ANTIBODY-DRUG CONJUGATE HAVING IMPROVED STABILITY AND USE THEREOF
20180360986 ยท 2018-12-20
Inventors
- Young Min Kim (Gyeonggi-do, KR)
- Min Ji Ko (Daejeon, KR)
- Jae Yong Kim (Seoul, KR)
- Ju Hee Kim (Daejeon, KR)
- Kyung Duk Moon (Daejeon, KR)
- Dae Hae Song (Daejeon, KR)
- Jae Hyun Eom (Sejong, KR)
- Jin Won Jung (Daejeon, KR)
Cpc classification
A61K47/6899
HUMAN NECESSITIES
A61K47/6851
HUMAN NECESSITIES
C07K2317/94
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/24
CHEMISTRY; METALLURGY
A61K47/6849
HUMAN NECESSITIES
A61P37/06
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
C07K16/2878
CHEMISTRY; METALLURGY
International classification
A61K47/68
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The present invention relates to an antibody-drug conjugate comprising a drug conjugated to an antibody, a preparation method thereof and the use thereof.
Claims
1. An antibody-drug conjugate comprising an immunosuppressive agent conjugated to the N-terminal amino acid residue of the heavy chain or light chain of an antibody, wherein the immunosuppressive agent is site-specifically conjugated to the N-terminal ?-amine group of native first amino acid of the heavy chain or light chain of the antibody, and the immunosuppressive agent is conjugated to the antibody by a linker having a reactive aldehyde group, and the conjugate is produced through reductive alkylation by the aldehyde group.
2. The antibody-drug conjugate of claim 1, wherein the antibody includes full-length antibodies or antibody fragments containing antigen binding domains.
3. The antibody-drug conjugate of claim 2, wherein the antibody is selected from the group consisting of IgG, scFv, Fv, Fab, Fab, and F(ab).sub.2.
4. The antibody-drug conjugate of claim 1, wherein the immunosuppressive agent is a cytokine antagonist.
5. The antibody-drug conjugate of claim 4, wherein the cytokine antagonist is an interleukin antagonist.
6. The antibody-drug conjugate of claim 1, wherein the immunosuppressive agent is a cytokine inhibitor.
7. The antibody-drug conjugate of claim 4, wherein the cytokine inhibitor is an interleukin inhibitor.
8. The antibody-drug conjugate of claim 1, wherein the antibody is selected from the group consisting of Trastuzumab, Lorvotuzumab, Brentuximab, and Glembatumumab.
9. A pharmaceutical composition for treating autoimmune disease, which comprises the antibody-drug conjugate of claim 1.
10. A method for preparing the antibody-drug conjugate of claim 1, the method comprising conjugating the immunosuppressive agent to the N-terminal ?-amine group of the heavy chain or light chain of the antibody, by reacting an antibody with an immunosuppressive agent containing a reactive group capable of crosslinking with an ?-amine group.
11. The method of claim 10, further comprising separating the antibody-drug conjugate from a reaction product including the antibody and the immunosuppressive agent.
12. The method of claim 10, wherein the reactive group capable of crosslinking with the ?-amine group is selected from the group consisting of isothiocyanate, isocyanate, acyl azide, NHS ester, sulfonyl chloride, aldehyde, glyoxal, epoxide, oxirane, carbonate, aryl halide, imidoester, carbodiimide, anhydride, and fluorophenyl ester.
13. A method for treating autoimmune disease, comprising administering the antibody-drug conjugate of claim 1 to a subject having autoimmune disease.
14. The method of claim 13, wherein the autoimmune disease is rheumatoid arthritis, systemic scleroderma, systemic lupus erythematosus, atomic dermatitis, psoriasis, alopecia areata, asthma, Crohn's disease, Behcet's disease, Sj?gren's syndrome, Guillain-Barre syndrome, chronic thyroiditis, multiple sclerosis, polymyositis, ankylsoing spondylitis, fibrositis, or polyarteritis nodosa.
15. The method of claim 13, wherein the antibody of the antibody-drug conjugate includes full-length antibodies or antibody fragments containing antigen binding domains.
16. The method of claim 13, wherein the antibody of the antibody-drug conjugate is selected from the group consisting of IgG, scFv, Fv, Fab, Fab, and F(ab).sub.2.
17. The method of claim 13, wherein the immunosuppressive agent of the antibody-drug conjugate is a cytokine antagonist.
18. The method of claim 17, wherein the cytokine antagonist is an interleukin antagonist.
19. The method of claim 13, wherein the immunosuppressive agent of the antibody-drug conjugate is a cytokine inhibitor.
20. The method of claim 19, wherein the cytokine inhibitor is an interleukin inhibitor.
21. The method of claim 13, wherein the antibody of the antibody-drug conjugate is selected from the group consisting of Trastuzumab, Lorvotuzumab, Brentuximab, and Glembatumumab.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
[0023]
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
BEST MODE FOR CARRYING OUT THE INVENTION
[0033] In one aspect, the present invention provides is directed to an antibody-drug conjugate comprising a drug conjugated to the N-terminal amino acid residue of the heavy chain or light chain of an antibody.
[0034] As used herein, the term antibody-drug conjugate (ADC) refers to the form in which a drug and an antibody are chemically conjugated to each other without reducing the biological activities of the antibody and the drugs. In the present invention, the term antibody-drug conjugate refers to the form in which the drug is conjugated to the N-terminal amino acid residue of the heavy chain and/or light chain of the antibody, particularly, the form in which the drug is conjugated to the N-terminal a-amine group of the heavy chain and/or light chain of the antibody. In the present invention, it was found that, when a drug was site-specifically conjugated to the N-terminus of the heavy chain or light chain among various regions of an antibody, the antibody-drug conjugate had excellent in vivo efficacy and stability and low toxicity, compared to previously reported antibody-drug conjugates, including antibody-drug conjugates formed by cysteine conjugation, antibody-drug conjugates formed by thiol conjugation, and antibody-drug conjugates formed by lysine conjugation, indicating that the N-terminus of the heavy chain or light chain of antibodies can be a site advantageous in terms of efficacy, stability and low toxicity. This schematic view of an antibody-drug conjugate according to the present invention is schematically shown in
[0035] As used herein, the term N-terminus refers to the amino terminus (N-terminus) of the heavy chain or light chain of an antibody, which is a site to which a drug can be conjugated for the purpose of the present invention. Examples of the N-terminus include, but are not limited to, not only amino acid residues at the distal end of the N-terminus, but also amino acid residues near the N-terminus. Specifically, the term N-terminus refers to the first amino acid residue of the heavy chain or light chain of an antibody, and more specifically, refers to the a-amine group of the first amino acid of the heavy chain or light chain of an antibody, but is not limited thereto.
[0036] The antibody-drug conjugate according to the present invention can have the advantage of guaranteeing homogeneity through the site-specific conjugation or number-specific conjugation between an antibody and a drug. Particularly, through the optimization procedure of the present invention, 1-8 drug moieties corresponding to the optimal drug-antibody ratio (DAR) can be conjugated to the N-terminal amino acid residue of each antibody molecule.
