/or selection via negative magnetic immune-adherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected. For example, to enrich for CD4+ cells by negative selection, a monoclonal antibody cocktail typically includes antibodies to CD 14, CD20, CD 11b, CD 16, HLA-DR, and CD8.

    [0430] For isolation of a desired population of immune cells by positive or negative selection, the concentration of cells and surface (e.g., particles such as beads) can be varied. In certain embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads.

    [0431] In some embodiments, the cells may be incubated on a rotator for varying lengths of time at varying speeds at either 2-10° C. or at room temperature.

    [0432] T cells for stimulation, or PBMCs from which immune cells such as T cells are isolated, can also be frozen after a washing step. Wishing not to be bound by theory, the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population. After the washing step that removes plasma and platelets, the cells may be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this context, one method involves using PBS containing 20% DMSO and 8% human serum albumin, or culture media containing 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin and 7.5% DMSO, or 31.25% Plasmalyte-A, 31.25% Dextrose 5%, 0.45% NaCl, 10% Dextran 40 and 5% Dextrose, 20% Human Serum Albumin, and 7.5% DMSO or other suitable cell freezing media containing for example, Hespan and PlasmaLyte A, the cells then are frozen to −80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at −20° C. or in liquid nitrogen.

    Pharmaceutical Compositions

    [0433] The disclosure provides pharmaceutical compositions comprising immune cells of the disclosure, and comprising the engineered receptors of the disclosure and a pharmaceutically acceptable diluent, carrier or excipient. In some embodiments, the immune cell comprises an inhibitory receptor comprising a ligand binding domain specific to a class I major histocompatibility complex (MHC-I) molecule, or a peptide-MHC complex thereof, wherein expression and/or function of human leukocyte antigen (HLA) in said immune cell has been reduced or eliminated. In some embodiments, the immune cell comprises an interfering RNA, comprising a sequence complementary to a sequence of a HLA-A*02 mRNA. In some embodiments, the interfering RNA is capable of inducing RNAi-mediated degradation of the HLA-A*02 mRNA. In some embodiments, the interfering RNA is a short hairpin RNA (shRNA) as described herein. In some embodiments, the immune cell further comprises an activator receptor as described herein.

    [0434] Such compositions may comprise buffers such as neutral buffered saline, phosphate buffered saline and the like; carbohydrates such as glucose, mannose, sucrose or dextrans, mannitol; proteins; polypeptides or amino acids such as glycine; antioxidants; chelating agents such as EDTA or glutathione; and preservatives.

    [0435] Provided herein are methods of producing an immune cell with reduced autocrine binding/signaling comprising transducing and/or transfecting the immune cell with a vector described herein. In some embodiments, the method comprises transducing the immune cell with a first vector comprising a sequence encoding an activator receptor and a second vector comprising a sequence encoding an inhibitory receptor, thereby producing an immune cell expressing the activator and inhibitory receptors. In some embodiments, the inhibitory receptor specifically binds to an HLA-A*02 pMHC antigen and the target gene comprises HLA-A*02. In some embodiments, prior to the transducing and/or transfecting steps, the immune cell comprises a polynucleotide or vector encoding interfering RNA targeting a HLA-A*02 mRNA.

    Methods of Treating Disease

    [0436] Provided herein are methods of treating a subject in need thereof, comprising administering to the subject a therapeutically effective amount of a composition comprising immune cells comprising the engineered receptors and having reduced or eliminated expression and/or function of HLA. In some embodiments, the immune cell comprises an interfering RNA (e.g. an shRNA), polynucleotide, vector, fusion protein, engineered receptor (e.g. an inhibitory receptor) of the disclosure.

    [0437] In some embodiments, the method of treating a subject in need thereof comprises providing immune cells from a subject suffering from or at risk for cancer or a hematological malignancy; transducing the immune cell with the vectors described herein; and administering the immune cell to the subject.

