COMPOSITIONS AND METHODS FOR DETECTING AND QUANTIFYING HOST CELL PROTEIN IN CELL LINES AND RECOMBINANT POLYPEPTIDE PRODUCTS
20180364235 ยท 2018-12-20
Assignee
Inventors
- Feny Gunawan (San Francisco, CA)
- Yi-Chun Hsiao (San Mateo, CA)
- Denise C. Krawitz (San Anselmo, CA)
- Margaret S. Lin (Danville, CA)
- Martin Vanderlaan (San Francisco, CA)
- Rajesh Vij (San Mateo, CA)
- Inn H. Yuk (Berkeley, CA)
- Judith Zhu-Shimoni (Kensington, CA)
Cpc classification
G01N33/577
PHYSICS
C07K2317/33
CHEMISTRY; METALLURGY
International classification
Abstract
Monoclonal and polyclonal antibodies that bind hamster phospholipase B-like 2 are provided. Also provided are methods for detecting and quantifying hamster phospholipase B-like 2, for example, in recombinant polypeptide preparations, as well as kits for carrying out such methods. Methods of screening or selecting host cell lines or recombinant polypeptide-expressing cell lines that express low levels of hamster phospholipase B-like 2 are also provided.
Claims
1.-17. (canceled)
18. A monoclonal antibody that binds hamster phospholipase B-like 2, wherein the antibody comprises: (a) a variable heavy chain region comprising CDRH1 comprising the amino acid sequence of SEQ ID NO: 15, CDRH2 comprising the amino acid sequence of SEQ ID NO: 16, and CDRH3 comprising the amino acid sequence of SEQ ID NO: 17; (b) a variable light chain region comprising CDRL1 comprising the amino acid sequence of SEQ ID NO: 20, CDRL2 comprising the amino acid sequence of SEQ ID NO: 21, and CDRL3 comprising the amino acid sequence of SEQ ID NO: 22; or (c) a variable heavy chain region comprising CDRH1 comprising the amino acid sequence of SEQ ID NO: 15, CDRH2 comprising the amino acid sequence of SEQ ID NO: 16, and CDRH3 comprising the amino acid sequence of SEQ ID NO: 17 and a variable light chain region comprising CDRL1 comprising the amino acid sequence of SEQ ID NO: 20, CDRL2 comprising the amino acid sequence of SEQ ID NO: 21, and CDRL3 comprising the amino acid sequence of SEQ ID NO: 22.
19. (canceled)
20. (canceled)
21. The antibody of claim 18 comprising a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 14.
22. The antibody of claim 18 comprising a variable light chain region comprising the amino acid sequence of SEQ ID NO: 19.
23. The antibody of claim 18 comprising a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 14 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 19.
24. The antibody of claim 23 comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 13 and a light chain comprising the amino acid sequence of SEQ ID NO: 18.
25. (canceled)
26. A monoclonal antibody that binds hamster phospholipase B-like 2, wherein the antibody comprises: (a) a variable heavy chain region comprising CDRH1 comprising the amino acid sequence of SEQ ID NO: 5, CDRH2 comprising the amino acid sequence of SEQ ID NO: 6, and CDRH3 comprising the amino acid sequence of SEQ ID NO: 7; (b) comprising a variable light chain region comprising CDRL1 comprising the amino acid sequence of SEQ ID NO: 10, CDRL2 comprising the amino acid sequence of SEQ ID NO: 11, and CDRL3 comprising the amino acid sequence of SEQ ID NO: 12; or (c) a variable heavy chain region comprising CDRH1 comprising the amino acid sequence of SEQ ID NO: 5, CDRH2 comprising the amino acid sequence of SEQ ID NO: 6, and CDRH3 comprising the amino acid sequence of SEQ ID NO: 7 and a variable light chain region comprising CDRL1 comprising the amino acid sequence of SEQ ID NO: 10, CDRL2 comprising the amino acid sequence of SEQ ID NO: 11, and CDRL3 comprising the amino acid sequence of SEQ ID NO: 12.
27. (canceled)
28. (canceled)
29. The antibody of claim 26 comprising a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 4.
30. The antibody of claim 26 comprising a variable light chain region comprising the amino acid sequence of SEQ ID NO: 9.
31. The antibody of claim 26 comprising a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 4 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 9.
