APPLICATION OF ZN7MT3 AND ITS DERIVATIVES IN THE PREVENTION AND TREATMENT OF ALZHEIMER'S DISEASE

20180371061 ยท 2018-12-27

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure provides a use based on Zn.sub.7MT3 or a derivative thereof. Zn.sub.7MT3 or a derivative thereof is used for prevention or treatment of Alzheimer's disease or other neurodegenerative diseases, or for development, screening or preparation of a medicament suitable for Alzheimer's disease or other neurodegenerative diseases. Further provided are a method for preparing Zn.sub.7MT3 and a method for preparing gH625-Zn.sub.7MT3. Zn.sub.7MT3 and the derivatives thereof of the present disclosure can be used for improving cognitive dysfunction of an AD brain, regulating the cellular morphology of hippocampus in the AD brain, inhibiting the deposition of the amyloid protein in the AD brain and inhibiting the apoptosis of nerve cells in the brain, and can effectively prevent the progression of senile dementia; and the method for preparing Zn.sub.7MT3 is simple and efficient, and gH625-Zn.sub.7MT3 can easily cross the blood-brain barrier.

    Claims

    1. A use of Zn.sub.7MT3 or a derivative thereof, wherein Zn.sub.7MT3 or a derivative thereof is used for prevention or treatment of Alzheimer's disease or other neurodegenerative diseases, or for development, screening or preparation of a medicament suitable for Alzheimer's disease or other neurodegenerative diseases.

    2. The use according to claim 1, wherein Zn.sub.7MT3 or a derivative thereof is used for improving cognitive dysfunction of an AD brain, regulating the cellular morphology of hippocampus in the AD brain, inhibiting the deposition of amyloid proteins in the AD brain or inhibiting the apoptosis of nerve cells in the brain.

    3. The use according to claim 1, wherein the dosage form of the medicament comprises at least one of tablets, capsules, granules, suspensions, emulsions, solutions, syrups and injections.

    4. The use according to claim 1, wherein the derivative of Zn.sub.7MT3 comprises gH625-Zn.sub.7MT3, or other similar fusion proteins based on metallothionein MT3 or Zn.sub.7MT3 fused with transmembrane small peptide tags.

    5. A method for preparing Zn.sub.7MT3, comprising the steps of: S1, fusion-expressing MT3 with MBP and Smt3 tags; and S2, subjecting the semi-finished product obtained in S1 to acid denaturation to remove impurity metals, then adding thereto excess zinc ions to renature MT3 protein, and subjecting the resultant product to separation and purification to remove the surplus zinc ions, thereby obtaining Zn.sub.7MT3.

    6. The method for preparing Zn.sub.7MT3 according to claim 5, wherein MT3 is solubly expressed in Escherichia coli.

    7. A method for preparing gH625-Zn.sub.7MT3, wherein gH625-Zn.sub.7MT3 is made by metal recombination of gH625-MT3 formed by fusion of gH625 and MT3.

    8. The method according to claim 7, wherein gH625 comprises a transmembrane sequence is a glycoprotein of herpes simplex virus; the transmembrane sequence contains 23 amino acid residues; MT3 comprises metallothionein III; and metallothionein III contains 68 amino acid residues.

    9. The method according to claim 7, wherein a Smt3-MT3 gene expression plasmid containing a fusion tag is constructed by using a vector through the genetic engineering technology; the gene sequence of gH625 is inserted into the Smt3-MT3 gene to form a smt3-gH625-MT3 fusion protein gene; the smt3-gH625-MT3 recombinant fusion protein is solubly expressed in Escherichia coli, and is then subjected to separation and purification to obtain gH625-MT3 recombinant fusion protein; the gH625-MT3 recombinant fusion protein is further caused to bind to zinc ions by chemical recombination, thereby obtaining gH625-Zn.sub.7MT3.

    10. The method according to claim 7, wherein the vector is pET22b(+).

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0028] FIG. 1: Regulatory effect of Zn.sub.7MT3 on the cellular morphology in CA1 region of brain tissue hippocampus of AD mice;

    [0029] FIG. 2: Zn.sub.7MT3's inhibition on the deposition of Abeta proteins in the brain of the AD mice;

    [0030] FIG. 3: Impact of Zn.sub.7MT3 on the apoptosis of nerve cells in the brain of the AD mice;

    [0031] FIG. 4: Regulatory effect of gH625-Zn.sub.7MT3 on the cellular morphology in CA1 region of brain tissue hippocampus of the AD mice;

    [0032] FIG. 5: gH625-Zn.sub.7MT3's inhibition on the deposition of Abeta proteins in the brain of the AD mice; and

    [0033] FIG. 6: Impact of gH625-Zn.sub.7MT3 on the apoptosis of nerve cells in the brain of the AD mice.