    [0438] Provided herein are methods of manufacturing a composition comprising immune cells with reduced autocrine binding/signaling comprising providing immune cells from a subject suffering from or at risk for cancer or a hematological malignancy; and transducing or transfecting the immune cell with one or more vectors described herein. In some embodiments, the vector encodes an interfering RNA targeting HLA-A*02 mRNA. In some embodiments, the vector encodes an engineered receptor (e.g. an inhibitory receptor that specifically binds to HLA-A*02 pMHC antigen and the target gene comprises HLA-A*02. In some embodiments, prior to the transducing and/or transfecting steps, the immune cell comprises a polynucleotide encoding activator and/or inhibitory receptors. In some embodiments, the method comprises transducing the immune cell with a first vector comprising a sequence encoding the activator receptor and a second vector comprising a sequence encoding the inhibitory receptor, thereby producing an immune cell expressing the activator and inhibitory receptors.

    [0439] The current method for adoptive cell therapy using autologous cells includes isolating immune cells from patient blood, performing a series of modifications on the isolated cells, and administering the cells to a patient (Papathanasiou et al. Cancer Gene Therapy. 27:799-809 (2020)). Providing immune cells from a subject suffering from or at risk for cancer or a hematological malignancy requires isolation of immune cell from the patient's blood, and can be accomplished through methods known in the art, for example, by leukapheresis. During leukapheresis, blood from a subject is extracted and the peripheral blood mononuclear cells (PBMCs) are separated, and the remainder of the blood is returned to the subject's circulation. The PBMCs are stored either frozen or cryopreserved as a sample of immune cells and provided for further processing steps, such as, e.g. the modifications described herein.

    [0440] In some embodiments, the method of treating a subject described herein comprises modifications to immune cells from the subject comprising a series of modifications comprising enrichment, activation, genetic modification, expansion, formulation, and cryopreservation.

    [0441] The disclosure provides enrichment steps that can be, for example, washing and fractionating methods known in the art for preparation of subject PBMCs for downstream procedures, e.g. the modifications described herein. For example, without limitation, methods can include devices to remove gross red blood cells and platelet contaminants, systems for size-based cell fractionation for the depletion of monocytes and the isolation of lymphocytes, and/or systems that allow the enrichment of specific subsets of T cells, such as, e.g. CD4+, CD8+, CD25+, or CD62L+ T cells. Following the enrichment steps, a target sub-population of immune cells will be isolated from the subject PMBCs for further processing. Those skilled in the art will appreciate that enrichment steps, as provided herein, may also encompass any newly discovered method, device, reagent or combination thereof.

    [0442] The disclosure provides activation steps that can be any method known in the art to induce activation of immune cells, e.g. T cells, required for their ex vivo expansion. Immune cell activation can be achieved, for example, by culturing the subject immune cells in the presence of dendritic cells, culturing the subject immune cells in the presence of artificial antigen-presenting cells (AAPCs), or culturing the immune cells in the presence of irradiated K562-derived AAPCs. Other methods for activating subject immune cells can be, for example, culturing the immune cells in the presence of isolated activating factors and compositions, e.g. beads, surfaces, or particles functionalized with activating factors. Activating factors can include, for example, antibodies, e.g. anti-CD3 and/or anti-CD28 antibodies. Activating factors can also be, for example, cytokines, e.g. interleukin (IL)-2 or IL-21. Activating factors can also be costimulatory molecules, such as, for example, CD40, CD40L, CD70, CD80, CD83, CD86, CD137L, ICOSL, GITRL, and CD134L. Those skilled in the art will appreciate that activating factors, as provided herein, may also encompass any newly discovered activating factor, reagent, composition, or combination thereof that can activate immune cells.

    [0443] The disclosure provides expansion steps for the immune cells described herein. Immune cells can be expanded in any immune cell expansion system known in the art to generate therapeutic doses of immune cells for administration. For example, bioreactor bags for use in a system comprising controller pumps, and probes that allow for automatic feeding and waste removal can be used for immune cell expansion. Cell culture flasks with gas-permeable membranes at the base may be used for immune cell expansion. Any such system known in the art that enables expansion of immune cells for clinical use is encompassed by the expansion step provided herein. Immune cells are expanded in culture systems in media formulated specifically for expansion. Expansion can also be facilitated by culturing the immune cell of the disclosure in the presence of activation factors as described herein. Those skilled in the art will appreciate that expansion steps, as provided herein, may also encompass any newly discovered culture systems, media, or activating factors that can be used to expand immune cells.

