Treatment for multiple myeloma (MM)

Abstract

The present disclosure relates to the treatment of multiple myeloma. Monoclonal antibody MOR202 is efficacious when administered to patient at certain dosage regimens.

Claims

1. A method for treatment of multiple myeloma, said method comprising administering to a human patient in need dexamethasone and an antibody specific for CD38, said antibody comprising a variable heavy domain encoded by SEQ ID NO:11 and a variable light domain encoded by SEQ ID NO:12, wherein said antibody is administered at a dose of 16 mg/kg once weekly to significantly improve overall response of the human patient over human patients receiving 4 or 8 mg/kg once weekly or once every other week of said antibody in combination with dexamethasone.

2. The method according to claim 1, wherein said antibody is administered once weekly (q1w) over at least eight weeks.

3. The method according to claim 1, wherein said antibody is administered intravenously.

4. The method according to claim 1, wherein said antibody is administered intravenously over a period of two hours.

5. The method according to claim 1, wherein said antibody comprises an IgG1 Fc region.

6. The method according to claim 1, wherein the dexamethasone is dosed at 20 mg or 40 mg once weekly (q1W).

7. The method of claim 1 wherein the patient has relapsed/refractory multiple myeloma in humans.

Description

FIGURE LEGENDS

(1) FIG. 1 shows the amino acid sequence of the variable domains of antibody MOR202.

(2) FIG. 2 shows the best responses and time on treatment for patients from cohorts 5-8 receiving at least 1 treatment cycle.

(3) FIG. 3 shows the best change in M protein for patients from cohorts 5-8 receiving at least 1 treatment cycle.

(4) FIG. 4 shows the MOR202 dose vs. overall response results in the clinical trial of MOR03087 (MOR202) in adult subjects with relapsed/refractory multiple myeloma.

(5) FIG. 5 shows the trough levels of MOR202 according to best response in the clinical trial of MOR03087 (MOR202) in adult subjects with relapsed/refractory multiple myeloma.

(6) FIG. 6 shows any infusion-related reactions in the clinical trial of MOR03087 (MOR202) in adult subjects with relapsed/refractory multiple myeloma.

(7) FIGS. 7A, 7B, 7C, and 7D show MOR202 serum concentrations over time in the clinical trial of MOR03087 (MOR202) in adult subjects with relapsed/refractory multiple myeloma.

(8) FIG. 8 shows the mean trough levels of MOR202 resulting from certain dosing regimens in the clinical trial of MOR03087 (MOR202) in adult subjects with relapsed/refractory multiple myeloma.

DETAILED DESCRIPTION OF THE INVENTION

(9) The term “antibody” means monoclonal antibodies, including any isotype, such as, IgG, IgM, IgA, IgD and IgE. An IgG antibody is comprised of two identical heavy chains and two identical light chains that are joined by disulfide bonds. Each heavy and light chain contains a constant region and a variable region. Each variable region contains three segments called “complementarity-determining regions” (“CDRs”) or “hypervariable regions”, which are primarily responsible for binding an epitope of an antigen. They are referred to as CDR1, CDR2, and CDR3, numbered sequentially from the N-terminus. The more highly conserved portions of the variable regions outside of the CDRs are called the “framework regions”. An “antibody fragment” means an Fv, scFv, dsFv, Fab, Fab′ F(ab′)2 fragment, or other fragment, which contains at least one variable heavy or variable light chain, each containing CDRs and framework regions.

(10) “VH” refers to the variable region of an immunoglobulin heavy chain of an antibody, or antibody fragment. “VL” refers to the variable region of the immunoglobulin light chain of an antibody, or antibody fragment.

(11) The “CDRs” herein are defined by either Chothia et al or Kabat et al. See Chothia C, Lesk A M. (1987) Canonical structures for the hypervariable regions of immunoglobulins. J Mol Biol., 196(4):901-17, which is incorporated by reference in its entirety. See Kabat E. A, Wu T. T., Perry H. M., Gottesman K. S. and Foeller C. (1991). Sequences of Proteins of Immunological Interest. 5th edit., NIH Publication no. 91-3242, US Dept. of Health and Human Services, Washington, D.C.

(12) The term “CD38” refers to the protein known as CD38, having the following synonyms: ADP-ribosyl cyclase 1, cADPr hydrolase 1, Cyclic ADP-ribose hydrolase 1, T10.