    [0034] In each of the figures, A is a control group (normal mice), B is an AD mice model group, and C is AD model mice administered with a medicament for six weeks.

    DETAILED DESCRIPTION

    [0035] The present disclosure will be described in detail by way of examples. In the present disclosure, the embodiments described below are intended to illustrate the present disclosure better, rather than limit the scope of the present disclosure.

    [0036] It should be noted that the mentioned human MT3 is a specific protein name, which, if not specified, is consistent with most published documents, the NCBI database and the European gene database.

    [0037] Human MT3 protein amino acid sequence (1-68):

    TABLE-US-00001 MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPA ECEKCAKDCVCKGGEAAEAEAEKSSCCQ.

    [0038] MT3 (Metallothionein 3), also referred to as neuronal growth inhibitory factor, contains 68 amino acid residues, with the GenBank name EAW82868.1.

    [0039] GH625-MT3 fusion protein amino acid sequence (1-91):

    TABLE-US-00002 HGLASTLTRWAHYNALIRAFGGGMDPETCPCPSGGSCTCA DSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAA EAEAEKSSCCQ.

    Embodiment 1: Preparation of Zn.SUB.7.MT3

    [0040] Unless otherwise specified, all biochemical reagents and kits were purchased from Sigama or Invitrogen.

    [0041] (1) Plasmid Construction

    [0042] Human metallothionein MT3 and fusion tag protein gene Smt3 were purchased from Guangzhou Funeng Gene Company, the gene vector plasmid MBPHT-mCherry-2 was purchased from Invitrogen, and the synthesis of the gene primers was completed by Shanghai Generay Biotech Co., Ltd. A PCR product was obtained by amplification using the designed primers P1, P2 (amplifying Smt3 gene) and P3, P4 (amplifying MT3 gene). The amplification product was verified by 1% agarose gel detection and the desired fragment was recovered with gel. Product 1 and product 2 were mixed at the same concentration ratio to serve as a template, and the Smt3-MT3 sequence was obtained by amplification using P1 and P4 primers, with its 5 end carrying BamHI enzyme digestion site GGATCC and its 3 end carrying HindIII enzyme digestion site AAGCTT. The designed amplification primers were as follows:

    TABLE-US-00003 P1: 5-CGCGGATCCATGGCTAGCATGTCGGACTC-3 P2: 5-GGCAGGTCTCAGGGTCCATACCACCAATCTGTTCTC-3 P3: 5-GAGAACAGATTGGTGGTATGGACCCTGAGACCTGCC-3 P4: 5-CGCAAGCTTTCACTGGCAGCAGCTGCA-3

    [0043] The vector MBPHT-mCherry-2 and the amplified Smt3-MT3 gene sequence were subjected to double enzyme digestion at 37 C. for 6 hours by using BamHI and HindIII endonucleases, respectively, enzyme digestion was verified to be successful by means of 1% agarose gel detection, and the digested fragments were recovered with gel. The digested large and small fragments were mixed at 1:3 and ligated at 16 C. for 8 hours with T4 ligase. The ligation product was transformed into Top10 clone competent cells, and positive clones were picked for PCR identification and sequencing to prove successful construction of the fusion protein MT3-Smt3 expression plasmid.

    [0044] (2) Expression and Purification of MT3 Protein

    [0045] The constructed plasmid was transformed into host bacterium BL21 (DE3). Single colonies were picked out and placed in 3 ml of LB culture medium, were cultured in a shaker at 37 C. for 8 hours, then inoculated into 50 ml of LB culture medium at a ratio of 1:100 and cultured in a 37 C. shaker for 6 hours, and further inoculated into 2YT culture medium at a ratio of 1:100 (the abovementioned culture mediums all contained 100 g/ml ampicillin sodium). When the colonies were cultured in a shaker at 37 C. and at 200 rpm to have an OD value of 0.6-0.8, the IPTG inducer was added thereto until the final concentration reached 0.4 mM, and the resultant product was expressed overnight at 16 C.