[0037] As used herein, the term homogeneity refers to the case in which the ratio and site of conjugation between two substances in a conjugate of the two substances are homogeneous. However, the term is intended to include not only the case in which the ratio and site of conjugation are completely homogeneous, but also the case in which a specific ratio and site of conjugation are predominant. When a conjugate has homogeneity, it is entirely homogeneous, and the dose-dependent efficacy thereof can be accurately measured, and thus the dose and number of administration thereof can be standardized.
[0038] As used herein, the term antibody means a protein molecule which comprises an immunoglobulin molecule immunologically reactive with a certain antigen, and which serves as a receptor that specifically recognizes the antigen. The term is intended to encompass polyclonal antibodies, monoclonal antibodies, full-length antibodies and antibody fragments containing antigen binding domains. A full-length antibody has two full-length light chains and two full-length heavy chains, in which each of the light chains is linked to the heavy chain by a disulfide bond. The full-length antibody comprises IgA, IgD, IgE, IgM and IgG, and subtypes of IgG include IgG1, IgG2, IgG3 and IgG4. The term antibody fragment refers to a fragment having an antigen-binding function, and is intended to include Fab, Fab, F(ab)2, scFv and Fv. Fab comprises light-chain and heavy-chain variable regions, a light-chain constant region, and a heavy-chain first constant domain (CH1), and has one antigen-binding site. Fab differs from Fab in that it has a hinge region including one or more cysteine residues at the C-terminus of the heavy-chain CH1 domain. An F(ab)2 antibody is formed by a disulfide bond between the cysteine residues of the hinge region of Fab. Fv means a minimal antibody fragment having only a heavy-chain variable region and a light-chain variable region. dsFv is has a structure in which a heavy-chain variable region and a light-chain variable region are linked to each other by a disulfide bond, and scFV generally has a structure in which a heavy-chain variable region and a light-chain variable region are covalently linked to each other by a peptide linker. These antibody fragments can be obtained using proteases (for example, Fab fragments can be obtained by digesting a full-length antibody with papain, and F(ab)2 fragments can be obtained by digesting a full-length antibody with pepsin). Preferably, these antibody fragments can be produced by a genetic recombinant technique. These antibody fragments can be obtained using proteases (for example, digestion of a whole antibody with papain or pepsin affords Fab or F(ab)2, respectively), and preferably may be constructed by genetic recombination techniques.
[0039] In addition, the antibody that is used in the present invention may be a natural antibody or a recombinant antibody. As used herein, the term natural antibody refers to an antibody that has undergone no genetic modification. The natural antibody may have a significantly low risk of immunogenicity, unlike antibodies genetically modified in vivo. As used herein, the term recombinant antibody means a genetically modified antibody which may have an antigen-binding activity or desired characteristic imparted by genetic modification.
[0040] As used herein, the term genetic modification refers to an action of changing the amino acid sequence of interest and is intended to include the modification of polypeptides having amino acid sequences that somewhat differ from the amino acid sequence of a native sequence polypeptide encoding the amino acid sequence of interest. Amino acid sequence variants contain an amino acid sequence having a substitution, deletion or insertion of one or more amino acid residues at one or more specific positions in a native amino acid sequence.
[0041] The antibody that is used in the present invention may be an antibody recognizing a cell surface antigen which is internalized into cells when binding to the antibody. For the purpose of the present invention, when an antigen is internalized into cells by binding to the antibody, a drug, particularly a cytotoxic drug, conjugated to the antibody, can enter the cells due to the characteristics of the antibody, and thus can exhibit high efficacy, but is not limited thereto.
[0042] In addition, the antibody that is used in the present invention may be an antibody that binds specifically to a cancer cell surface antigen or a surface antigen of a tissue in which an autoimmune disease has occurred.
[0043] As used herein, the term cancer cell surface antigen refers to either a substance that is not produced in normal cells or not exposed to the cell surface, or a substance that is exposed to the cell surface specifically in cancer cells, or s substance that is present more on the surface of cancer cells than on the surface of normal cells. When the substance of interest is recognized by the antibody, it is referred to as an antigen.
[0044] Specifically, the cancer cell surface antigen that is used I the present invention may be any cancer cell surface antigen that can be recognized specifically by the antibody of the present invention. Examples of the cancer cell surface antigen may include CD19, CD20, CD30, CD33, CD37, CD22, CD56, CD70, CD74, CD138, Muc-16, mesothelin, HER2, HER3, GPNMB(glycoprotein NMB), IGF-1R, BCMA(B cell maturation antigen), PSMA(prostate-specific membrane antigen), EpCAM(Epithelial cell adhesion molecule), and EGFR (epidermal growth factor receptor). More specifically, the cancer cell surface antigen may be any one selected from the group consisting of HER2, CD30, CD56, and GPNMB, but is not limited thereto. In an example of the present invention, Trastuzumab, a kind of anti-HER2 antibody, Lorvotuzumab, a kind of anti-CD56 antibody, Brentuximab, a kind of anti-CD30 antibody, and Glembatumumab, a kind of anti-GPNMB antibody, which recognize Her2, CD56 and GPNMB, were used as model antibodies.
[0045] As used herein, the term drug means any substance having cell-specific biological activity, and is intended to include compounds, DNA, RNA, peptides and the like. The term drug is intended to include not only substances containing a reactive group capable of crosslinking with an a-amine group, but also substances having a linker containing a reactive group capable of crosslinking with an a-amine group. In this case, the drug can bind site-specifically to the N-terminal amino acid residue of the antibody by the linker, but is not limited thereto.
[0046] The term linker refers to a chemical moiety comprising an atomic chain that allows the drug to bind covalently to the antibody. The linker is prepared in a state in which it is connected to the drug, and the end of the linker has a reactive group that can be linked to the antibody.
[0047] Examples of the reactive group capable of crosslinking with an ?-amine group include any reactive groups known in the art, which can crosslink with the N-terminal ?-amine group of the heavy chain or light chain of the antibody. Examples of the reactive group may include isothiocyanate, isocyanate, acyl azide, NHS ester, sulfonyl chloride, aldehyde, glyoxal, epoxide, oxirane, carbonate, aryl halide, imidoester, carbodiimide, anhydride, and fluorophenyl ester. More preferably, the reactive group is aldehyde or NHS ester, but not specifically limited thereto. Such reactive groups can be bound with the amine group by acylation or alkylation, but are not specifically limited thereto.
[0048] In particular, the antibody-drug conjugate of the present invention may be an immunoconjugate in which the drug connected with a linker having a reactive aldehyde group is conjugated to the N-terminal amino acid residue of the antibody in a site-specific and number-specific way.