(13) Human CD38 has the amino acid sequence of:

(14) TABLE-US-00001 (SEQ ID NO: 10) MANCEFSPVSGDKPCCRLSRRAQLCLGVSILVLILVVVLAVVVPRWRQQW SGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCN ITEEDYQPLMKLGTQTVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLL GYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAA CDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDS RDLCQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSE I.

(15) “MOR202” an anti-CD38 antibody whose amino acid sequence is provided in FIG. 1. MOR202 is disclosed in U.S. Pat. No. 8,088,896, which is incorporated by reference in its entirety. “MOR202” and “MOR03087” are used as synonyms to describe the antibody shown in FIG. 1.

(16) The DNA sequence encoding the MOR202 Variable Heavy Domain is:

(17) TABLE-US-00002 (SEQ ID NO: 11) CAGGTGCAATTGGTGGAAAGCGGCGGCGGCCTGGTGCAACCGGGCGGCAG CCTGCGTCTGAGCTGCGCGGCCTCCGGATTTACCTTTTCTTCTTATTATA TGAATTGGGTGCGCCAAGCCCCTGGGAAGGGTCTCGAGTGGGTGAGCGGT ATCTCTGGTGATCCTAGCAATACCTATTATGCGGATAGCGTGAAAGGCCG TTTTACCATTTCACGTGATAATTCGAAAAACACCCTGTATCTGCAAATGA ACAGCCTGCGTGCGGAAGATACGGCCGTGTATTATTGCGCGCGTGATCTT CCTCTTGTTTATACTGGTTTTGCTTATTGGGGCCAAGGCACCCTGGTGAC GGTTAGCTCA.

(18) The DNA sequence encoding the MOR202 Variable Light Domain is:

(19) TABLE-US-00003 (SEQ ID NO: 12) GATATCGAACTGACCCAGCCGCCTTCAGTGAGCGTTGCACCAGGTCAGAC CGCGCGTATCTCGTGTAGCGGCGATAATCTTCGTCATTATTATGTTTATT GGTACCAGCAGAAACCCGGGCAGGCGCCAGTTCTTGTGATTTATGGTGAT TCTAAGCGTCCCTCAGGCATCCCGGAACGCTTTAGCGGATCCAACAGCGG CAACACCGCGACCCTGACCATTAGCGGCACTCAGGCGGAAGACGAAGCGG ATTATTATTGCCAGACTTATACTGGTGGTGCTTCTCTTGTGTTTGGCGGC GGCACGAAGTTAACCGTTCTTGGCCAG.

(20) MOR202 has an IgG1 Fc region.

(21) A pharmaceutical composition includes an active agent, e.g. an antibody for therapeutic use in humans. A pharmaceutical composition may additionally include pharmaceutically acceptable carriers or excipients.

(22) “Multiple myeloma” is also known as plasma cell myeloma, myelomatosis, or Kahler's disease (after Otto Kahler), and is a cancer of plasma cells, a type of white blood cell normally responsible for producing antibodies. In multiple myeloma, collections of abnormal plasma cells accumulate in the bone marrow, where they interfere with the production of normal blood cells. Most cases of multiple myeloma also feature the production of a paraprotein an abnormal antibody which can cause kidney problems. Bone lesions and hypercalcemia (high blood calcium levels) are also often encountered.

(23) Multiple myeloma is diagnosed with blood tests (serum protein electrophoresis, serum free kappa/lambda light chain assay), bone marrow examination, urine protein electrophoresis, and X-rays of commonly involved bones.

(24) M protein or myeloma protein is an abnormal immunoglobulin fragment or immunoglobulin light chain that is produced in excess by an abnormal clonal proliferation of plasma cells, typically in multiple myeloma.

(25) “Administered” or “administration” refers to the delivery of a pharmaceutical composition by an injectable form, such as, for example, an intravenous, intramuscular, intradermal or subcutaneous route or mucosal route, for example, as a nasal spray or aerosol for inhalation or as an ingestable solution, capsule or tablet.

(26) The antibody which is administered according to the present disclosure is administered to the patient in a therapeutically effective amount. A “therapeutically effective amount” refers to an amount sufficient to cure, alleviate or partially arrest the clinical manifestations of a given disease or disorder, i.e. MM, and its complications.

(27) Mg/kg means milligram antibody per kilogram body weight.

(28) “Cmax” refers to the highest plasma concentration of the antibody observed within the sampling interval.

(29) “AUC” or “area under the curve” refers to the area under the plasma concentration-time curve, as calculated by the trapezoidal rule over the complete sample collection interval.

(30) The drug dose that leads to a therapeutically effect can also be described in terms of the total exposure to a patient measured by area under the curve.