    [0046] The purification process of the fusion protein was as follows: the bacteria harvested through centrifugation were suspended (1 ml/g bacteria) by adding thereto Tris buffer solution (20 mM Tris-HCl, 500 mM NaCl, 10% glycerol, 5 mM -mercaptoethanol, pH=7.5), a small amount of lysozyme, DNA enzyme and 1% PMSF were added thereto, the bacteria were dissolved by stirring and disrupted with an ultrasonic disintegrator, and then centrifuged with a high-speed centrifuge (for 30 min at 12000 rpm), and the supernatant was taken therefrom to flow through a well-balanced affinity Ni-NTA column so that the His-tagged fusion proteins were attached to the column. The impurity proteins were eluted with Tris buffer solution containing 20 mM imidazole until no color change was detected by Coomassie Brilliant Blue. The fusion proteins were eluted with Tris buffer solution containing 200 mM imidazole. The eluted fusion proteins were placed into a dialysis bag for dialysis, the dialysate was Tris buffer solution, 1 L was used each time, the dialysate was changed every 6 hours for three times in total, thereafter SUMO enzyme was added thereto at a ratio of 1% for enzyme digestion for 6 hours, the resultant product was flowed through the well-balanced Ni-NTA column for three times in total to remove tag proteins and SUMO enzyme, and then subjected to Superdex-G75 gel molecular sieve to further remove the impurity proteins, and the purified MT3 protein was detected, by 15% SDS-PAGE gel detection, to have a purity of 95% or more.

    [0047] (3) Metal Recombination of Zn.sub.7MT3

    [0048] DTT was added to 2 ml of MT3 protein solution (5 mg/ml) until the final concentration reached 50 mM, and the mixture was reduced at 4 C. for 2 hours. 6M HCl solution was added thereto to regulate the pH to 1-2, then the mixture was acidified for 1 hour and then was passed through the Superdex G-25 column to remove impurity metal ions, and MT3 protein was eluted with HCl solution having the pH of 2.0. The effluent was detected by an ultraviolet spectrometer and then collected. Demetallized Apo-MT3 protein solution was loaded into anaerobic glove box after being degassed, DTT was added thereto until the final concentration reached 50 mM, ZnCl.sub.2 having a concentration 20 times the protein concentration was added thereto, 2M Tris base was added thereto dropwise slowly to regulate the pH to 8-9, the product was left overnight at room temperature, and then dialyzed to remove surplus zinc ions, and Zn.sub.7MT3 was obtained after protein concentration.

    [0049] (4) Property Characterization of Zn.sub.7MT3

    [0050] The MT3 protein concentration calibration method: 2,2-dithiodipyridine (2-PDS) colorimetry was adopted. The principle was that the sulfhydryl group in the protein was oxidized by using 2,2-dithiodipyridine and the resultant product 2-thiopyridine had sharp absorption at 343 nm. 10 l of protein solution was added to 500 l of determination solution (2 mM 2,2-dithiodipyridine, 1 mM EDTA, 0.2 M sodium acetate, pH 4.0). The mixture was mixed well and stood at room temperature for 5 minutes, and then the value of absorbance at 343 nm was measured with an ultraviolet spectrometer and the concentration of the sulfhydryl group (SH) in the protein was calculated using the lamber-beers law. C(SH)=A.sub.343/(.sub.343.Math.L), where A.sub.343 was the absorbance of the reaction product (2-thiopyridine) at 343 nm, .sub.343 was the molar extinction coefficient (7.06103 M.sup.1) of the reaction product at 343 nm, and L was the optical diameter length (cm). Since the metallothionein contains a plurality of sulfhydryl groups, the concentration of the protein could be obtained just by dividing the measured concentration of sulfhydryl groups by the number of sulfhydryl groups.

    [0051] Metal content determination of Zn.sub.7MT3: a small amount of concentrated nitric acid was added to a certain amount of recombinant protein for nitrification overnight at 65 C., the resultant product was tenfold diluted, and then the content of metal Zn was measured on an inductively coupled plasma optical emission spectrometer (ICP-OES). The results showed that per mole of recombinant MT3 protein contained 70.2 moles of Zn.

    [0052] (5) Removal of Endotoxin from Zn.sub.7MT3

    [0053] Zn.sub.7MT3 (with a molecular weight of about 7 KD) was first subjected to 10 KD ultrafiltration membrane to entrap endotoxin (LPS) in aggregation state, and then subjected to Polymyxin B affinity column to remove the residual endotoxin.