[0049] The reactive aldehyde group is effective in site-specifically conjugating the drug to the N-terminal amino acid residue (particularly ?-amine) of the antibody while minimizing non-specific reactions. The final product produced through reductive alkylation by an aldehyde bond is much more stable than that linked by an amide bond. The reactive aldehyde group has the property of selectively reacting with the N-terminal ?-amine at low pH. Thus, the conjugate of the present invention has homogeneous in that the drug is site-specifically conjugated to the N-terminal ?-amine of the antibody. Thus, the present invention overcomes the problem of the prior art in which the uniform efficacy and quality of a drug cannot be guaranteed because of heterogeneity of the number and site of conjugations in conventional antibody-drug conjugates, but is not specifically limited thereto.
[0050] In an example of the present invention, the present inventors have found that, when a conjugation reaction is carried out at a pH of 6.0 or lower in order to conjugate a cytotoxic drug site-specifically to the ?-amine of an antibody, the conjugation of the cytotoxic drug to the ?-amine of lysine residues can be minimized.
[0051] The drug that is used in the present invention may be any substance that can induce the activation or inhibition of certain signaling pathways, including cell death, cell proliferation, immune activation and immune suppression. In particular, the drug may be a cytotoxic drug or an immunosuppressive agent.
[0052] As used herein, the term cytotoxic drug refers to any substance, for example, a compound, which has a cytotoxic or cell proliferation inhibitory effect. The term cytotoxic effect refers to the effect of inhibiting or reducing the function of cells to induce disruption of the cells, and the term cell proliferation inhibitory effect refers to the effect of limiting cell growth functions such as cell growth or cell proliferation.
[0053] Examples of the cytotoxic drug that is used in the present invention include chemotherapeutic agents, including microtubule structure formation inhibitors, meiosis inhibitors, RNA polymerase inhibitors, topoisomerase inhibitors, DNA intercalators, DNA alkylators and ribosome inhibitors, protein toxins that can function as enzymes, and radioisotopes. Examples of the cytotoxic drug may include maytansinoid, auristatin, dolastatin, tubulysin, calicheamicin, pyrrolobenzodiazepines, doxorubicin, duocamycin, carboplatin(paraplatin), cisplatin, cyclophosphamide, ifosfamide, nidran, [nitrogen mustard(mechlorethamine HCL)], bleomycin, mitomycin C, cytarabine, fluorouracil, gemcitabine, trimetrexate, methotrexate, etoposide, vinblastine, vinorelbine, alimta, altretamine, procarbazine, taxol, taxotere, topotecan, irinotecan, trichothecene, CC1065, alpha-amanitin, other enediyne antibiotics, exotoxin, and plant toxin. In addition, compounds include their stereoisomers and derivatives. Furthermore, the auristatin that is used in the present invention may be monomethyl auristatin E or monomethyl auristatin F, but is not limited thereto.
[0054] The term immunosuppressive agent refers to any compound having the effect of reducing immune responses. The term means a substance that can antagonize immune causing substances or that can inhibit substances (cytokines such as interleukins) which are involved in immune responses.
[0055] In an example of the present invention, Trastuzumab, Lorvotuzumab, Brentuximab and Glembatumumab were used as model antibodies, and monomethyl auristatin E ((MMAE)) or monomethyl auristatin F (MMAF) were used as cytotoxic drugs to be conjugated to the N-terminus of the antibodies (Examples 1 and 2). Trastuzumab was allowed to react with MMAF or MMAE at a pH of 6.0 to conjugate the drug to the N-terminus of the antibody, thereby preparing an antibody-drug conjugate. In the case of this antibody-drug conjugate, it was shown that the antigen binding activity of the antibody and the cytotoxic efficacy of the drug were maintained even after conjugation of the drug (Examples 3 to 5). In particular, this antibody-drug conjugate showed excellent stability in human serum in vitro compared to another antibody-drug conjugate (comparative conjugate) having a cysteine or lysine bond, and also showed excellent pharmacokinetics in an excellent pharmacokinetic experiment performed using rats (Example 6). In addition, this antibody-drug conjugate showed excellent anticancer activity compared to the comparative conjugate in anticancer animal models, but showed low toxicity similar to a control group in terms of weight, hepatotoxicity, blood and the like (Examples 7 and 8). Furthermore, results similar to the above-described results in terms of antigen binding activity, cytotoxicity and the like were obtained even when other drugs such as MMAE were used or when other antibodies such as Lorvotuzumab, Brentuximab and Glembatumumab were used (Example 9), indicating that the technology according to the present invention, in which a drug is conjugated to the N-terminus of the heavy chain or light chain of an antibody, can become a platform technology in the preparation of antibody-drug conjugates.
[0056] In another aspect, the present invention is directed to a method for preparing the antibody-drug conjugate.
[0057] The antibody-drug conjugate and its components are as described above.
[0058] Specifically, the method for preparing the antibody-drug conjugate comprises allowing an antibody to react with a drug containing a reactive group capable of crosslinking with an ?-amine group, thereby conjugating the drug to the N-terminal ?-amine group of the heavy chain or light chain of the antibody.
[0059] In addition, the method for preparing the antibody-drug conjugate may further comprise separating the antibody-drug conjugate from a reaction product including the antibody and the drug, which did not form the conjugate.
[0060] Specifically, in the preparation method, the antibody and the drug may be conjugated to each other at a pH of 4.0-6.5, more specifically 5.5-6.5, even more specifically 6.0. As described above, the present invention has an advantage in that specific conjugation between an aldehyde group present in the drug or its linker and the N-terminal ?-amine of the antibody can occur at low pH.
[0061] The process of separating the antibody-drug conjugate can be performed by various methods known in that art. For example, it can be performed by a chromatographic process including size exclusion chromatography, but is not specifically limited thereto.
[0062] In still another aspect, the present invention is directed to a composition comprising the antibody-drug conjugate.
[0063] The composition may be in the form of a pharmaceutical composition for treating cancer or autoimmune disease, which comprise the antibody-drug conjugate. In this case, the antibody may be an antibody that binds specifically to a cancer cell surface antigen or a surface antigen of a tissue in which autoimmune disease has occurred. The pharmaceutical composition of the present invention may further comprise a pharmaceutically acceptable carrier.
[0064] The antibody, the drug, the cancer cell surface antigen and the surface antigen of the tissue in which autoimmune disease has occurred are as described above.
[0065] As used herein, the term cancer includes all the kinds of cancers without limitations, but examples of the cancer may include esophageal cancer, stomach cancer, large intestine cancer, rectal cancer, oral cancer, pharynx cancer, larynx cancer, lung cancer, colon cancer, breast cancer, uterine cervical cancer, endometrial cancer, ovarian cancer, prostate cancer, testis cancer, bladder cancer, renal cancer, liver cancer, pancreatic cancer, bone cancer, connective tissue cancer, skin cancer, brain cancer, thyroid cancer, leukemia, Hodgkin's disease, lymphoma, and multiple myeloid blood cancer. A cancer that can be treated depending on the kind of an antigen specific to the cancer cell surface antigen may be selected.