(31) The amount that is effective for a particular therapeutic purpose will depend on the severity of the disease or injury as well as on the weight and general state of the subject. It will be understood that determination of an appropriate dosage may be achieved, using routine experimentation, by constructing a matrix of values and testing different points in the matrix, all of which is within the ordinary skills of a trained physician or clinical scientist.

(32) The antibody of the present disclosure can be administered at different time points and the treatment cycle may have a different length. The antibodies may be administered daily, every other day, three times a week, weekly or biweekly. The antibodies may also be administered over at least four weeks, over at least five weeks, over at least six weeks, over at least seven weeks, over at least eight weeks, over at least nine weeks, over at least ten weeks, over at least eleven weeks or over at least twelve weeks.

(33) The term “epitope” includes any protein determinant capable of specific binding to an antibody or otherwise interacting with a molecule. Epitopic determinants generally consist of chemically active surface groupings of molecules such as amino acids or carbohydrate or sugar side chains and can have specific three-dimensional structural characteristics, as well as specific charge characteristics. An epitope may be “linear” or “conformational.” The term “linear epitope” refers to an epitope with all of the points of interaction between the protein and the interacting molecule (such as an antibody) occur linearally along the primary amino acid sequence of the protein (continuous). The term “conformational epitope” refers to an epitope in which discontinuous amino acids that come together in three dimensional conformation. In a conformational epitope, the points of interaction occur across amino acid residues on the protein that are separated from one another.

Embodiments

(34) An aspect includes a method of treating multiple myeloma in a subject in need thereof comprising administering to the subject a therapeutically effective amount of an antibody specific for CD38 wherein said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1) or SYYMN (SEQ ID NO: 2), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 3), an HCDR3 of sequence DLPLVYTGFAY (SEQ ID NO: 4), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 5), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 6), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 7), wherein said antibody is administered at a dose of 8 mg/kg or more.

(35) An aspect includes a use of an antibody specific for CD38 wherein said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1) or SYYMN (SEQ ID NO: 2), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 3), an HCDR3 of sequence DLPLVYTGFAY (SEQ ID NO: 4), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 5), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 6), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 7) in the manufacture of a medicament for the treatment of multiple myeloma, wherein said antibody is administered at a dose of 8 mg/kg or more.

(36) In certain embodiments the present disclosure relates to an antibody specific for CD38 wherein said antibody comprises an HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1) or SYYMN (SEQ ID NO: 2), an HCDR2 region of sequence GISGDPSNTYYADSVKG (SEQ ID NO: 3), an HCDR3 of sequence DLPLVYTGFAY (SEQ ID NO: 4), an LCDR1 region of sequence SGDNLRHYYVY (SEQ ID NO: 5), an LCDR2 region of sequence GDSKRPS (SEQ ID NO: 6), and an LCDR3 region of sequence QTYTGGASL (SEQ ID NO: 7) for use in the treatment of multiple myeloma, wherein said antibody is administered at a dose of 8 mg/kg or more.

(37) In an embodiment, the antibody comprises the HCDR1 region of sequence GFTFSSYYMN (SEQ ID NO: 1).

(38) In an embodiment, the antibody comprises the HCDR1 region of sequence SYYMN (SEQ ID NO: 2).

(39) In an embodiment, the multiple myeloma is relapsed/refractory.

(40) In certain embodiments, the disclosed antibody specific for CD38 is administered at a dose of 16 mg/kg or more.

(41) In certain embodiments, the antibody is administered once every two weeks (q2w) over at least eight weeks.

(42) In certain embodiments, the antibody is administered once weekly (q1w) over at least eight weeks.

(43) In certain embodiments, the antibody is administered intravenously.

(44) In certain embodiments, the antibody is administered intravenously over a period of two hours.

(45) In certain embodiments, the antibody comprises a variable heavy chain of the sequence QVQLVESGGGLVQPGGSLRLSCAASGFTFSSYYMNWVRQAPGKGLEWVSGISGDPSN TYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLPLVYTGFAYWGQGTLV TVSS (SEQ ID NO: 8) and a variable light chain of the sequence DIELTQPPSVSVAPGQTARISCSGDNLRHYYVYWYQQKPGQAPVLVIYGDSKRPSGI PERFSGSNSGNTATLTISGTQAEDEADYYCQTYTGGASLVFGGGTKLTVLGQ (SEQ ID NO: 9).

(46) In certain embodiments, the antibody comprises an IgG1 Fc region.