    Embodiment 2: AD Mouse Model and Zn.SUB.7.MT3 Drug Therapy

    [0054] APP/PS1 transgenic mice were purchased from Beijing Zhongke Zesheng Biotechnology Co., Ltd., 5 months old, weighing 24-26 g. Name of the test drug: Zn.sub.7MT3; solvent: normal saline; and preparation method: preparing the drug into a solution at the desired concentration with normal saline solution just before use. Intraventricular administration of mice: the experimental animals were APP/PS1 transgenic mice. Sustained release administration was performed for 6 weeks by using an Alzet miniosmotic pump Model 2006. The administration site was the lateral ventricle, at the time of implanting a catheter, a stereotactic instrument was used for precise positioning (with the anterior fontanelle being the origin, 1.0 mm to the left or right, 0.4 mm to the back, and 0.3 mm deep), the dosage was 2 mg/kg/day, and 6 weeks later, the blood serum and brain tissues were harvested.

    Embodiment 3: Verification of Cognitive Ability of AD Mice Using Morris Water Maze

    [0055] Installation: a round pool was used, having a diameter of 1 m, a height of 50 cm and water depth of 30 cm, and having a white bottom, and water temperature was maintained at 232 C. Four equally spaced points N, E, S and W were marked on the wall of the pool and served as the starting points of the test. The pool was divided into four quadrants, and a platform was placed in the center of the third quadrant (the platform was equidistant from the wall of the pool and the circle center). The platform was submersed in water at 1 cm depth, making the platform invisible. Lots of clues (triangles, squares, circles and rhombuses in different colors were placed in the quadrants) were arranged around the pool and the clues remained unchanged for use by the mice to position the platform. Place navigation test: the test lasted for 6 days, and training was performed for 4 times at fixed time periods every day. At the beginning of the training, the platform was placed in the first quadrant, and the mice were placed into the pool facing the wall of the pool from any of the four starting points on the wall of the pool. The time it took for the mice to find the platform and the swimming path of the mice were recorded by a free video recording system, and the four times of training referred to the four training sessions started by placing the mice in water from the four different starting points (different quadrants). After the mice found the platform or if the mice could not find the platform within 90 seconds (the latent period was set to 90 seconds), the experimenter directed the mice to the platform, the mice rested on the platform for 10 seconds, and then the next test was started.

    [0056] Spatial probe test: the platform was removed 24 h after the place navigation test was completed. The mice were then placed into water from the third quadrant, the swimming paths of the mice within 180 s were recorded, the residence time of the mice in the target quadrant (the third quadrant) and the frequency at which the mice crossed the original position of the platform were recorded, and the spatial positioning ability of the test mice was observed. The data were processed with SPSS10.0 software, and one-way ANOVA was adopted to verify and compare the distinctiveness of the effect of drug administration. The results showed that AD mice that had been treated with Zn.sub.7MT3 exhibited an improvement in cognitive ability. Compared with the control group, the AD mice in the drug administration group were improved by 20% or more in the residence time is the third quadrant and the frequency at which the mice crossed the original position of the platform, indicating that Zn.sub.7MT3 could effectively prevent the development of the disease of the AD mice under treatment.

    Embodiment 4: Regulation of Zn.SUB.7.MT3 on Cranial Nerve Cells of AD Mice

    [0057] After 6 weeks of administration, brain tissues of the AD mice were harvested, fixed in 4% paraformaldehyde, dehydrated, embedded in paraffin, cut into slices with a thickness of 4 microns by a microtome, and then stained with haematoxylin and eosin (HE); and thereafter the cellular morphology in CA1 region of hippocampus was observed under an optical microscope (Leica, Germany). The experimental results were as shown in FIG. 1 (A was a control group, B was an AD mouse model group, and C was a group of AD mouse models intraventricularly administered with Zn.sub.7MT3 in a positioned, sustained-release manner). The cells in CA1 region of the brain tissues of the AD model mice deformed and shrank, no chromatin or ribosome was observed, and the cellular morphology tended to be normal after administration of Zn.sub.7MT3. After the administration of Zn.sub.7MT3, the degeneration of the cranial nerve cells of the mice could be inhibited and the nerve cells were regulated to restore normal functions.