32. The antibody of claim 31 comprising a heavy chain comprising the amino acid sequence of SEQ ID NO: 3 and a light chain comprising the amino acid sequence of SEQ ID NO: 8.
33. (canceled)
34.-42. (canceled)
43. An immunoassay kit for the detection of hamster phospholipase B-like 2 protein comprising a capture antibody of claim 18.
44. An immunoassay kit for the detection of hamster phospholipase B-like 2 protein comprising a polyclonal capture antibody and a polyclonal detection antibody.
45. The immunoassay kit of claim 43, wherein the immunoassay is an ECL immunoassay.
46. The immunoassay kit of claim 43, wherein the immunoassay is an ELISA immunoassay.
47.-69. (canceled)
70. The immunoassay kit of claim 43, wherein the kit comprises a detection antibody that comprises a variable heavy chain region comprising CDRH1 comprising the amino acid sequence of SEQ ID NO: 5, CDRH2 comprising the amino acid sequence of SEQ ID NO: 6, and CDRH3 comprising the amino acid sequence of SEQ ID NO: 7 and a variable light chain region comprising CDRL1 comprising the amino acid sequence of SEQ ID NO: 10, CDRL2 comprising the amino acid sequence of SEQ ID NO: 11, and CDRL3 comprising the amino acid sequence of SEQ ID NO: 12.
71. An immunoassay kit for the detection of hamster phospholipase B-like 2 protein comprising a detection antibody of claim 26.
72. The immunoassay kit of claim 71, wherein the immunoassay is an ECL immunoassay.
73. The immunoassay kit of claim 71, wherein the immunoassay is an ELISA immunoassay.
74. The immunoassay kit of claim 43, wherein the capture antibody comprises a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 14 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 19.
75. The immunoassay kit of claim 70, wherein the detection antibody comprises a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 4 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 9.
76. An immunoassay kit for the detection of hamster phospholipase B-like 2 protein comprising a capture antibody and a detection antibody, wherein: the capture antibody comprises a variable heavy chain region comprising CDRH1 comprising the amino acid sequence of SEQ ID NO: 15, CDRH2 comprising the amino acid sequence of SEQ ID NO: 16, and CDRH3 comprising the amino acid sequence of SEQ ID NO: 17 and a variable light chain region comprising CDRL1 comprising the amino acid sequence of SEQ ID NO: 20, CDRL2 comprising the amino acid sequence of SEQ ID NO: 21, and CDRL3 comprising the amino acid sequence of SEQ ID NO: 22; and the detection antibody comprises a variable heavy chain region comprising CDRH1 comprising the amino acid sequence of SEQ ID NO: 5, CDRH2 comprising the amino acid sequence of SEQ ID NO: 6, and CDRH3 comprising the amino acid sequence of SEQ ID NO: 7 and a variable light chain region comprising CDRL1 comprising the amino acid sequence of SEQ ID NO: 10, CDRL2 comprising the amino acid sequence of SEQ ID NO: 11, and CDRL3 comprising the amino acid sequence of SEQ ID NO: 12.
77. The immunoassay kit of claim 76, wherein the capture antibody comprises a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 14 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 19; and the detection antibody comprises a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 4 and a variable light chain region comprising the amino acid sequence of SEQ ID NO: 9.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0024]
[0025]
[0026]
[0027]
[0028]
[0029]
[0030]
[0031]
[0032]
[0033]
[0034]
[0035]
[0036]
DETAILED DESCRIPTION
[0037] Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Singleton et al., Dictionary of Microbiology and Molecular Biology 2nd ed., J. Wiley & Sons (New York, N.Y. 1994), and March, Advanced Organic Chemistry Reactions, Mechanisms and Structure 4th ed., John Wiley & Sons (New York, N.Y. 1992), provide one skilled in the art with a general guide to many of the terms used in the present application.
Certain Definitions
[0038] For purposes of interpreting this specification, the following definitions will apply and whenever appropriate, terms used in the singular will also include the plural and vice versa. In the event that any definition set forth below conflicts with any document incorporated herein by reference, the definition set forth below shall control.
[0039] As used in this specification and the appended claims, the singular forms a, an and the include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to a protein or an antibody includes a plurality of proteins or antibodies, respectively; reference to a cell includes mixtures of cells, and the like.
[0040] The term detecting is used herein in the broadest sense to include both qualitative and quantitative measurements of a target molecule. Detecting includes identifying the mere presence of the target molecule in a sample as well as determining whether the target molecule is present in the sample at detectable levels.