(47) In embodiments, the antibody is administered in combination with dexamethasone.

(48) In embodiments, the antibody is administered in combination with dexamethasone, wherein dexamethasone is dosed at 20 mg or 40 mg once weekly (q1W).

EXAMPLES

Example 1: Patient Selection

(49) The study was an open-label, multicentre, dose escalation (3+3 design) study to characterize the safety and preliminary efficacy of the human anti-CD38 antibody MOR03087 (MOR202), in adult subjects with relapsed/refractory multiple myeloma, as monotherapy and in adult subjects with relapsed/refractory multiple myeloma in combination with standard therapy. ClinicalTrials.gov Identifier: NCT01421186.

(50) Patients were eligible to participate in the study if they met the following criteria:

(51) 1. were >18 years of age,

(52) 2. Relapsed or refractory multiple myeloma defined as:

(53) Parts A, B and C:

(54) (i) Failure of at least 2 previous therapies which must have included an immunomodulatory agent and a proteasome inhibitor (either together or part of different therapies) (ii) All subjects must have documented progression during or after their last prior therapy for multiple myeloma

(55) Part D:

(56) (i) At least 2 previous therapies including lenalidomide and a proteasome inhibitor (ii) All subjects must have documented progression during or within 60 days after their last prior therapy for multiple myeloma

(57) Part E:

(58) (i) Received at least one previous therapy (ii) All subjects must have documented progression during or after their last prior therapy for multiple myeloma

(59) Additional inclusion criteria were as follows:

(60) 1. Presence of serum M-protein ≥0.5 g per 100 mL (≥5 g/L) and/or urine M-protein ≥200 mg per 24-hour period

(61) 2. Absolute neutrophil count (ANC)≥1,000/mm3

(62) 3. Haemoglobin ≥8 g/dL, and

(63) 4. Ability to comply with all study related procedures, medication use and evaluations.

(64) The main exclusion criteria were primary, refractory MM; solitary plasmacytoma or plasma cell leukemia; and previous allogenic stem cell transplant.

(65) Tables 1A and B describes the demographics of the patients treated in the present study.

(66) TABLE-US-00004 TABLE 1A Demographics of Patients Treated in the present Study as of Apr. 13, 2015 Cohorts  1-4 5-8  Total Dosing (mg/kg) 0.01-0.5 2-16 Patients treated 14 28 42 Median age (years) 70 69.5 69.5 Gender, % Female 42.9 28.6 33.3 Male 57.1 71.4 66.7 Ethnicity, % Caucasian 100 100 100 Median Karnofsky PS (%) 90 90 90 Median number of prior 4 (2-10) 4 (2-11) 4 (2-11) therapy lines (range) ASCTs (%) 93 75 81 Prior therapies, % (selection) Bortezomib 100 100 100 Carfilzomib 0 7.1 4.8 Thalidomide 35.7 39.3 38.1 Lenalidomide 100 96.4 97.6 Pomalidomide 0 21.4 14.3 Melphalan 100 96.4 97.6 Cyclophosphamide 64.3 82.1 76.2 Doxorubicin 57.1 60.7 59.5 ASCTs Autologous Stem Cell Transplant; PS, performance status.

(67) TABLE-US-00005 TABLE 1B Demographics of Patients Treated in the present Study as of Oct. 26, 2015 Schedule q1w + Q1W + Q1w + Dex POM/Dex LEN/Dex Dosing (mg/kg) 4-16 8 8 Patients treated 10 3 4 Median age (years) 68 64 59 Gender, % Female 60 67 75 Male 40 33 25 Ethnicity, % Caucasian 100 100 100 Median Karnofsky 90 100 95 PS (%) Median number 4 3 2 of prior therapy lines (range) ASCTs (%) 80 33 75 Prior therapies, % (selection) Bortezomib 100 100 100 Lenalidomide 100 100 25 Cyclophosphamide 90 33 100 Melphalan 80 100 75 Doxorubicin 60 0 50 Thalidomide 50 0 0 Pomalidomide 10 0 0 Carfilzomib 10 0 0 Panobinostat 0 0 25 ASCT, autologous stem cell transplant; Dex, dexamethasone; LEN, lenalidomide; POM, pomalidomide; PS, performance status; q1w, weekly.

Example 2: Study Design

(68) The primary study outcome measures were as follows:

(69) 1. Identify the maximum tolerated dose (MTD) and/or recommended dose/schedule of MOR202 as monotherapy with and without dexamethasone (DEX), and in combination with pomalidomide (POM)/DEX and lenalidomide (LEN)/DEX.