    [0444] The disclosure provides formulation and cryopreservation steps for the expanded immune cells. Formulation steps provided include, for example, washing away excess components used in the preparation and expansion of immune cells of the methods of treatment described herein. Any pharmaceutically acceptable formulation medium or wash buffer compatible with immune cell known in the art may be used to wash, dilute/concentration immune cells, and prepare doses for administration. Formulation medium can be acceptable for administration of the immune cells, such as, for example crystalloid solutions for intravenous infusion. Cryopreservation can optionally be used to store immune cells long-term. Cryopreservation can be achieved using known methods in the art, including for example, storing cells in a cryopreservation medium containing cryopreservation components. Cryopreservation components can include, for example, dimethyl sulfoxide or glycerol. Immune cells stored in cryopreservation medium can be cryopreserved by reducing the storage temperature to −80° C. to −180° C.

    [0445] In some embodiments, the method comprises administering immune cells described herein. In some embodiments, the method comprises administering a conditioning regimen prior to administering the immune cells described herein. In some embodiments, the conditioning regimen is lymphodepletion. A lymphodepletion regimen can include, for example, administration of alemtuzumab, cyclophosphamide, benduamustin, rituximab, pentostatin, and/or fludarabine. Lymphodepletion regimen can be administered in one or more cycles until the desired outcome of reduced circulating immune cells.

    [0446] In some embodiments, the conditioning regimen comprises administering an agent that specifically targets, and reduces or eliminates CD52+ cells in the subject, and the immune cells are modified to reduce or eliminate CD52 expression.

    [0447] In some embodiments, the method of treatment comprises determining the HLA germline type of the subject. In some embodiments, determining the HLA germline type comprises determining the presence of HLA-A*02:01 heterozygosity. In some embodiments, the HLA germline type is determined in bone marrow.

    [0448] In some embodiments, the method of treatment comprises determining the level of expression of an activator ligand. In some embodiments, the level of expression of an activator ligand is determined in tumor tissue samples from the subject. In some embodiments, the expression level of an activator ligand is determined using next generation sequencing. In some embodiments, the expression level of an activator ligand is determined using RNA sequencing. In some embodiments, the level of an activator ligand is determined using immunohistochemistry.

    [0449] In some embodiments, the method of treatment comprises administering a therapeutically effective dose of immune cells in a subject in need thereof, wherein the subject is determined to be HLA germline HLA-A*02:01 heterozygous and have tumor tissue with activator expression and loss of HLA-A*02:01.

    [0450] In some embodiments, a therapeutically effective dose of the immune cells described herein are administered. In some embodiments, the immune cells of the disclosure are administered by intravenous injection. In some embodiments, the immune cells of the disclosure are administered by intraperitoneal injection. In some embodiments, a therapeutically effective dose comprises about 0.5×10.sup.6 cells, about 1×10.sup.6 cells, about 2×10.sup.6 cells, about 3×10.sup.6 cells, 4×10.sup.6 cells, about 5×10.sup.6 cells, about 6×10.sup.6 cells, about 7×10.sup.6 cells, about 8×10.sup.6 cells, about 9×10.sup.6 cells, about 1×10.sup.7, about 2×10.sup.7, about 3×10.sup.7, about 4×10.sup.7, about 5×10.sup.7, about 6×10.sup.7, about 7×10.sup.7, about 8×10.sup.7, about 9×10.sup.7, 1×10.sup.8 cells, about 2×10.sup.8 cells, about 3×10.sup.8 cells, about 4×10.sup.8 cells, about 5×10.sup.8 cells, or about 6×10.sup.8 cells. In some embodiments, a therapeutically effective dose comprises about 0.5×10.sup.6 cells to about 6×10.sup.8 cells, about 1×10.sup.6 cells to about 5×10.sup.8 cells, about 2×10.sup.6 cells to about 5×10.sup.6 cells, about 3×10.sup.6 cells to about 4×10.sup.8 cells, about 4×10.sup.6 cells to about 3×10.sup.8 cells, about 5×10.sup.6 cells to about 2×10.sup.8 cells, about 6×10.sup.6 cells to about 1×10.sup.8 cells, about 7×10.sup.6 cells to about 9×10.sup.7 cells, about 8×10.sup.6 cells to about 8×10.sup.7 cells, about 9×10.sup.6 cells to about 7×10.sup.7 cells, about 1×10.sup.7 cells to about 6×10.sup.7 cells, or about 2×10.sup.7 cells to about 5×10.sup.7 cells. In some embodiments, a therapeutically effective dose comprises about 0.5×10.sup.6 cells to about 6×10.sup.8 cells. The term “about” as referred to in a therapeutically dose, can be, for example, ±0.5×10.sup.6 cells, 0.5×10.sup.7 cells, or 0.5×10.sup.8 cells.