[0041] A sample refers to a small portion of a larger quantity of material. Generally, testing according to the methods described herein is performed on a sample. The sample is typically obtained from a recombinant polypeptide preparation obtained, for example, from cultured recombinant polypeptide-expressing cell lines, also referred to herein as product cell lines, or from cultured host cells. As used herein, host cells do not contain genes for the expression of recombinant polypeptides of interest or products. A sample may be obtained from, for example but not limited to, harvested cell culture fluid, from an in-process pool at a certain step in a purification process, or from the final purified product.
[0042] A capture antibody refers to an antibody that specifically binds a target molecule in a sample. Under certain conditions, the capture antibody forms a complex with the target molecule such that the antibody-target molecule complex can be separated from the rest of the sample. In certain embodiments, such separation may include washing away substances or material in the sample that did not bind the capture antibody. In certain embodiments, a capture antibody may be attached to a solid support surface, such as, for example but not limited to, a plate or a bead.
[0043] A detection antibody refers to an antibody that specifically binds a target molecule in a sample or in a sample-capture antibody combination material. Under certain conditions, the detection antibody forms a complex with the target molecule or with a target molecule-capture antibody complex. A detection antibody is capable of being detected either directly through a label, which may be amplified, or indirectly, e.g., through use of another antibody that is labeled and that binds the detection antibody. For direct labeling, the detection antibody is typically conjugated to a moiety that is detectable by some means, for example, including but not limited to, biotin or ruthenium.
[0044] The terms label or detectable label refers to any chemical group or moiety that can be linked to a substance that is to be detected or quantitated, e.g., an antibody. Typically, a label is a detectable label that is suitable for the sensitive detection or quantification of a substance. Examples of detectable labels include, but are not limited to, luminescent labels, e.g., fluorescent, phosphorescent, chemiluminescent, bioluminescent and electrochemiluminescent labels, radioactive labels, enzymes, particles, magnetic substances, electroactive species and the like. Alternatively, a detectable label may signal its presence by participating in specific binding reactions. Examples of such labels include haptens, antibodies, biotin, streptavidin, his-tag, nitrilotriacetic acid, glutathione S-transferase, glutathione and the like.
[0045] The term detection means refers to a moiety or technique used to detect the presence of the detectable antibody through signal reporting that is then read out in an assay. Typically, detection means employ reagents that amplify an immobilized label such as the label captured onto a microtiter plate, e.g., avidin or streptavidin-HRP.
[0046] Photoluminescence refers to a process whereby a material luminesces subsequent to the absorption by that material of light (alternatively termed electromagnetic radiation). Fluorescence and phosphorescence are two different types of photoluminescence. Chemiluminescent processes involve the creation of the luminescent species by a chemical reaction. Electro-chemiluminescence or ECL is a process whereby a species, e.g., an antibody, luminesces upon the exposure of that species to electrochemical energy in an appropriate surrounding chemical environment.
[0047] The terms polypeptide and protein are used interchangeably herein to refer to polymers of amino acids of any length. The polymer may be linear or branched, it may comprise modified amino acids, and it may be interrupted by non-amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids, etc.), as well as other modifications known in the art. The terms polypeptide and protein as used herein specifically encompass antibodies.
[0048] Purified polypeptide (e.g., antibody or immunoadhesin) means that the polypeptide has been increased in purity, such that it exists in a form that is more pure than it exists in its natural environment and/or when initially synthesized and/or amplified under laboratory conditions. Purity is a relative term and does not necessarily mean absolute purity.
[0049] An antibody which binds an antigen of interest, e.g. a host cell protein, is one that binds the antigen with sufficient affinity such that the antibody is useful as an assay reagent, e.g., as a capture antibody or as a detection antibody. Typically, such an antibody does not significantly cross-react with other polypeptides.
[0050] With regard to the binding of a polypeptide to a target molecule, the term specific binding or specifically binds to or is specific for a particular polypeptide or an epitope on a particular polypeptide target means binding that is measurably different from a non-specific interaction. Specific binding can be measured, for example, by determining binding of a target molecule compared to binding of a control molecule, which generally is a molecule of similar structure that does not have binding activity.