    Embodiment 5: Inhibition of Zn.SUB.7.MT3 on Aggregation of Amyloid Proteins in the Brain of AD Mice

    [0058] This experiment was thioflavine S staining experiment. The flow of the experiment was as follows: after 6 weeks of administration, brain tissues of the AD mice were harvested, then fixed, embedded in paraffin, sliced, dewaxed in xylene, dehydrated in gradient ethanol and washed with TBS for three times. 0.3% thioflavine S (dissolved in 50% ethanol) was dropped on the tissues, and the tissues were incubated at room temperature for 10 minutes, washed three times with 50% ethanol, washed with TBS, dried, mounted and then observed under a laser confocal microscope. The experimental results were as shown in FIG. 2. Thioflavine S itself has green fluorescence and can specifically bind to mature Abeta amyloid protein, and therefore can be used to label the content and distribution of amyloid protein in brain tissues so as to evaluate the pathological condition of the AD disease. The experimental results were as shown in FIG. 2 (A was a control group, B was an AD mouse model group, and C was a group of AD mouse models intraventricularly administered with Zn.sub.7MT3 in a positioned, sustained-release manner). After administration, Abeta amyloid proteins were significantly reduced, as compared with the model group, which indicated that Zn.sub.7MT3 could remarkably decrease the deposition of Abeta proteins in the brain of the AD mice.

    Embodiment 6: Inhibition of Zn.SUB.7.MT3 on the Apoptosis of Cranial Nerve Cells of AD Mice

    [0059] The TUNEL apoptosis detection kit (G3250 kit) was purchased from Promega company. The brain tissues of the mice were harvested 6 week after administration, then fixed, embedded in paraffin, sliced, dewaxed in xylene, dehydrated in gradient ethanol, washed with TBS, incubated with protease K at room temperature for 10 min, sliced, washed with PBS, fixed with formaldehyde, added with an equilibration buffer for preequilibration, washed, then added with an incubation buffer (containing an equilibration buffer, a nucleoside mixture and rTdT enzyme) and incubated at 37 C. for 1 h in the dark, after the reaction was terminated, the resultant product was co-stained with DAPI, dried in the shade, mounted and photographed by a laser microscope. The results were as shown in FIG. 3 (A was a control group, B was an AD mouse model group, and C was a group of AD mouse models intraventricularly administered with Zn.sub.7MT3 in a positioned, sustained-release manner). The results showed that Zn.sub.7MT3 could inhibit the apoptosis of cranial nerve cells of the mice.

    Embodiment 7: Preparation and Characterization of gH625-Zn.SUB.7.MT3

    [0060] Unless otherwise specified, all biochemical reagents and kits were purchased from Sigama or Invitrogen company.

    [0061] (1) Construction of Smt-MT3 Plasmid

    [0062] Human metallothionein MT3 and fusion tag protein gene Smt3 were purchased from Guangzhou Funeng Gene Company, the gene vector plasmid MBPHT-mCherry-2 was purchased from Invitrogen Company, and the synthesis of the gene primers was completed by Shanghai Generay Biotech Co., Ltd. A PCR product was obtained by amplification using the designed primers P1, P2 (amplifying Smt3 gene) and P3, P4 (amplifying MT3 gene). The amplification product was verified by 1% agarose gel detection and the desired fragment was recovered with gel. Product 1 and product 2 were mixed at the same concentration ratio to serve as a template, and the Smt3-MT3 sequence was obtained by amplification using P1 and P4 primers, with its 5 end carrying BamH I enzyme digestion site GGATCC and its 3 end carrying Hind III enzyme digestion site AAGCTT. The designed amplification primers were as follows:

    TABLE-US-00004 P1: 5-CGCGGATCCATGGCTAGCATGTCGGACTC-3 P2: 5-GGCAGGTCTCAGGGTCCATACCACCAATCTGTTCTC-3 P3: 5-GAGAACAGATTGGTGGTATGGACCCTGAGACCTGCC-3 P4: 5-CGCAAGCTTTCACTGGCAGCAGCTGCAC-3

    [0063] The vector MBPHT-mCherry-2 and the amplified Smt3-MT3 gene sequence were subjected to double enzyme digestion at 37 C. for 6 hours by using BamH I and Hind III endonucleases, respectively, enzyme digestion was verified to be successful by means of 1% agarose gel detection, and the digested fragments were recovered with gel. The digested large and small fragments were mixed at 1:3 and ligated at 16 C. for 8 hours with T4 ligase. The ligation product was transformed into Top10 close competent cells, and positive clones were picked for PCR identification and sequencing to prove successful construction of the fusion protein Smt3-MT3 expression plasmid.