    [0451] In some embodiments, the subject in need thereof has cancer. Cancer is a disease in which abnormal cells divide without control and spread to nearby tissue. In some embodiments, the cancer comprises a liquid tumor or a solid tumor. Exemplary liquid tumors include leukemias and lymphomas. Further cancers that are liquid tumors can be those that occur, for example, in blood, bone marrow, and lymph nodes, and can include, for example, leukemia, myeloid leukemia, lymphocytic leukemia, lymphoma, Hodgkin's lymphoma, melanoma, and multiple myeloma. Leukemias include, for example, acute lymphoblastic leukemia (ALL), acute myeloid leukemia (AML), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), and hairy cell leukemia. Exemplary solid tumors include sarcomas and carcinomas. Cancers can arise in virtually an organ in the body, including blood, bone marrow, lung, breast, colon, bone, central nervous system, pancreas, prostate and ovary. Further cancers that are solid tumors include, for example, prostate cancer, testicular cancer, breast cancer, brain cancer, pancreatic cancer, colon cancer, thyroid cancer, stomach cancer, lung cancer, ovarian cancer, Kaposi's sarcoma, skin cancer, squamous cell skin cancer, renal cancer, head and neck cancers, throat cancer, squamous carcinomas that form on the moist mucosal linings of the nose, mouth, throat, bladder cancer, osteosarcoma, cervical cancer, endometrial cancer, esophageal cancer, liver cancer, and kidney cancer. In some embodiments, the condition treated by the methods described herein is metastasis of melanoma cells, prostate cancer cells, testicular cancer cells, breast cancer cells, brain cancer cells, pancreatic cancer cells, colon cancer cells, thyroid cancer cells, stomach cancer cells, lung cancer cells, ovarian cancer cells, Kaposi's sarcoma cells, skin cancer cells, renal cancer cells, head or neck cancer cells, throat cancer cells, squamous carcinoma cells, bladder cancer cells, osteosarcoma cells, cervical cancer cells, endometrial cancer cells, esophageal cancer cells, liver cancer cells, or kidney cancer cells.

    [0452] Any cancer wherein a plurality of the cancer cells express the first, activator ligand and do not express the second, inhibitor ligand is envisaged as within the scope of the instant disclosure. For example, CEA positive cancers that can be treated using the methods described herein include colorectal cancer, pancreatic cancer, esophageal cancer, gastric cancer, lung adenocarcinoma, head and neck cancer, diffuse large B cell cancer or acute myeloid leukemia cancer.

    [0453] Treating cancer can result in a reduction in size of a tumor. A reduction in size of a tumor may also be referred to as “tumor regression”. Preferably, after treatment, tumor size is reduced by 5% or greater relative to its size prior to treatment; more preferably, tumor size is reduced by 10% or greater; more preferably, reduced by 20% or greater; more preferably, reduced by 30% or greater; more preferably, reduced by 40% or greater; even more preferably, reduced by 50% or greater; and most preferably, reduced by greater than 75% or greater. Size of a tumor may be measured by any reproducible means of measurement. The size of a tumor may be measured as a diameter of the tumor.

    [0454] Treating cancer can result in a reduction in tumor volume. Preferably, after treatment, tumor volume is reduced by 5% or greater relative to its size prior to treatment; more preferably, tumor volume is reduced by 10% or greater; more preferably, reduced by 20% or greater; more preferably, reduced by 30% or greater; more preferably, reduced by 40% or greater; even more preferably, reduced by 50% or greater; and most preferably, reduced by greater than 75% or greater. Tumor volume may be measured by any reproducible means of measurement.