[0066] The term autoimmune disease, as used herein, refers to any autoimmune disease that is targeted by the antibody-drug conjugate. Examples of the autoimmune disease include rheumatoid arthritis, systemic scleroderma, systemic lupus erythematosus, atomic dermatitis, psoriasis, alopecia areata, asthma, Crohn's disease, Behcet's disease, Sj?gren's syndrome, Guillain-Barre syndrome, chronic thyroiditis, multiple sclerosis, polymyositis, ankylsoing spondylitis, fibrositis, and polyarteritis nodosa.
[0067] As used herein, the term pharmaceutically acceptable carrier refers to a carrier or diluent that does not impair the biological activity and characteristics of an administered compound without irritating an organism. As a pharmaceutically acceptable carrier in a composition that is formulated as a liquid solution, a sterile and biocompatible carrier is used. The pharmaceutically acceptable carrier may be physiological saline, sterile water, Ringer's solution, buffered saline, albumin injection solution, dextrose solution, maltodextrin solution, glycerol, ethanol, or a mixture of two or more thereof. In addition, the composition of the present invention may, if necessary, comprise other conventional additives, including antioxidants, buffers, and bacteriostatic agents.
[0068] The carrier is not limited particularly, but for oral administration, the composition of the present invention can comprises binders, lubricants, disintegrants, excipients, emulsifiers, dispersions, stabilizers, suspending agents, pigments, perfumes, etc., for injection administration, the composition of the present invention can comprises buffers, preservatives, analgesics, emulsifiers, isotonic agents, stabilizers, etc., and for local administration, the composition of the present invention can comprises bases, excipients, lubricants, preservatives, etc., can be used.
[0069] The inventive composition can be formulated with a pharmaceutically acceptable carrier as described above in various manners. For example, for oral administration, the composition of the present invention can be formulated in the form of tablet, troche, capsule, elixir, suspension, syrup, wafer, etc., and for injection administration, the composition can be formulated as a unit dosage ampoule or a multiple dosage form. The composition can also be formulated as solution, suspension, tablet, pill, capsule, sustained-release formulation, etc.
[0070] In the meantime, examples of carrier, excipient or diluent suitable for the formulation of the composition may include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, acacia rubber, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, methyl cellulose, microcrystalline cellulose, polyvinylpyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, magnesium stearate and mineral oils. In addition, the composition of the present invention may additionally contain fillers, anti-aggregating agents, lubricants, wetting agents, perfumes, and preservatives.
[0071] In addition, the pharmaceutical composition of the present invention may include any one formulation selected from the group consisting of tablets, pills, powders, granules, capsules, suspensions, internal solutions, emulsions, syrups, sterilized aqueous solutions, non-aqueous solvents, suspensions, emulsions, lyophilized agents, and suppositories according to a conventional method.
[0072] In addition, the conjugate may be used in a mixture with various pharmaceutically acceptable carriers such as physiological saline or organic solvents. To increase the stability or absorption property of the conjugate, the conjugate may be used in combination with carbohydrates such as glucose, sucrose or dextran, antioxidants such as ascorbic acid or glutathione, chelating agents, low-molecular-weight proteins, or stabilizers.
[0073] In yet another aspect, the present invention is directed to a method of treating cancer or autoimmune disease using the antibody-drug conjugate or the composition. The antibody may be an antibody that binds specifically to a cancer cell surface antigen, and the drug may be a drug for treating cancer. In addition, the antibody may be an antibody that binds specifically a surface antigen of a tissue in which autoimmune disease has occurred, and the drug may be a drug for treating autoimmune disease.
[0074] The antibody and the drug are as described above.
[0075] The method may be a method for treatment of cancer or autoimmune disease, which comprises administering the pharmaceutical composition to a subject in need of the treatment. The antibody-drug conjugate and carriers that are used in the method are as described above.
[0076] The composition may be administered as single or multiple doses in a pharmaceutically effective amount. In this case, the composition may be administered in the form of liquid, powder, aerosol, capsule, enteric-coated tablet, or suppository. The composition of the present invention can be administered intraperitoneally, intravenously, intramuscularly, subcutaneously, transdermally, orally, topically, intranasally, intrapulmonarily or intrarectally, but is not limited thereto. However, because the protein antibody is digested when administered orally, the active ingredient in the composition for oral administration should be coated or formulated so as to be protected from degradation in the stomach. In addition, the pharmaceutical composition may be administered by any device by which the active ingredient may be delivered to target cells. Furthermore, the pharmaceutical composition of the present invention may be administered individually or in combination with other therapeutic agents, and may be administered sequentially or simultaneously with conventional therapeutic agents.
[0077] The composition comprising the antibody-drug conjugate of the present invention is administered in a pharmaceutically effective amount. As used herein, the term pharmaceutically effective amount refers to an amount sufficient to treat or prevent the disease at a reasonable benefit/risk ratio applicable for medical treatment or prevention, and an effective dosage level can be determined according to the severity of disease, the activity of the drug, the patient's age, weight, health conditions, gender, and sensitivity to the drug, time of administration, route of administration and the discharge rate, duration of treatment, combination with the composition of the present invention used, or well-known elements and elements in other medical fields, including drugs used simultaneously.
[0078] In a further aspect, the present invention is directed to a method for screening an antibody suitable for use in preparation in the antibody-drug conjugate.
[0079] In the preparation of the antibody-drug conjugate according to the present invention, an antibody suitable for use in effectively preparing the antibody-drug conjugate by conjugating a drug to the N-terminus (particularly ?-amine) of the antibody can be screened and selected.
EXAMPLES
[0080] Hereinafter, the present invention will be described in further detail with reference to examples. It will be obvious to a person having ordinary skill in the art that these examples are illustrative purposes only and are not to be construed to limit the scope of the present invention. Thus, the substantial scope of the present invention will be defined by the appended claims and equivalents thereof.
Example 1: Selection of Model Antibodies
[0081] In the preparation of an antibody-cytotoxin conjugate representative of the antibody-drug conjugate of the present invention, the anti-HER2 antibody Trastuzumab, the anti-CD56 antibody Lorvotuzumab, the anti-CD30 antibody Brentuximab and the anti-GPNMB (glycoprotein NMB) antibody Glembatumumab were used as model antibodies in order to examine whether cytotoxin having a linker would be site-selectively conjugated to the antibodies.
[0082] The above antibodies were constructed into expression vectors using known amino acid sequence information, and a stable cell line was constructed from the CHO cell line. Alternatively, the antibodies were expressed transiently, incubated and purified.