    [0064] (2) Construction of Smt3-gH625-MT3 Expression Plasmid

    [0065] Using Smt3-MT3 plasmid as a template and using TOYOBO mutagenesis kit, primers (P5, P6) were designed to insert the gene sequence (H.sub.2N-HGLASTLTRWAHYNALIRAFGGG-CONH.sub.2) of gH625 into the N-terminal of MT3 sequence. The primers were as follows:

    TABLE-US-00005 P5: 5-ATTACAACGCACTAATCCGGGCTTTCGGTGGTGGAATGGACCCTGAG ACCTGCCC-3 P6: 5-GTGCCCATCGAGTCAGCGTTGAAGCGAGTCCTAGACCACCAATCTGT TCTCTGT-3

    [0066] The specific experiment operations were as follows:

    [0067] (a) reverse PCR

    [0068] 1) diluting the primers to 10 pmol/l, and regulating the concentration of template plasmid DNA to 50 ng/ul;

    [0069] 2) preparing the PCR reaction solution according to the following proportions:

    [0070] sterilized distilled water 35 l

    [0071] 10Buffer for iPCR 5 l

    [0072] 2 mM dNTPs 5 l

    [0073] primer 1 (10 pmol/ul) 1.5 l;

    [0074] primer 2 (10 pmol/ul) 1.5 l;

    [0075] plasmid DNA (50 ng/ul) 1 l,

    [0076] KOD-Plus-1 l

    [0077] Total Volume 50 l

    [0078] 3) performing PCR under the following conditions:

    [0079] 1. 94 C. 2 min

    [0080] 2. 98 C. 10 sec

    [0081] 3. 68 C. 6 min

    [0082] 4. repeating the steps by 2 to 10 cycles: [0083] 4 C. Hold

    [0084] (b) digesting the template plasmid DNA with Dpn I

    [0085] 1) adding 2 ul Dpn I to the PCR reaction solution (total amount of 50 l) after completion of the PCR reaction, and mixing the solution well gently; and

    [0086] 2) Spinning down, and reacting at 37 C. for 1 hour.

    [0087] (c) autocyclization of the PCR product

    [0088] 1) melting T4 Polynucleotide Kinase and Ligation high in ice bath, thereafter stirring Ligation high well gently, and spinning down;

    [0089] 2) preparing a reaction solution using a new PCR tube as follows:

    [0090] Dpn I treated PCR product 2 l

    [0091] sterilized distilled water 7 l

    [0092] Ligation high 5 l

    [0093] T4 Polynucleotide Kinase 1 l

    [0094] Total Volume 15 l

    [0095] 3) stirring well gently and spinning down;

    [0096] 4) reacting at 16 C. for 1 hour; and

    [0097] 5) transforming Escherichia coli with part of the reaction solution, picking monoclones and sequencing.

    [0098] For the successfully sequenced plasmids, the expressed protein was Smt3-gH625-MT3 fusion protein, the vector was pET22b(+), and the resistance was Kanamycin.

    [0099] (3) Biological Expression of Smt3-gH625-MT3 Protein and Purification of gH625-MT3

    [0100] The successfully constructed Smt3-gH625-MT3 plasmid was transformed into host bacterium BL21 (DE3). Single colonies were picked out and placed in 3 ml of LB culture medium, were cultured in a shaker at 37 C. for 8 hours, then inoculated into 50 ml of LB culture medium at a ratio of 1:100 and cultured in a 37 C. shaker for 6 hours, and further inoculated into 2YT culture medium at a ratio of 1.100 (the abovementioned culture mediums all contained 50 g/ml kanamycin). When the colonies were cultured in a shaker at 37 C. and at 200 rpm to have an OD value of 0.6-0.8, the IPTG inducer was added thereto until the final concentration reached 0.4 mM, and the resultant product was expressed overnight at 16 C.

    [0101] The purification process of the fusion protein was as follows: the bacteria harvested through centrifugation were suspended (1 ml/g bacteria) by adding thereto Tris buffer solution (20 mM Tris-HCl, 500 mM NaCl, 10% glycerol, 5 mM -mercaptoethanol, pH=7.5), a small amount of lysozyme, DNA enzyme and 1% PMSF were added thereto, the bacteria were dissolved by stirring and disrupted with an ultrasonic disintegrator, and then centrifuged with a high-speed centrifuge (for 30 min at 12000 rpm), and the supernatant was taken therefrom to flow through a well-balanced Ni-NTA affinity column so that the His-tagged fusion proteins were attached to the column. The impurity proteins were eluted with Tris buffer solution containing 20 mM imidazole until no color change was detected by Coomassie Brilliant Blue. The fusion proteins were eluted with Tris buffer solution containing 200 mM imidazole. The eluted fusion proteins were placed into a dialysis bag for dialysis, the dialysate was Tris buffer solution, thereafter SUMO enzyme was added thereto at a ratio of 1% for enzyme digestion for 6 hours, the resultant product was flowed through the well-balanced Ni-NTA column for three times in total to remove tag proteins and SUMO enzyme, and then subjected to Superdex-G75 gel molecular sieve to further remove the impurity proteins, and the purified gH625-MT3 protein was detected, by 15% SDS-PAGE gel detection, to have a purity of 95% or more.