    [0455] Treating cancer results in a decrease in number of tumors. Preferably, after treatment, tumor number is reduced by 5% or greater relative to number prior to treatment; more preferably, tumor number is reduced by 10% or greater; more preferably, reduced by 20% or greater; more preferably, reduced by 30% or greater; more preferably, reduced by 40% or greater; even more preferably, reduced by 50% or greater; and most preferably, reduced by greater than 75%. Number of tumors may be measured by any reproducible means of measurement. The number of tumors may be measured by counting tumors visible to the naked eye or at a specified magnification. Preferably, the specified magnification is 2×, 3×, 4×, 5×, 10×, or 50×.

    [0456] Treating cancer can result in a decrease in number of metastatic lesions in other tissues or organs distant from the primary tumor site. Preferably, after treatment, the number of metastatic lesions is reduced by 5% or greater relative to number prior to treatment; more preferably, the number of metastatic lesions is reduced by 10% or greater; more preferably, reduced by 20% or greater; more preferably, reduced by 30% or greater; more preferably, reduced by 40% or greater; even more preferably, reduced by 50% or greater; and most preferably, reduced by greater than 75%. The number of metastatic lesions may be measured by any reproducible means of measurement. The number of metastatic lesions may be measured by counting metastatic lesions visible to the naked eye or at a specified magnification. Preferably, the specified magnification is 2×, 3×, 4×, 5×, 10×, or 50×.

    [0457] Treating cancer can result in an increase in average survival time of a population of treated subjects in comparison to a population receiving carrier alone. Preferably, the average survival time is increased by more than 30 days; more preferably, by more than 60 days; more preferably, by more than 90 days; and most preferably, by more than 120 days. An increase in average survival time of a population may be measured by any reproducible means. An increase in average survival time of a population may be measured, for example, by calculating for a population the average length of survival following initiation of treatment with an active compound. An increase in average survival time of a population may also be measured, for example, by calculating for a population the average length of survival following completion of a first round of treatment with an active compound.

    [0458] Treating cancer can result in an increase in average survival time of a population of treated subjects in comparison to a population of untreated subjects. Preferably, the average survival time is increased by more than 30 days; more preferably, by more than 60 days; more preferably, by more than 90 days; and most preferably, by more than 120 days. An increase in average survival time of a population may be measured by any reproducible means. An increase in average survival time of a population may be measured, for example, by calculating for a population the average length of survival following initiation of treatment with an active compound. An increase in average survival time of a population may also be measured, for example, by calculating for a population the average length of survival following completion of a first round of treatment with an active compound.

    [0459] Treating cancer can result in increase in average survival time of a population of treated subjects in comparison to a population receiving monotherapy with a drug that is not a compound of the present invention, or a pharmaceutically acceptable salt, prodrug, metabolite, analog or derivative thereof. Preferably, the average survival time is increased by more than 30 days; more preferably, by more than 60 days; more preferably, by more than 90 days; and most preferably, by more than 120 days. An increase in average survival time of a population may be measured by any reproducible means. An increase in average survival time of a population may be measured, for example, by calculating for a population the average length of survival following initiation of treatment with an active compound. An increase in average survival time of a population may also be measured, for example, by calculating for a population the average length of survival following completion of a first round of treatment with an active compound.

    [0460] Treating cancer can result in a decrease in the mortality rate of a population of treated subjects in comparison to a population receiving carrier alone. Treating cancer can result in a decrease in the mortality rate of a population of treated subjects in comparison to an untreated population. Treating cancer can result in a decrease in the mortality rate of a population of treated subjects in comparison to a population receiving monotherapy with a drug that is not a compound of the present invention, or a pharmaceutically acceptable salt, prodrug, metabolite, analog or derivative thereof. Preferably, the mortality rate is decreased by more than 2%; more preferably, by more than 5%; more preferably, by more than 10%; and most preferably, by more than 25%. A decrease in the mortality rate of a population of treated subjects may be measured by any reproducible means. A decrease in the mortality rate of a population may be measured, for example, by calculating for a population the average number of disease-related deaths per unit time following initiation of treatment with an active compound. A decrease in the mortality rate of a population may also be measured, for example, by calculating for a population the average number of disease-related deaths per unit time following completion of a first round of treatment with an active compound.

    [0461] Treating cancer can result in a decrease in tumor growth rate. Preferably, after treatment, tumor growth rate is reduced by at least 5% relative to number prior to treatment; more preferably, tumor growth rate is reduced by at least 10%; more preferably, reduced by at least 20%; more preferably, reduced by at least 30%; more preferably, reduced by at least 40%; more preferably, reduced by at least 50%; even more preferably, reduced by at least 50%; and most preferably, reduced by at least 75%. Tumor growth rate may be measured by any reproducible means of measurement. Tumor growth rate can be measured according to a change in tumor diameter per unit time.