Example 2: Synthesis of Toxin
[0083] Monomethyl auristatin F (MMAF) toxin having an aldehyde linker connected to the end was synthesized (LegoChem Biosciences or XcessBioscience) (
Example 3: Preparation of Monoclonal Antibody-Cytotoxin Conjugate
[0084] 3-1: Preparation of Monoclonal Antibody-Drug Conjugate According to the Present Invention
[0085] An antibody was diluted in 100 mM potassium phosphate buffer (pH 5.49) and concentrated to about 7.1 mg/ml. Next, MMAF (LegoChem Biosciences, Korea) connected with a linker having an aldehyde reactive group was dissolved in 50% DMSO (dimethyl sulfoxide) solvent to a concentration of 2.5 mg/ml. Thereafter, the prepared antibody solution and MMAF solution were mixed with each other so as to achieve the following conditions: final 70 mM potassium phosphate (pH 6.0); antibody concentration: 5.0 mg/ml; 14% DMSO; MMAF concentration: 0.3 mg/ml; and the molar ratio between the ?-amine of the antibody and MMAF: about 1:2.3 (or the molar ratio between the antibody and MMAF is 1:9). NaCNBH.sub.3 (Sigma, USA) was added to the reaction solution to a final concentration of 20 mM, and then reacted at 4? C. for 12 hours with gentle stirring. To separate unreacted antibody and unreacted MMAF connected with the linker, a Sephadex G-25 column (GE Healthcare, USA) or a resource phenyl column (Resource Phe, GE Healthcare, USA) was used. According to this process, a conjugate was prepared in which about three MMAF toxin molecules per antibody molecule were selectively conjugated to the amino terminus of the antibody (
[0086] 3-2: Preparation of Control Antibody-Drug Conjugate
[0087] According to a conventional technology, a control antibody-drug conjugate was prepared by cysteine conjugation (Thiomab (HC-A114C)+Mal-C6-MMAF), thiol conjugation (Mal-C6-MMAF) or lysine conjugation (SMCC linker, SH-C6-MMAF).
[0088] To prepare a thiol-conjugated antibody, an antibody was reduced with TCEP at a pH of 8.0, and then Mal-C4-MMAF was added thereto and allowed to react at 0? C. for 3 hours. After the reaction, thiol was added to the reaction product which was then further reacted. After termination of the reaction, replacement with 1?PBS using a G25 desalting column (GE healthcare, USA) was performed to complete the reaction.
[0089] To prepare a cysteine-conjugated antibody, cysteine in a purified antibody was activated, and then Mal-C6-MMAF was added thereto, and conjugation was performed according to a process similar to that used in the preparation of the thiol-conjugated antibody.
[0090] A conjugate comprising a lysine-conjugated antibody was prepared with reference to International Patent Publication No. WO2005037992 (Immunogen). First, an antibody was reacted with an SMCC linker, and unreacted SMCC was removed by buffer exchange. The antibody-SMCC conjugate was reacted with SH-C4-MMAF (Concortis bioscience, USA) containing a thiol group, thereby preparing an antibody-SMCC-MMAF conjugate.
[0091] The antibody-cytotoxin conjugates prepared by ?-amine conjugation according to the present invention are summarized in Table 1 below.
TABLE-US-00001 TABLE 1 Antibody-drug conjugates Conjugate name (when Conjugation Trastuzumab and MMAF type Conjugation conditions are used) Cys Thiomab (HC A114C), Mal-C6- Thiomab-MMAF conjugation MMAF Thiol Mal-C6-MMAF T-C-MMAF conjugation Lys SMCC linker, SH-C6-MMAF T-K-MMAF conjugation Amine ALD-C6-MMAF (weakly acidic T-N-MMAF conjugation pH)
[0092] The four conjugates prepared as described above were analyzed to determine the DAR (drug antibody ratio) and the site of conjugation. The analysis was performed by LC-MS and peptide mapping.
Example 4: Physicochemical Properties and Biological Properties
[0093] 4-1: Analysis of Molecular Weight
[0094] The molecular weights of the antibody-drug conjugates (T-N-MMAF) were determined by LC-MS analysis. The theoretical molecular weight of the drug (MMAF) used is 824.54 Da, and the molecular weight of Trastuzumab is 145 kDa. Thus, the conjugation of the drug to the antibody and the number of drug moieties conjugated to one antibody molecule could be simultaneously determined by mass spectrometry.
[0095] To determine the DAR of T-N-MMAF prepared in Example 3, the molecular weight of T-N-MMAF was analyzed by LC/MS. The prepared sample was treated with PNGaseF to remove sugar chains, and then separated through an ACQUITY UPLC BEH 200 SEC column, after which the sample was injected into the Waters Synapt G2-S system to analyze the mass. The results of the analysis are shown in
[0096] As a result, as shown in
TABLE-US-00002 TABLE 2 No. of Relative bound drug Mass (Da) intensity(%) Da 0 145179.5 1.8 1 146005.3 10.7 825.8 2 146833.2 21.2 827.9 3 147661.1 25.4 827.9 4 148488.9 21.0 827.8 5 149317.0 12.5 828.1 6 150145.5 5.0 828.5 7 150964.2 2.3 818.7 DAR 3.219 DAR = Sum(Intensity(%) ? No. of Drug/100) Drug moiety mass: 828 Da
[0097] 4-2: Site of Conjugation of Drug
[0098] The site of conjugation of the drug in the prepared T-N_MMAF conjugates was determined by peptide mapping. T-N-MMAF ADC (having a DAR of 3.2) prepared in Example 3 was treated with Rapigest (Waters), and then treated with trypsin (Roche) to make fragments. The reaction product was separated through an ACQUITY UPLC PST (BEH) C18 column, and the separated peaks were subjected to mass spectrometry through the Waters Synapt G2-S Q/TOF system to determine the sequence of the reaction product. The results of the analysis are shown in
[0099] As a result, as shown in
TABLE-US-00003 TABLE 3 Trypsin fragment Ratio Heavy EVQLVESGGGLVQPGGSLR (SEQ ID NO: 1) 46% chain-N- terminus Light DIQMTQSPSSLSASVGDR (SEQ ID NO: 2) 29% chain-N- terminus Heavy THTCPPCPAPELLGGPSVFLFPPKPKDTLMISR 17% chain-CH2 (SEQ ID NO: 3) Others 8%
[0100] 4-3: Analysis of Purity
[0101] To determine the aggregate content of the prepared T-N-MMAF conjugate, purity analysis of the conjugate was performed by SE-HPLC and SDS-PAGE analysis. Size exclusion chromatography was used in a TSK-Ge13000SWXL column using PBS as a mobile phase, and SDS-PAGE was performed using 4-12% Novex NuPAGE gel. The results of the chromatography are shown in
[0102] As a result, as shown in
[0103] 4-4: Antigen Binding Activity
[0104] In order to examine the antigen binding activity of the antibody is maintained even after the drug was conjugated thereto, the antigen binding activity of the drug-conjugated antibody was measured by a method of measuring surface plasmon resonance using Biacore?. As a control antibody, a natural antibody was used. The antigen (ErbB2) binding activity was analyzed using Biacore T200, and each antibody was immobilized on a CM5 sensor chip (GE healthcare, USA) using an amine coupling kit, after which kD (M) was calculated by measuring and analyzing on/off rate while injecting ErbB2 at concentrations of 50, 16.67, 5.56, 1.85, 0.62 and 0.21 nM and at a rate of 30 uL/min.