    [0102] (4) Preparation of gH625-Zn.sub.7MT3

    [0103] DTT was added to 2 ml of gH625-MT3 fusion protein solution (5 mg/ml) until the final concentration reached 5 mM, and the mixture was reduced at 4 C. for 2 hours. 6M HCl solution was added thereto to regulate the pH to 1-2, then the mixture was acidified for 1 hour and then was passed through the Superdex G-25 column to remove impurity metal ions, and gH625-MT3 protein was eluted with HCl solution having the pH of 2.0. The effluent was detected by an ultraviolet spectrometer and then collected. Demetallized gH625-MT3 protein solution was loaded into anaerobic glove box after being degassed, DTT was added thereto until the final concentration reached 5 mM, ZnCl.sub.2 having a concentration 20 times the protein concentration was added thereto, 2M Tris base was added thereto dropwise slowly to regulate the pH to 8-9, the product was left overnight at room temperature, and then dialyzed to remove surplus zinc ions, and the fusion metalloprotein gH625-Zn.sub.7MT3 was obtained after protein concentration.

    [0104] (5) Metal Content Determination of gH625-Zn.sub.7MT3

    [0105] A small amount of concentrated nitric acid was added to a certain amount of recombinant fusion protein gH625-Zn.sub.7MT3 for nitrification overnight at 65 C., the resultant product was tenfold diluted, and then the content of metal Zn was measured on an inductively coupled plasma optical emission spectrometer (ICP-OES). The results showed that per mole of recombinant gH625-Zn.sub.7MT3 fusion protein contained 70.2 moles of Zn.

    [0106] (6) Removal of Endotoxin from gH625-Zn.sub.7MT3

    [0107] GH625-Zn.sub.7MT3 was first subjected to an ultrafiltration membrane to entrap endotoxin (LPS) in aggregation state, and then subjected to Polymyxin B affinity column to remove the residual endotoxin.

    Embodiment 8: AD Model Mice and gH625-Zn.SUB.7.MT3 Drug Therapy

    [0108] APP/PS1 transgenic mice were purchased from Beijing Zhongke Zesheng Biotechnology Co., Ltd., 5 months old, weighing 24-26 g. Name of the test drug: gH625-Zn.sub.7MT3; solvent: normal saline; and preparation method: preparing the drug into a solution at the desired concentration with normal saline solution just before use. Intraperitoneal administration of mice: the experimental animals were APP/PS1 transgenic mice. The dosage was 2 mg/kg/day, and 6 weeks later, the blood serum and brain tissues were harvested.

    Embodiment 9: Verification of Cognitive Ability of AD Mice Using Morris Water Maze

    [0109] Installation: a round pool was used, having a diameter of 1 m, a height of 50 cm and water depth of 30 cm, and having a white bottom, and water temperature was maintained at 232 C. Four equally spaced points N, E, S and W were marked on the wall of the pool and served as the starting points of the test. The pool was divided into four quadrants, and a platform was placed in the center of the third quadrant (the platform was equidistant from the wall of the pool and the circle center). The platform was submersed in water at 1 cm depth, making the platform invisible. Lots of clues (triangles, squares, circles and rhombuses in different colors were placed in the quadrants) were arranged around the pool and the clues remained unchanged for use by the mice to position the platform.

    [0110] Place navigation test: the test lasted for 6 days, and training was performed for 4 times at fixed time periods every day. At the beginning of the training, the platform was placed in the first quadrant, and the mice were placed into the pool facing the wall of the pool from any of the four starting points on the wall of the pool. The time it took for the mice to find the platform and the swimming path of the mice were recorded by a free video recording system, and the four times of training referred to the four training sessions started by placing the mice in water from the four different starting points (different quadrants). After the mice found the platform or if the mice could not find the platform within 90 seconds (the latent period was set to 90 seconds), the experimenter directed the mice to the platform, the mice rested on the platform for 10 seconds, and then the next test was started.