[0051] Affinity refers to the strength of the sum total of noncovalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless indicated otherwise, as used herein, binding affinity refers to intrinsic binding affinity which reflects a 1:1 interaction between members of a binding pair (e.g., antibody and antigen). The affinity of a molecule X for its partner Y can generally be represented by the dissociation constant (Kd). Affinity can be measured by common methods known in the art, including those described herein.
[0052] The terms anti-PLBL2 antibody and an antibody that binds to PLBL2 refer to an antibody that is capable of binding PLBL2, e.g., hamster PLBL2 with sufficient affinity such that the antibody is useful as an agent in targeting PLBL2, e.g., as an agent in the assays described herein. In one embodiment, the extent of binding of an anti-PLBL2 antibody to an unrelated, non-PLBL2 protein is less than about 10% of the binding of the antibody to PLBL2 as measured, e.g., by a radioimmunoassay (RIA). In certain embodiments, an antibody that binds to PLBL2 has a dissociation constant (Kd) of 1 M, 100 nM, 10 nM, 1 nM, 0.1 nM, 0.01 nM, or 0.001 nM (e.g. 10.sup.8M or less, e.g. from 10.sup.8M to 10.sup.13M, e.g., from 10.sup.9M to 10.sup.13 M).
[0053] The term antibody herein is used in the broadest sense and encompasses various antibody structures, including but not limited to monoclonal antibodies, polyclonal antibodies, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments so long as they exhibit the desired antigen-binding activity.
[0054] Antibodies are naturally occurring immunoglobulin molecules which have varying structures, all based upon the immunoglobulin fold. For example, IgG antibodies have two heavy chains and two light chains that are disulphide-bonded to form a functional antibody. Each heavy and light chain itself comprises a constant (C) and a variable (V) region. The V regions determine the antigen binding specificity of the antibody, and the C regions provide structural support and function in non-antigen-specific interactions with immune effectors. The antigen binding specificity of an antibody or antigen-binding fragment of an antibody is the ability of an antibody to specifically bind to a particular antigen.
[0055] The antigen binding specificity of an antibody is determined by the structural characteristics of the variable or V region. The term variable refers to the fact that certain portions of the variable domains differ extensively in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not evenly distributed throughout the variable domains of antibodies. It is concentrated in three segments called hypervariable regions both in the light chain and the heavy chain variable domains. The more highly conserved portions of variable domains are called the framework regions (FRs). The variable domains of native heavy and light chains each comprise four FRs, largely adopting a -sheet configuration, connected by three hypervariable regions, which form loops connecting, and in some cases forming part of, the -sheet structure. The hypervariable regions in each chain are held together in close proximity by the FRs and, with the hypervariable regions from the other chain, contribute to the formation of the antigen-binding site of antibodies (see Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). The constant domains are not involved directly in binding an antibody to an antigen, but exhibit various effector functions, such as participation of the antibody in antibody dependent cellular cytotoxicity (ADCC).
[0056] The term hypervariable region when used herein refers to the amino acid residues of an antibody that are responsible for antigen binding. The hypervariable region may comprise amino acid residues from a complementarity determining region or CDR (e.g., around about residues 24-34 (L1), 50-56 (L2) and 89-97 (L3) in the V.sub.L, and around about 31-35B (H1), 50-65 (H2) and 95-102 (H3) in the V.sub.II (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)) and/or those residues from a hypervariable loop (e.g. residues 26-32 (L1), 50-52 (L2) and 91-96 (L3) in the V.sub.L, and 26-32 (H1), 52A-55 (H2) and 96-101 (H3) in the V.sub.H (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)).
[0057] Framework or FR residues are those variable domain residues other than the hypervariable region residues as herein defined.
[0058] Antibody fragments comprise a portion of an intact antibody, preferably comprising the antigen binding region thereof. Examples of antibody fragments include Fab, Fab, F(ab).sub.2, and Fv fragments; diabodies; tandem diabodies (taDb), linear antibodies(e.g., U.S. Pat. No. 5,641,870, Example 2; Zapata et al., Protein Eng. 8(10):1057-1062 (1995)); one-armed antibodies, single variable domain antibodies, minibodies, single-chain antibody molecules; multispecific antibodies formed from antibody fragments (e.g., including but not limited to, Db-Fc, taDb-Fc, taDb-CH3, (scFV)4-Fc, di-scFv, bi-scFv, or tandem (di,tri)-scFv); and Bi-specific T-cell engagers (BiTEs).