    [0462] Treating cancer can result in a decrease in tumor regrowth. Preferably, after treatment, tumor regrowth is less than 5%; more preferably, tumor regrowth is less than 10%; more preferably, less than 20%; more preferably, less than 30%; more preferably, less than 40%; more preferably, less than 50%; even more preferably, less than 50%; and most preferably, less than 75%. Tumor regrowth may be measured by any reproducible means of measurement. Tumor regrowth is measured, for example, by measuring an increase in the diameter of a tumor after a prior tumor shrinkage that followed treatment. A decrease in tumor regrowth is indicated by failure of tumors to reoccur after treatment has stopped.

    [0463] Treating or preventing a cell proliferative disorder can result in a reduction in the rate of cellular proliferation. Preferably, after treatment, the rate of cellular proliferation is reduced by at least 5%; more preferably, by at least 10%; more preferably, by at least 20%; more preferably, by at least 30%; more preferably, by at least 40%; more preferably, by at least 50%; even more preferably, by at least 50%; and most preferably, by at least 75%. The rate of cellular proliferation may be measured by any reproducible means of measurement. The rate of cellular proliferation is measured, for example, by measuring the number of dividing cells in a tissue sample per unit time.

    [0464] Treating or preventing a cell proliferative disorder can result in a reduction in the proportion of proliferating cells. Preferably, after treatment, the proportion of proliferating cells is reduced by at least 5%; more preferably, by at least 10%; more preferably, by at least 20%; more preferably, by at least 30%; more preferably, by at least 40%; more preferably, by at least 50%; even more preferably, by at least 50%; and most preferably, by at least 75%. The proportion of proliferating cells may be measured by any reproducible means of measurement. Preferably, the proportion of proliferating cells is measured, for example, by quantifying the number of dividing cells relative to the number of nondividing cells in a tissue sample. The proportion of proliferating cells can be equivalent to the mitotic index.

    [0465] Treating or preventing a cell proliferative disorder can result in a decrease in size of an area or zone of cellular proliferation. Preferably, after treatment, size of an area or zone of cellular proliferation is reduced by at least 5% relative to its size prior to treatment; more preferably, reduced by at least 10%; more preferably, reduced by at least 20%; more preferably, reduced by at least 30%; more preferably, reduced by at least 40%; more preferably, reduced by at least 50%; even more preferably, reduced by at least 50%; and most preferably, reduced by at least 75%. Size of an area or zone of cellular proliferation may be measured by any reproducible means of measurement. The size of an area or zone of cellular proliferation may be measured as a diameter or width of an area or zone of cellular proliferation.

    [0466] Treating or preventing a cell proliferative disorder can result in a decrease in the number or proportion of cells having an abnormal appearance or morphology. Preferably, after treatment, the number of cells having an abnormal morphology is reduced by at least 5% relative to its size prior to treatment; more preferably, reduced by at least 10%; more preferably, reduced by at least 20%; more preferably, reduced by at least 30%; more preferably, reduced by at least 40%; more preferably, reduced by at least 50%; even more preferably, reduced by at least 50%; and most preferably, reduced by at least 75%. An abnormal cellular appearance or morphology may be measured by any reproducible means of measurement. An abnormal cellular morphology can be measured by microscopy, e.g., using an inverted tissue culture microscope. An abnormal cellular morphology can take the form of nuclear pleomorphism.

    Kits and Articles of Manufacture

    [0467] The disclosure provides kits and articles of manufacture comprising the polynucleotides and vectors encoding the interfering RNAs and engineered receptors described herein, and immune cells with reduced or eliminated HLA expression and/or function described herein and comprising the engineered receptors described herein. In some embodiments, the kit comprises articles such as vials, syringes and instructions for use.

    [0468] In some embodiments, the kit comprises a polynucleotide or vector comprising a sequence encoding the interfering RNAs and/or one or more engineered receptors of the disclosure.