    [0111] Spatial probe test: the platform was removed 24 h after the place navigation test was completed. The mice were then placed into water from the third quadrant, the swimming paths of the mice within 180 s were recorded, the residence time of the mice in the target quadrant (the third quadrant) and the frequency at which the mice crossed the original position of the platform were recorded, and the spatial positioning ability of the test mice was observed. The data were processed with SPSS10.0 software, and one-way ANOVA was adopted to verify and compare the distinctiveness of the effect of drug administration.

    [0112] The results showed that AD mice that had been treated with gH625-Zn.sub.7MT3 exhibited a remarkable improvement in cognitive ability. Compared with the control group, the AD mice in the drug administration group were significantly improved (from 50% to 78%) in the residence time in the third quadrant and the average frequency at which the mice crossed the original position of the platform, indicating that gH625-Zn.sub.7MT3 could effectively prevent the development of the disease of the AD mice.

    Embodiment 10: Regulation of gH625-Zn.SUB.7.MT3 on Cranial Nerve Cells of AD Mice

    [0113] After 6 weeks of administration (gH625-Zn.sub.7MT3 ), brain tissues of the AD mice were harvested, fixed in 4% paraformaldehyde, dehydrated, embedded in paraffin, cut into slices with a thickness of 4 microns by a microtome, and then stained with haematoxylin and eosin (HE); and thereafter the cellular morphology in CA1 region of hippocampus was observed under an optical microscope (Leica, Germany). The experimental results were as shown in FIG. 4 (A was a control group of normal mice, B was an AD mouse model group, and C was an AD mouse model administration group). The cells in CA1 region of the brain tissues of the AD model mice deformed and shrank, no chromatin or ribosome was observed, and the cellular morphology tended to be normal after administration of gH625-Zn.sub.7MT3. After the administration of gH625-Zn.sub.7MT3, the degeneration of the cranial nerve cells of the mice could be inhibited and the nerve cells were regulated to restore normal functions.

    Embodiment 11: Inhibition of gH625-Zn.SUB.7.MT3 on Aggregation of Amyloid Proteins in the Brain of AD Mice

    [0114] This experiment was thioflavine S staining experiment. The flow of the experiment was as follows: after 6 weeks of administration (gH625-Zn.sub.7MT3), brain tissues of the AD mice were harvested, then fixed, embedded in paraffin, sliced, dewaxed in xylene, dehydrated in gradient ethanol and washed with TBS for three times. 0.3% thioflavine S (dissolved in 50% ethanol) was dropped on the tissues, and the tissues were incubated at room temperature for 10 minutes, washed three times with 50% ethanol, washed with TBS, dried, mounted and then observed under a laser confocal microscope. The experimental results were as shown in FIG. 5. Thioflavine S itself has green fluorescence and can specifically bind to mature Abeta amyloid protein, and therefore can be used to label the content and distribution of amyloid protein in brain tissues so as to evaluate the pathological condition of the AD disease. The experimental results were as shown in FIG. 5 (A was a control group, B was an AD mouse model group, and C was an AD mouse model administration group). After administration, Abeta amyloid proteins were significantly reduced, as compared with the model group, which indicated that gH625-Zn.sub.7MT3 could remarkably decrease the deposition of Abeta proteins in the brain of the AD mice.

    Embodiment 12: Inhibition of gH625-Zn.SUB.7.MT3 on the Apoptosis of Cranial Nerve Cells of AD Mice

    [0115] The TUNEL apoptosis detection kit (G3250 kit) was purchased from Promega company. The brain tissues of the mice were harvested 6 week after administration, then fixed, embedded in paraffin, sliced, dewaxed in xylene, dehydrated in gradient ethanol, washed with TBS, incubated with protease K at room temperature for 10 min, sliced, washed with PBS, fixed with formaldehyde, added with an equilibration buffer for preequilibration, washed, then added with an incubation buffer (containing an equilibration buffer, a nucleoside mixture and rTdT enzyme) and incubated at 37 C. for 1 h in the dark, after the reaction was terminated, the resultant product was co-stained with DAPI, dried in the shade, mounted and photographed by a laser microscope. The results were as shown in FIG. 6 (A was a control group, B was an AD mouse model group, and C was an AD mouse model administration group). The results showed that gH625-Zn.sub.7MT3 could inhibit the apoptosis of cranial nerve cells of the mice.