[0059] Papain digestion of antibodies produces two identical antigen-binding fragments, called Fab fragments, each with a single antigen-binding site, and a residual Fc fragment, whose name reflects its ability to crystallize readily. Pepsin treatment yields an F(ab).sub.2 fragment that has two antigen-binding sites and is still capable of cross-linking antigen.
[0060] Fv is the minimum antibody fragment that contains a complete antigen-recognition and antigen-binding site. This region consists of a dimer of one heavy chain and one light chain variable domain in tight, non-covalent association. It is in this configuration that the three hypervariable regions of each variable domain interact to define an antigen-binding site on the surface of the V.sub.H-V.sub.L dimer. Collectively, the six hypervariable regions confer antigen-binding specificity to the antibody. However, even a single variable domain (or half of an Fv comprising only three hypervariable regions specific for an antigen) has the ability to recognize and bind antigen, although at a lower affinity than the entire binding site.
[0061] The Fab fragment also contains the constant domain of the light chain and the first constant domain (CH1) of the heavy chain. Fab fragments differ from Fab fragments by the addition of a few residues at the carboxy terminus of the heavy chain CH1 domain including one or more cysteines from the antibody hinge region. Fab-SH is the designation herein for Fab in which the cysteine residue(s) of the constant domains bear at least one free thiol group. F(ab).sub.2 antibody fragments originally were produced as pairs of Fab fragments that have hinge cysteines between them. Other chemical couplings of antibody fragments are also known.
[0062] The light chains of antibodies (immunoglobulins) from any vertebrate species can be assigned to one of two clearly distinct types, called kappa () and lambda (), based on the amino acid sequences of their constant domains.
[0063] Depending on the amino acid sequence of the constant domain of their heavy chains, antibodies can be assigned to different classes. There are five major classes of intact antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy chain constant domains that correspond to the different classes of antibodies are called , , , , and , respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
[0064] Single-chain Fv or scFv antibody fragments comprise the V.sub.H and V.sub.L domains of antibody, wherein these domains are present in a single polypeptide chain. In some embodiments, the Fv polypeptide further comprises a polypeptide linker between the V.sub.H and V.sub.L domains that enables the scFv to form the desired structure for antigen binding. For a review of scFv see Plckthun in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., Springer-Verlag, New York, pp. 269-315 (1994).
[0065] The term diabodies refers to small antibody fragments with two antigen-binding sites, which fragments comprise a heavy chain variable domain (V.sub.H) connected to a light chain variable domain (V.sub.L) in the same polypeptide chain (V.sub.H-V.sub.L). By using a linker that is too short to allow pairing between the two domains on the same chain, the domains are forced to pair with the complementary domains of another chain and create two antigen-binding sites. Diabodies are described more fully in, for example, EP 404,097; WO 93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993).
[0066] The term multispecific antibody is used in the broadest sense and specifically covers an antibody comprising an antigen-binding domain that has polyepitopic specificity (i.e., is capable of specifically binding to two, or more, different epitopes on one biological molecule or is capable of specifically binding to epitopes on two, or more, different biological molecules). In some embodiments, an antigen-binding domain of a multispecific antibody (such as a bispecific antibody) comprises two VH/VL units, wherein a first VH/VL unit specifically binds to a first epitope and a second VH/VL unit specifically binds to a second epitope, wherein each VH/VL unit comprises a heavy chain variable domain (VH) and a light chain variable domain (VL). Such multispecific antibodies include, but are not limited to, full length antibodies, antibodies having two or more VL and VH domains, antibody fragments such as Fab, Fv, dsFv, scFv, diabodies, bispecific diabodies and triabodies, antibody fragments that have been linked covalently or non-covalently. A VH/VL unit that further comprises at least a portion of a heavy chain constant region and/or at least a portion of a light chain constant region may also be referred to as a hemimer or half antibody. Polyepitopic specificity refers to the ability to specifically bind to two or more different epitopes on the same or different target(s). Monospecific refers to the ability to bind only one epitope. According to one embodiment the multispecific antibody is an IgG antibody that binds to each epitope with an affinity of 5 M to 0.001 pM, 3 M to 0.001 pM, 1 M to 0.001 pM, 0.5 M to 0.001 pM, or 0.1 M to 0.001 pM.