TABLE-US-00004 TABLE 4 Antigen binding activity Samples Test 1 (10.sup.?10 M) Test 2 (10.sup.?10 M) Average (10.sup.?10 M) Trastuzumab 1.3 2.2 1.8 T-N-MMAF 1.2 0.9 1.1 (DAR 1.6) T-N-MMAF 1.1 0.7 0.9 (DAR 3.2)
[0105] As a result, as summarized in Table 4 above, it was found that an antigen binding activity of about 0.1 nM similar to that of the natural antibody was maintained even after drug conjugation regardless of the DAR.
Example 5: In Vitro Cytotoxicity Analysis
[0106] In order to examine the in vitro efficacy of the prepared antibody-cytotoxin conjugate, an anti-proliferation assay was performed using BT474, HCC1954, SKOV-3, JIMT-1 cell lines which are HER2-expressing tumor cell lines. Each of the cell lines was cultured and suspended at a concentration of 1?10.sup.5 cells/ml, and 100 of the suspension was loaded into each well of a 96-well plate. The cells were incubated in an incubator for 3 hours, and then 100
of the antibody-cytotoxin conjugate diluted to various concentrations was added to each well of the plate and incubated in an incubator for 4 days. A 1:10 dilution of CCK-8 (Dojindo) was added to each well of the plate, which was then covered with a foil and incubated in an incubator for 2-5 hours. Next, the absorbance of each well at 450 nm was measured using a SpectraMax 190 microplate reader (Molecular Device).
TABLE-US-00005 TABLE 5 Cytotoxicity (IC.sub.50 (pM)) T-N-MMAF T-C-MMAF T-K-MMAF Cell line (DAR 3.2) (DAR 3.6) (DAR 3.9) HCC1954 40 22 45 SKOV-3 104 59 N.D. JIMT1 253 98 727 BT474 116 49 77
[0107] As a result, as shown in Table 5 below, T-N-MMAF showed cytotoxicity slightly lower than T-C-MMAF in all the four cancer cell lines, but a significant decrease in cytotoxicity, which can influence in vivo efficacy, was not observed.
Example 6: Stability Test
[0108] 6-1: Stability in Human Serum In Vitro
[0109] Using T-N-MMAF prepared in Example 3 and control antibodies, including a natural antibody, T-C-MMAF and Thiomab-MMAF, a stability test in human serum in vitro was performed. The antibody-cytotoxin conjugate was buffer-exchanged with 1?PBS and concentrated to 3.33 mg/ml, and then mixed with human serum (Sigma, USA) at a ratio of 1:9 (v/v) and allowed to stand at 37? C. for 7 days. After 7 days, to remove proteins other the stored sample was treated with MabSelectSure (GE healthcare, USA) than the antibody-cytotoxin conjugate contained in the sample in order to minimize interference in LC/MS analysis. The stability of the conjugate in human serum in vitro was analyzed by LC/MS, and the results of the analysis are shown in Table 6 below.
TABLE-US-00006 TABLE 6 Relative content of Relative monoclonal content of Relative antibody conjugate content of DAR (7 days of (7 days of (7 days of Samples storage, %) storage, %) storage, %) Trastuzumab 90.0 T-N-MMAF 89.3 90.5 101.4 T-C-MMAF 49.2 32.3 65.6 Thiomab-MMAF 69.9 59.5 85.1
[0110] As a result, as can be seen in Table 6 above, the changes in the content and DAR of T-N-MMAF compared to the control natural antibody after 7 days of storage were not observed. However, in the case of T-C-MMAF and Thiomab-MMAF, which are the comparative antibody-drug conjugates, decreases in the total antibody content and the DAR could be observed.
[0111] 6-2: Rat Pharmacokinetics (PK)
[0112] In vivo stability was compared and analyzed through a rat pharmacokinetic experiment. Each of three ADCs (T-K-MMAF, T-C-MMAF, and T-N-MMAF) and Trastuzumab were injected intravenously once to female Sprague-Dawley rats at a dose of 2.5 mg/kg. At 0.05, 0.5, 1, 6, 24, 72, 168, 240 and 336 hours after administration of the substances, blood was collected. A total antibody assay of analyzing all antibodies binding to ErbB2 in blood and a conjugated antibody assay of analyzing an antibody maintaining drug conjugation were performed by an ELISA method.
[0113] The total antibody content was analyzed by an ELISA method as follows.
[0114] A 96-well microplate was coated with ErbB2 (R&D systems), and then a sample was added to the plate and incubated at a temperature of 37r for 1 hour. The plate was washed with PBST to remove all non-fixed substances, and then the absorbance of the plate at 450 nm was measured using HRP-conjugated anti-human kappa light chain antibody and 3,3,5,5-tetramethylbenzidine (TMB, Sigma, 10440), thereby determining the total antibody content of the sample.
[0115] The conjugated antibody assay was performed by a method similar to the above-described method. Specifically, a 96-well microplate was coated with anti-MMAF antibody (Young In Frontier), and then a sample was added to the plate and incubated at a temperature of 37r for 1 hour. Next, biotinylated ErbB2 (ACROBIOSYSTEMS, USA), streptavidin-HRP and TMB were sequentially added to the plate to develop color, and then the absorbance of the plate at 450 nm was measured to determine the concentration of the conjugated antibody. The results of the measurement are shown in
TABLE-US-00007 TABLE 7 PK parameters measured after administering ADCs to rats at a dose of 2.5 mg/kg Treatment (n = 5, each) Total Ab Conjugated Ab 2-compartment AUC T.sub.1/2 C.sub.max AUC T.sub.1/2 C.sub.max modeling (hr*?g/ml) (hr) (?g/ml) (hr*?g/ml) (hr) (?g/ml) Trastuzumab 6964.9 115.7 128.1 T-N-MMAF 6795.7 122.1 111.2 6813.2 118.3 112.4 T-C-MMAF 5933.5 111.6 94.3 4315.4 84.6 93.7 T-K-MMAF 4324.3 65.1 157.5 3781.7 53.2 190.0
Example 7: Test for Anticancer Effect in Anticancer Model Animals
[0116] In order to examine the efficacy of three ADCs prepared by different techniques and the difference in efficacy by drug-antibody ratio (DAR), an in vivo efficacy test was performed in breast cancer (HCC 1954) xenograft models using nude rats.
[0117] Each of four ADCs, that is, T-N-M (DAR: about 1.6 and 3.2), T-C-M (DAR: about 3.7) and T-K-M (DAR: about 3.9), was administered intravenously once to HCC1954 cell-transplanted rats at a dose of 1 mg/kg, and then the degree of inhibition of growth of the transplanted tumor was compared between the test groups. The results are shown in
[0118] As a result, as shown in
Example 8: Toxicity Test
[0119] In order to examine whether stability varying depending on the technique for preparation of ADCs influences toxicity, a single-dose toxicity test was performed using SD rats. Each of three ADCs was administered intravenously once at a high dose of 200 mpk. As comparative groups, an antibody alone and MMAF were administered at a dose of 200 mpk. The weight was measured everyday during a period ranging from the time point of administration of the test substance to the end of the test (day 12). Biochemical analysis of the blood was performed at 5 days after administration. Measurement items were AST and ALT for determining hepatotoxicity and typical hematological toxicity, neutrophils and platelets.