(70) 2. Evaluate safety by the incidence and severity of adverse events (AEs).

(71) 3. Evaluate the immunogenicity of MOR202.

(72) The Secondary outcome measures were as follows:

(73) 1. Evaluate the pharmacokinetics (PK) of MOR202 without and with POM/DEX and LEN/DEX.

(74) 2. Identify the overall response rate, duration of response, time-to-progression, and progression-free survival.

(75) Patients were allocated to the following cohorts:

(76) TABLE-US-00006 Dose- Part A: 2-hour IV infusion of MOR202 escalation Cohorts 1-8: Cohorts 0.01 .fwdarw. 0.04 .fwdarw. 0.15 .fwdarw. 0.5 .fwdarw. 1.5 .fwdarw. 4.0 .fwdarw. 8.0 .fwdarw. 16.0 mk/kg, without DEX, q2w Part B: 2-hour IV Part C: 2-hour IV infusion of MOR202 infusion of MOR202 (Cohorts 6b-8b): (Cohorts 6c-8c): 4 .fwdarw. (8) .fwdarw. (16) mg/kg, 4 .fwdarw. 8 .fwdarw. 16 mg/kg, without DEX, q1w with DEX, q1w Part D: 2-hour IV Part E: 2-hour IV infusion of MOR202 infusion of MOR202 (Cohorts 7d-8d): (Cohorts 7e-8e): 8 .fwdarw. 16 mg/kg, 8 .fwdarw. 16 mg/kg, with POM/DEX, q1w with LEN/DEX, q1w Confirmatory MOR202 monotherapy without/with DEX, q1w or q2w Cohorts MOR202 with POM/DEX, q1w (26 patients MOR202 with LEN/DEX, q1w each) q1w: weekly; q2w: every 2 weeks; DEX: dexamethasone; LEN: lenalidomide; POM: pomalidomide.

(77) Treatment cycles were 28 days. Initial MOR03087 doses were 0.01 mg/kg in part A, 4 mg/kg in parts B and C and 8 mg/kg in parts D and E; in all parts MOR03087 doses was escalated to a maximum of 16 mg/kg. In part A, patients received a biweekly intravenous infusion of MOR03087 which was administered on days 1 and 15 of the cycle. In parts B to E patients received a weekly intravenous infusion of MOR03087 which was administered on days 1, 8, 15, and 22 of the cycle.

(78) In all parts a loading dose of MOR03087 was administered on day 4 of cycle 1.

(79) Where applicable, dexamethasone was administered to patients orally; 40 mg (≤75 years old) or 20 mg (>75 years old) on days 1, 8, 15, and 22 of the 28-day cycle. An additional dose was administered in cycle 1 on day 4.

(80) For the relevant cohorts, Pomalidomide was administered to patients orally 4 mg on days 1-21 of the 28-day cycle.

(81) For the relevant cohorts, Lenalidomide was administered to patients orally 25 mg on days 1-21 of the 28-day cycle.

(82) For all parts, patients will be treated until disease progression or until a maximum of 2 years after first treatment.

Example 3: Study Completion

(83) Parts A-C were conducted in patients with rrMM who had failed 2 previous therapies including an immunomodulatory drug and a proteasome inhibitor.

(84) The duration of treatment was as follows:

(85) Patients from part A (cohorts 1-6) were treated for up to 2 cycles only (2×28 days). Patients from subsequent cohorts were/will be treated until disease progression (PD) for up to 2 years.

(86) The route of MOR202 administration was a 2-hour intravenous (IV) infusion.

(87) The premedication, where applicable was antipyretic, histamine H1 receptor blocker.

(88) On completion of parts A-E, confirmatory cohorts (of ≥6 patients each) are planned to validate the MTD and/or recommended dose/schedule of MOR202 as monotherapy with and without dexamethasone (q1w or q2w), and in combination with POM/DEX and LEN/DEX (q1w).

(89) As of Apr. 13, 2015, 42 patients had been treated; 14 and 28 patients in cohorts 1-4 and 5-8, respectively.

(90) As of 26 Oct. 2015, a total of 52 patients had been treated with 17 of these patients being treated with the clinically relevant dose regimens

Example 4: Toxicity Assessment

(91) 42 (100%) patients experienced adverse events (AEs) during treatment irrespective of causality.

(92) 18 (42.9%) patients discontinued treatment with 3 (7.1%) patients due to suspected causal relationship.