[0067] A bispecific antibody is a multispecific antibody comprising an antigen-binding domain that is capable of specifically binding to two different epitopes on one biological molecule or is capable of specifically binding to epitopes on two different biological molecules. A bispecific antibody may also be referred to herein as having dual specificity or as being dual specific.
[0068] The expression single domain antibodies (sdAbs) or single variable domain (SVD) antibodies generally refers to antibodies in which a single variable domain (VH or VL) can confer antigen binding. In other words, the single variable domain does not need to interact with another variable domain in order to recognize the target antigen. Examples of single domain antibodies include those derived from camelids (lamas and camels) and cartilaginous fish (e.g., nurse sharks) and those derived from recombinant methods from humans and mouse antibodies (Nature (1989) 341:544-546; Dev Comp Immunol (2006) 30:43-56; Trend Biochem Sci (2001) 26:230-235; Trends Biotechnol (2003):21:484-490; WO 2005/035572; WO 03/035694; Febs Lett (1994) 339:285-290; W000/29004; WO 02/051870).
[0069] The term monoclonal antibody as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope, except for possible variants that may arise during production of the monoclonal antibody, such variants generally being present in minor amounts. In contrast to polyclonal antibody preparations that typically include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen. In addition to their specificity, the monoclonal antibodies are advantageous in that they are uncontaminated by other immunoglobulins. The modifier monoclonal indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the methods provided herein may be made by the hybridoma method first described by Kohler et al., Nature 256:495 (1975), or may be made by recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567). The monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al., Nature 352:624-628 (1991) and Marks et al., J. Mol. Biol. 222:581-597 (1991), for example.
[0070] The monoclonal antibodies herein specifically include chimeric antibodies (immunoglobulins) in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (U.S. Pat. No. 4,816,567; Morrison et al., Proc. Natl. Acad. Sci. USA 81:6851-6855 (1984)). Chimeric antibodies of interest herein include primatized antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g. Old World Monkey, such as baboon, rhesus or cynomolgus monkey) and human constant region sequences (U.S. Pat. No. 5,693,780).
[0071] For the purposes herein, an intact antibody is one comprising heavy and light variable domains as well as an Fc region. The constant domains may be native sequence constant domains (e.g. human native sequence constant domains) or amino acid sequence variant thereof. Preferably, the intact antibody has one or more effector functions.
[0072] Native antibodies are usually heterotetrameric glycoproteins of about 150,000 daltons, composed of two identical light (L) chains and two identical heavy (H) chains. Each light chain is linked to a heavy chain by one covalent disulfide bond, while the number of disulfide linkages varies among the heavy chains of different immunoglobulin isotypes. Each heavy and light chain also has regularly spaced intrachain disulfide bridges. Each heavy chain has at one end a variable domain (V.sub.H) followed by a number of constant domains. Each light chain has a variable domain at one end (V.sub.L) and a constant domain at its other end; the constant domain of the light chain is aligned with the first constant domain of the heavy chain, and the light chain variable domain is aligned with the variable domain of the heavy chain. Particular amino acid residues are believed to form an interface between the light chain and heavy chain variable domains.
[0073] A naked antibody is an antibody (as herein defined) that is not conjugated to a heterologous molecule, such as a detection moiety or label.
[0074] The terms host cell, host cell line, and host cell culture are used interchangeably and refer to cells into which exogenous nucleic acid has been introduced, including the progeny of such cells. Host cells include transformants and transformed cells, which include the primary transformed cell and progeny derived therefrom without regard to the number of passages. Progeny may not be completely identical in nucleic acid content to a parent cell, but may contain mutations. Mutant progeny that have the same function or biological activity as screened or selected for in the originally transformed cell are included herein.
[0075] The terms contaminants and impurities are used interchangeably herein and refer to materials or substances that are different from the desired polypeptide product. The contaminant includes, without limitation: host cell materials, such as CHOP; leached Protein A; nucleic acid; a variant, fragment, aggregate or derivative of the desired polypeptide; another polypeptide; endotoxin; viral contaminant; cell culture media component, etc. In some examples, the contaminant may be a host cell protein (HCP) from, for example but not limited to, a bacterial cell such as an E. coli cell, an insect cell, a prokaryotic cell, a eukaryotic cell, a yeast cell, a mammalian cell, such as a Chinese hamster ovary cell, an avian cell, a fungal cell.