[0120] 8-1: Change in Weight
[0121] The results of measurement of changes in the weight are shown in
[0122] 8-2: Biochemical Analysis (Hepatotoxicity)
[0123] In order to examine whether the ADCs cause hepatotoxicity, biochemical analysis of blood collected at day 5 after administration of the ADCs was performed. The analysis was performed using the Au480 clinical analyzer (Beckman Coulter, USA), and the levels of AST (aspartate aminotransferase) and ALT (alanine aminotransferase) indicative of hepatotoxicity were measured. The results of the measurement are shown in
[0124] As a result, as shown in
[0125] 8-3: Hematological Analysis (Neutropenia and Thrombocytopenia)
[0126] Because the major clinical toxicities of currently approved ADCs indicate the hematological properties, hematological analysis of blood collected at day 5 after administration of the ADCs was performed using the Hemavet 950 FS hematological analyzer (Drew Scientific Inc., USA). The results of the analyzer are shown in
[0127] As a result, as shown in
[0128] The number of platelets was noticeably smaller than in the T-N-MMAF group than in other control groups including PBS. However, the T-C-MMAF and T-K-MMAF groups showed a significant decrease in the number of platelets, indicating that abrupt toxicity was caused by administration of the drugs.
Example 9: Examination of Platform Function
[0129] Whether the method for preparing the antibody-drug conjugate according to the present invention can be applied to various antibody-drug conjugates was examined. For this, the method was applied to various drugs or antibodies and various antibody forms in order to examine the function thereof.
[0130] 9-1: Examination of Function According to Type of Drug
[0131] In order to determine whether the method for preparing the antibody-drug conjugate according to the present invention can be applied to various drugs, N-terminal conjugation of various drugs was performed using Trastuzumab as a model antibody. Specifically, two drugs (MMAF and MMAE) were used, and the results obtained using MMAF are as described in the Examples above. Antibody-drug conjugates were prepared according to the method described in Example 1, and the DAR analysis, in vitro stability and rat PK of the prepared antibody-drug conjugates were performed according to the methods described in the Examples above.
[0132] 9-1-1: Preparation of T-N-MMAE
[0133] According to a conjugate between MMAE (XcessBioscience, USA) and an antibody was prepared. To determine the DAR of the conjugate, the molecular weight of the conjugate was analyzed by LC/MS, and the results of the analysis are shown in
TABLE-US-00008 TABLE 8 Chemical species distribution by DAR of T-N-MMAE and average DAR No. of Relative Delta drug Mass (Da) content (%) mass D0 N/D N/D D1 146061.05 6.3 D2 146863.77 14.3 802.72 D3 147672.80 23.3 809.03 D4 148484.33 24.2 811.53 D5 149297.30 16.5 812.97 D6 150112.25 8.6 814.95 D7 150922.84 6.8 810.59 DAR 3.83
[0134] 9-1-2: Analysis of Stability of T-N-MMAE in Human Serum
[0135] According to the method of Example 6, the stability of T-N-MMAE ADC in serum was evaluated. The concentration of ADC in each sample was measured by the total antibody assay using ELISA, and a change in the DAR was measured by LC/MS.
TABLE-US-00009 TABLE 9 ?g/ml % DAR % Day 0 364.8 100% 3.17 100% Day 3 346.9 95% 3.33 105% Day 7 294.8 81% 3.28 103%
[0136] 9-1-3: Rat PK of T-N-MMAE
[0137] In order to evaluate the in vivo stability of the prepared MMAE conjugate, a PK study in SD rats was performed according to a method similar to that of Example 6. Shortly, 2.5 mg/pk of the ADC was administered to female SD rats. At 12 min, 30 min, 1 hour, 6 hour, 24 hours, 3 days, 7 days, 10 days, 14 days, 17 days and 21 days after administration of the ADC, blood was collected from the rats, and the concentrations of total protein and conjugated antibody in the blood were measured according to the above-described methods using an ELISA technique.
TABLE-US-00010 TABLE 10 Rat PK parameters of T-N-MMAE AUC Conjugate/ half-life Conjugate/ Group (hr*?g/ml) Total ratio (hr) Total ratio trastuzumab 5868.83 169.6 T-N-MMAF (T) 6688.95 191.8 T-N-MMAF (C) 6871.71 103% 203.3 106% T-N-MMAE (T) 5639.24 173.9 T-N-MMAE (C) 5690.96 101% 163.7 94% * Trastuzumab and T-N-MMAF were included for comparison between tests.
[0138] As a result, as shown in
[0139] 9-1-4: Activity of T-N-MMAE
[0140] In order to determine the biological activity of the prepared MMAE conjugate, the activity thereof was measured using four different tumor cell lines. The results of the measurement are shown in Table 11 below. The method used was similar to that used in Example 5.
TABLE-US-00011 TABLE 11 Cytotoxicity of T-N-MMAE for HER2-expressing tumor cell lines IC.sub.50[nM] #1 #2 Average HCC1954 0.39 0.26 0.33 SKOV-3 3.04 2.62 2.83 JIMT1 4.00 3.51 3.76 BT474 0.56 0.70 0.63
[0141] As a result, the measured IC50 was in the range of 0.33-3.76 nM, which was similar to the activity (0.47 nM) of the BT474 cell line against the Trastuzumab/MMAE thiol conjugate reported in the literature. This suggests that the method for selective conjugation to the N-terminal ?-amine according to the present invention can also be applied to other types of drugs.
[0142] 9-2: Examination of Function According to Type of Antibody
[0143] In order to examine whether the method for preparing the antibody-drug conjugate according to the present invention can be applied to various antibodies, N-terminal conjugation to three anticancer antibodies (Brentuximab, Lorvotuzumab, Glembatumumab) was performed, and the DAR and in vitro stability of the conjugates were measured.