    [0469] In some embodiments, the kit comprises a plurality of immune cells comprising an interfering RNA and/or engineered receptor as described herein. In some embodiments, the plurality of immune cells comprises a plurality of T cells.

    EXAMPLES

    Example 1: Selection of Interfering RNA Sequences Targeting the HLA Gene

    [0470] In order to select guide nucleic acids for targeting the HLA-A*02:01:01:01 mRNA, all possible 18 bp, 19 bp, 20 bp, 21 bp, and 22 bp transcribed sequences corresponding to HLA-A*02:01:01:01 mRNA were determined, yielding 8397 sequences. From this set of potential target sequences, those containing GC content less than 25% or greater than or equal to 60% were excluded, resulting in 3586 potential target sequences. From this set of potential target sequences, those with runs of 4 or more of the same base in a row or a run of 7 C or G bases in a row were removed, resulting in 3101 potential target sequences. Next, the sequences were analyzed by identifying favorable characteristics identified by computational tools, such as the GPP RNAi Designer (Broad Institute), and similar favorable characteristics. The final set of potential targets included 278 sequences that can be used to design interfering RNAs that target the HLA-A*02:01:01:01 mRNA transcript for degradation through RNA interference. Illustrative alignments between shRNAs with a complementary sequence to the identified targets of the analysis are shown in FIG. 5.

    Example 2: shRNA-Mediated Reduction of HLA-A*02 Cell Surface Expression

    [0471] The effect of shRNA targeting the coding sequence (CDS) of the HLA-A*02:01:01:01 mRNA transcript on HLA-A*02 surface protein expression was assessed.

    [0472] Jurkat cells expressing HLA-A*02 were transfected using 100 uL format Neon electroporation system (Thermo Fisher) according to manufacturer's protocol using the following settings: 3 pulses, 1500V, 10 msec. Co-transfections were performed with 200 ng of U6-shRNA plasmids and 200 ng of plasmid expressing EGFR as a transfection marker per 1 million cells. Transfected cells were recovered in RPMI media supplemented with 20% heat-inactivated FBS and 0.1% Pen/Strep.

    [0473] 4 days following transfection, cells were stained for HLA-A*02 expression with BB7.2 antibody (Biolegend) and anti-EGFR antibody (Biolegend) for 30 minutes at 4° C. to assess knockdown efficiency.

    [0474] The results are shown in FIG. 6. The histograms show staining for either HLA-A*02, and corresponding quantification as % expression in control cells. The results indicate that several of the shRNA candidates were able to reduce expression of HLA-A*02 by over 50% compared to control cells. In particular, shRNA-12 showed a substantial decrease exceeding 90% knockdown compared to control cells.

    [0475] These results indicate the identified shRNA targeting the CDS of the HLA-A*02:01:01:01 mRNA transcript reduces expression of HLA-A*02 surface protein in immune cells.

    Example 3: shRNA-Mediated Reduction of HLA Class I Cell Surface Expression

    [0476] The effect of shRNA targeting the 5′ or 3′ untranslated region (UTR) of the HLA-A*02:01:01:01 mRNA transcript on HLA Class I surface protein expression was assessed.

    [0477] Jurkat cells were transfected using 100 uL format Neon electroporation system (Thermo Fisher) according to manufacturer's protocol using the following settings: 3 pulses, 1500V, 10 msec. Co-transfections were performed with 1 μg of U6-shRNA plasmids and 100 ng of plasmid expressing green fluorescent protein (GFP) as a transfection marker per 1 million cells. Transfected cells were recovered in RPMI media supplemented with 20% heat-inactivated FBS and 0.1% Pen/Strep.

    [0478] 4 days following transfection, cells were stained for HLA Class I expression with W6/32 antibody (BD Biosciences) for 30 minutes at 4° C. to assess knockdown efficiency.

    [0479] The results are shown in FIG. 7. The histograms show staining for HLA Class I expression. The results indicate that several of the shRNA candidates were able to reduce expression of HLA Class I compared to control cells. In particular, shRNA-35 and shRNA-63 showed a substantial decrease exceeding 90% knockdown compared to control cells.

    [0480] These results indicate the identified shRNA targeting the UTRs of the HLA-A*02:01:01:01 mRNA transcript reduce expression of HLA Class I surface protein in immune cells.