(93) There have been no treatment-related deaths.

(94) The Maximum Tolerated Dose (MTD) of MOR202 has not yet been reached.

(95) Table 2 shows the most frequently reported AEs.

(96) TABLE-US-00007 TABLE 2 Most frequently reported AEs as of Apr. 13, 2015 Cohorts Grades Cohort 1-4 Cohort 5-8 Total Hematologic AEs* (≥10%) Anemia 7.1 42.9 — 28.6 2.4 33.3 Lymphocyte count — 7.1 21.4  25.0 14.3 19.0 decreased WBC** count 7.1 7.1 7.1 25.0 7.1 19.0 decreased Leukopenia — 7.1 7.1 17.9 4.8 14.3 Neutrophil count — 0.0 3.6 17.9 2.4 11.9 decreased Thrombocytopenia — 0.0 7.1 17.9 4.8 11.9 Non-hematologic AEs (≥15%) Fatigue — 42.9 — 28.6 — 33.3 Nausea — 35.7 — 21.4 — 26.2 Diarrhea — 28.6 — 14.3 — 19.0 Headache — 42.9 — 3.6 — 16.7 Nasopharyngitis — 28.6 — 10.7 — 16.7 Pyrexia — 21.4 — 14.3 — 16.7 *MedDRA System Organ Classes “Blood and Lymphatic System Disorders” and “Investigations” are applicable and therefore Preferred Terms from both are included; **WBC, white blood cell.

(97) Infusion Tolerability

(98) A 2-hour IV infusion was feasible in all patients. Infusion-related reactions (IRRs) occurred in 13 (31%) patients receiving MOR202 without DEX, mainly during the first infusion.

(99) All IRRs were grade 1-2 except for 1 patient (grade 3).

(100) No IRRs occurred in patients who received DEX. IRRs are shown in FIG. 6.

Example 5: Treatment Administered and Response Assessment

(101) FIG. 2 shows responses as of Apr. 13, 2015. FIG. 3 shows the change in M protein to date.

(102) The overall response rate, duration of response, time-to-progression, and progression-free survival of all patients will be evaluated.

Example 6: Pharmacokinetics

(103) FIGS. 7A-D show the MOR202 serum concentrations over time. In most patients treated with 4 mg/kg q2w, a dominant target-mediated sink effect was observed leading to low or no detectable serum trough levels, see FIGS. 7A and C. In contrast, patients treated with ≥4 mg/kg q1w showed constant or slightly accumulating trough levels, see FIGS. 7B and D.

(104) The data of 8 mg/kg and 16 mg/kg q2w in FIGS. 7A and C indicate that dose-escalation leads to full target saturation at these higher dose levels.

(105) A terminal elimination half-life of 2-3 weeks was estimated by comparing modelled serum concentrations of MOR202 (at 4 mg/kg, q1w) with measured patient data.

(106) Only 1 patient (0.15 mg/kg q2w) developed a transient anti-MOR202 antibody response.

(107) PK data indicate the potential for full target occupancy in the majority of pts receiving 8 and 16 mg/kg q1w.

(108) Surprisingly it was found that the overall response rate, duration of response, time-to-progression, and/or progression-free survival of patients receiving administration of 8 mg/kg once every other week q2w and/or once weekly q1w was significantly improved over patients receiving 4 mg/kg once every other week q2w or 4 mg/kg once weekly q1w.

(109) Surprisingly it was found that the overall response rate, duration of response, time-to-progression, and/or progression-free survival of patients receiving administration of 16 mg/kg once every other week q2w and/or once weekly q1w was significantly improved over patients receiving 4 mg/kg once every other week q2w or 4 mg/kg once weekly q1w, and/or receiving 8 mg/kg once every other week q2w or 8 mg/kg once weekly q1w.

(110) FIG. 4 shows the superior overall response rates of dosing MOR202 at 16 mg/kg once weekly q1w in the treatment of multiple myeloma. FIG. 5 supports a direct relationship between minimum trough levels of MOR202 and clinical responses, whereas higher trough levels led to better clinical responses. FIG. 8 supports the direct relationship between the MOR202 dose, frequency of dosing and trough levels showing that higher trough levels were linked to higher doses.

(111) In summary, surprisingly it was found that the overall response rate of patients receiving administration of 16 mg/kg once weekly q1w was significantly improved over patients receiving 4 mg/kg once every other week q2w or 4 mg/kg once weekly q1w, and/or receiving 8 mg/kg once every other week q2w or 8 mg/kg once weekly q1w.