[0144] 9-2-1: Brentuximab
[0145] 9-2-1-1: Preparation of Brentuximab-N-MMAF
[0146] Using Brentuximab expressed from the CHO cell line, Brentuximab-N-MMAF (B-N-MMAF) was prepared according to the method of Example 3. The prepared ADC showed the LC/MS profile shown in
TABLE-US-00012 TABLE 12 No. of Relative Delta mass bound drug Mass (Da) content (%) (Da) D0 145208.6 3.1 D1 146034.9 14 826.3 D2 146863.3 24.4 828.4 D3 147692 26.4 828.7 D4 148520.7 18.2 828.7 D5 149349.7 9.3 829 D6 150177.5 4.7 827.8 DAR 2.90
[0147] 9-2-1-2: Ligand Binding Assay
[0148] In order to determine whether the properties of the antibody are changed by conjugation, the activity of binding of the antibody to an antigen was measured by an ELISA technique. Specifically, 100 ?g of the antigen CD30 (R&D Systems) was coated on a 96-well microplate, and then blocked with 1% BSA at 37? C. for 1 hour. After the blocking solution was removed, a sample was added to the plate and incubated at 37? C. for 1 hour. The plate was washed five times with PBST (PBS+0.05% tween 20), and then a 1000-fold dilution of HRP-conjugated anti-human kappa light-chain antibody was added to the plate and incubated at 37? C. for 1 hour. The plate was washed five times with PBST, and then TMB (Sigma) was added to the plate which was then subjected to color development for 10 minutes. 1N H.sub.2SO.sub.4 was added to the plate to stop the reaction, and then the absorbance of the plate at 450 nm was measured. The results of the measurement are shown in
[0149] 9-2-1-3: In Vitro Cytotoxicity
[0150] To determine the in vitro efficacy of the prepared antibody-cytotoxin conjugate, an anti-proliferation assay was performed using Karpas-299 and L-540 cell lines that are CD30-expressing cell lines.
[0151] Specifically, each of the cell lines was cultured and suspended at a concentration of 1?10.sup.5 cells/ml, and 100 of the suspension was loaded into each well of a 96-well plate. The cells were incubated in an incubator for 3 hours, and then 100
of the antibody-cytotoxin conjugate diluted to various concentrations was added to each well of the plate which was then incubated in an incubator for 4 days. A 1:10 dilution of CCK-8 (Dojindo) was added to each well of the plate, which was then covered with a foil and incubated in an incubator for 2-5 hours. Next, the absorbance of each well at 450 nm was measured using a SpectraMax 190 microplate reader. The results of the measurement are shown in Table 13 below.
TABLE-US-00013 TABLE 13 Cell line IC.sub.50(pM) Karpas-299 32.2 L-540 37.1
[0152] As a result, a cytotoxicity lower than 40 pM was observed in all the two cell lines (Karpas-299 and L-540).
[0153] 9-2-2: Lorvotuzumab
[0154] 9-2-2-1: Preparation of Lorvotuzumab-N-MMAF
[0155] Using Lorvotuzumab expressed transiently from CHO cells, Lorvotuzumab-N-MMAF (L-N-MMAF) was prepared according to the method of Example 3. As a result, the prepared ADC showed the conjugation profile shown in
TABLE-US-00014 TABLE 14 No. of Relative Delta mass bound drugs Mass (Da) content (%) (Da) D0 147001.5 3.3 D1 147830.8 10.8 829.3 D2 148657.9 18.6 827.1 D3 149486.6 22.7 828.7 D4 150315.4 20.1 828.8 D5 151144.7 13.7 829.3 D6 151973.5 7 828.8 D7 152803 3.7 829.5 DAR 3.329
[0156] 9-2-2-2: Ligand Binding Assay
[0157] In order to determine whether the properties of the antibody are changed by conjugation, the activity of binding of the antibody to an antigen before and after conjugation was measured by an ELISA technique. Specifically, 100 ?g of the antigen CD30 (R&D Systems, 2408-NC-050) was coated on a 96-well microplate at a concentration of 1 pg/ml, and then blocked with 1% BSA at 37? C. for 1 hour. After the blocking solution was removed, a test sample was added to the plate and incubated at 37? C. for 1 hour. The plate was washed five times with PBST (PBS+0.05% tween 20), and then a 1000-fold dilution of HRP-conjugated anti-human kappa light-chain antibody was added to the plate and incubated at 37? C. for 1 hour. The plate was washed five times with PBST, and then TMB (Sigma) was added to the plate which was then subjected to color development for 10 minutes. 1N H.sub.2SO.sub.4 was added to the plate to stop the reaction, and then the absorbance of the plate at 450 nm was measured. The results of the measurement are shown in
[0158] 9-2-2-2: In Vitro Cytotoxicity
[0159] To determine the in vitro efficacy of the prepared antibody-cytotoxin conjugate, an anti-proliferation assay was performed using an OPM-2 cell line. Specifically, the cell line was cultured and suspended at a concentration of 1?10.sup.5 cells/ml, and 100 of the suspension was loaded into each well of a 96-well plate. The cells were incubated in an incubator for 3 hours, and then 100
of the antibody-cytotoxin conjugate diluted to various concentrations was added to each well of the plate which was then incubated in an incubator for 4 days. A 1:10 dilution of CCK-8 (Dojindo) was added to each well of the plate, which was then covered with a foil and incubated in an incubator for 2-5 hours. Next, the absorbance of each well at 450 nm was measured using a SpectraMax 190 microplate reader. The results of the measurement are shown in Table 15 below.
TABLE-US-00015 TABLE 15 IC.sub.50 [nM] OPM-2 L-N-MMAF DAR 2.5 52.9 L-N-MMAF DAR 3.3 41.9
[0160] As can be seen in Table 15 above, the L-N-MMAF antibody according to the present invention showed a cytotoxicity of about 42-53 nM.
[0161] 9-2-3: Glembatumumab
[0162] 9-2-3-1: In Vitro Cytotoxicity
[0163] To determine the in vitro efficacy of the prepared antibody-cytotoxin conjugate, an anti-proliferation assay was performed using a SK-MEL-2 cell line that is a skin cancer cell line. Specifically, the cell line was cultured and suspended at a concentration of 1?10.sup.5 cells/ml, and 100 of the suspension was loaded into each well of a 96-well plate. The cells were incubated in an incubator for 3 hours, and then 100
of the antibody-cytotoxin conjugate diluted to various concentrations was added to each well of the plate which was then incubated in an incubator for 4 days. A 1:10 dilution of CCK-8 (Dojindo) was added to each well of the plate, which was then covered with a foil and incubated in an incubator for 2-5 hours. Next, the absorbance of each well at 450 nm was measured using a SpectraMax 190 microplate reader. The results of the measurement are shown in Table 16 below.
TABLE-US-00016 TABLE 16 SK-MEL-2 IC.sub.50(nM) G-N-MMAF DAR 2.2 5.47 G-N-MMAF DAR 3.4 3.36
[0164] As can be seen in Table 16 above, the G-N-MMAF according to the present invention showed a cytotoxicity of about 3-5 nM.
[0165] The above-described results suggest that a new platform of the antibody-drug conjugate prepared by site-specific conjugation of the drug to the N-terminal amino acid residue of the heavy chain or light chain of the antibody shows no reduction in the target specificity of the antibody while having high stability and also that the therapeutic effect of the antibody can be doubled by the drug conjugated thereto.
[0166] From the foregoing, it will be understood by those skilled in the art to which the present invention pertains that the present invention can be carried out in other concrete embodiments without changing the technical spirit or essential feature thereof. In this regard, it should be understood that the aforementioned examples are of illustrative in all aspects but not is limited. The scope of the present invention should be construed to include the meaning and scope of the appended claims, and all the alterations and modified forms which are derived from the equivalent concept thereof, rather than the detailed description.