    Example 4: shRNA-Mediated Reduction of HLA-A*02 Expression Increases Blocker Receptor Availability and Restores Blocker Receptor Function in HLA-A*02 Positive Jurkat Cells

    [0481] The effect of shRNA targeting the CDS of HLA-A*02:01:01:01 mRNA on the expression on blocker ligand binding receptors was determined in Jurkat cells expressing HLA-A*02. (FIG. 8).

    [0482] Jurkat cells that either express HLA-A*02 (A2+ Jurkat) or do not express HLA-A*02 (A2-Jurkat) were transfected using 100 uL format Neon electroporation system (Thermo Fisher) according to manufacturer's protocol using the following settings: 3 pulses, 1500V, 10 msec. Co-transfections were performed with 2 ug plasmids encoding activator and inhibitory receptors, and 2 ug of either U6-shRNA/A*02-blocker or A*02-blocker alone per million cells. Transfected cells were recovered in RPMI media supplemented with 20% heat-inactivated FBS and 0.1% Pen/Strep.

    [0483] 2 days following transfection, 10.sup.4 jurkat cells were co-cultured with 1.2×10.sup.4 HeLa target cells and incubated in Corning® 384-well Low Flange White Flat Bottom Polystyrene TC-treated Microplates for 6 hours. ONE-Step Luciferase Assay System (BPS Bioscience) was used to evaluate Jurkat luminescence. To evaluate blocker availability to bind HLA-A*02 antigen, Jurkat cells were stained with 10 ug/mL streptavidin-PE-HLA-A*02-pMHC or streptavidin-APC-HLA-A*02-pMHC tetramer for 30 minutes at 4° C. in PBS with 1% BSA and characterized by flow cytometry (BD FACSCanto II). Histograms show all cells.

    [0484] Results are shown in FIG. 8. In A2+ Jurkat effector cells in the absence of shRNA targeting the CDS of HLA-A*02:01:01:01 mRNA, activation of the CAR/TCR receptor occurred in the presence of target cells expressing the activator ligand and the HLA-A*02 blocker ligand, as well as in the presence of target cells expressing the activator ligand only. In contrast, A2− Jurkat effector cells showed significantly less CAR/TCR activation in the presence of target cells expressing the activator ligand and the HLA-A*02 blocker ligand. The A*02 blocker functions to inhibit T cell activation, which was observed in A2− Jurkat effector cells co-cultured with target cells expressing HLA-A*02 but not in A2+ Jurkat effector cells co-cultured with target cells expression HLA-A*02. This result indicates that expression of HLA-A*02 in Jurkat effector cells expressing an activator CAR/TCR and A*02 blocker interferes with A*02 inhibitory receptor function. In A2+ Jurkat effector cells transfected with shRNA targeting the CDS of HLA-A*02:01:01:01 mRNA, CAR/TCR activation was inhibited in the presence of target cells expressing the HLA-A*02 blocker ligand, but not in the presence of target cells lacking expression of the HLA-A*02 blocker ligand. This result indicates that shRNA targeting the CDS of HLA-A*02:01:01:01 mRNA can restore A*02 blocker function in the A2+ Jurkat cells.

    [0485] In Jurkat cells stained with the fluorescently labeled probe that binds the A*02 blocker, FACS analysis shows the availability, or binding capacity, of the A*02 blocker receptor (inhibitory receptor). In A2− Jurkat cells, histograms from the FACS analysis shows staining of a subset of cells, indicating availability of the A*02 blocker receptor. In contrast, in A2+ Jurkat cells, there is a shift in the histogram, showing the population of cells has little to no A*02 blocker receptor availability and another ill-defined population with incomplete A*02 blocker receptor availability. However, transfection in A2+ Jurkat cells transfected with shRNA targeting the CDS of HLA-A*02:01:01:01 mRNA, the histogram is shifted and resembles the A2-population, indicating near complete availability of the A*02 blocker receptor.

    [0486] Taken together, the results of these experiments show that in Jurkat cells expressing 1) a CAR or TCR that binds an activator ligand and 2) an engineered receptor that binds an HLA-A*02 blocker ligand (A*02 blocker), expression of HLA-A*02 interferes with A*02 blocker receptor function and A*02 blocker binding capacity. Further, the results show that shRNA mediated reduction of HLA-A*02 expression restores A*02 blocker function and binding capacity.