[0076] An isolated nucleic acid refers to a nucleic acid molecule that has been separated from a component of its natural environment. An isolated nucleic acid includes a nucleic acid molecule contained in cells that ordinarily contain the nucleic acid molecule, but the nucleic acid molecule is present extrachromosomally or at a chromosomal location that is different from its natural chromosomal location.
[0077] Isolated nucleic acid encoding an anti-PLBL2 antibody refers to one or more nucleic acid molecules encoding antibody heavy and light chains (or fragments thereof), including such nucleic acid molecule(s) in a single vector or separate vectors, and such nucleic acid molecule(s) present at one or more locations in a host cell.
[0078] Percent (%) amino acid sequence identity with respect to a reference polypeptide sequence is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in the reference polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for aligning sequences, including any algorithms needed to achieve maximal alignment over the full length of the sequences being compared. In certain embodiments, % amino acid sequence identity values are generated using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc., and the source code has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087. The ALIGN-2 program is publicly available from Genentech, Inc., South San Francisco, Calif., or may be compiled from the source code. The ALIGN-2 program should be compiled for use on a UNIX operating system, including digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
[0079] In situations where ALIGN-2 is employed for amino acid sequence comparisons, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows:
100 times the fraction X/Y
[0080] where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A. Unless specifically stated otherwise, all % amino acid sequence identity values used herein are obtained as described in the immediately preceding paragraph using the ALIGN-2 computer program.
[0081] The term variable region or variable domain refers to the domain of an antibody heavy or light chain that is involved in binding the antibody to antigen. The variable domains of the heavy chain and light chain (VH and VL, respectively) of a native antibody generally have similar structures, with each domain comprising four conserved framework regions (FRs) and three hypervariable regions (HVRs). (See, e.g., Kindt et al. Kuby Immunology, 6th ed., W. H. Freeman and Co., page 91 (2007).) A single VH or VL domain may be sufficient to confer antigen-binding specificity. Furthermore, antibodies that bind a particular antigen may be isolated using a VH or VL domain from an antibody that binds the antigen to screen a library of complementary VL or VH domains, respectively. See, e.g., Portolano et al., J. Immunol. 150:880-887 (1993); Clarkson et al., Nature 352:624-628 (1991).
[0082] The term vector, as used herein, refers to a nucleic acid molecule capable of propagating another nucleic acid to which it is linked. The term includes the vector as a self-replicating nucleic acid structure as well as the vector incorporated into the genome of a host cell into which it has been introduced. Certain vectors are capable of directing the expression of nucleic acids to which they are operatively linked. Such vectors are referred to herein as expression vectors.
[0083] Reference to about a value or parameter herein includes (and describes) variations that are directed to that value or parameter per se. For example, description referring to about X includes description of X.
[0084] As used herein and in the appended claims, the singular forms a, or, and the include plural referents unless the context clearly dictates otherwise. It is understood that aspects and variations of the invention described herein include consisting and/or consisting essentially of aspects and variations.
Assay Methods
[0085] Provided herein are immunoassay methods for detection and quantification of hamster PLBL2. Such methods may be used for the detection and quantification of hamster PLBL2 in recombinant polypeptide preparations produced in host cells, for example Chinese hamster ovary cells. In some embodiments, such methods use capture and detection anti-PLBL2 antibodies described herein. In some embodiments, the antibodies are used in any immunoassay method known in the art, including but not limited to, sandwich assay, enzyme-linked immunosorbent assay (ELISA) assay, electrochemical assay (ECL) assay, magnetic immunoassay. In certain embodiments, the method comprises contacting a sample of the recombinant polypeptide preparation with an anti-PLBL2 antibody as described herein under conditions permissive for binding of the anti-PLBL2 antibody to hamster PLBL2, and detecting whether a complex is formed between the anti-PLBL2 antibody and hamster PLBL2.
[0086] In certain embodiments, labeled anti-PLBL2 antibodies are provided. Labels include, but are not limited to, labels or moieties that are detected directly (such as fluorescent, chromophoric, electron-dense, chemiluminescent, and radioactive labels), as well as moieties, such as enzymes or ligands, that are detected indirectly, e.g., through an enzymatic reaction or molecular interaction. Exemplary labels include, but are not limited to, the radioisotopes 32P, 14C, 125I, 3H, and 131I, fluorophores such as rare earth chelates or fluorescein and its derivatives, rhodamine and its derivatives, dansyl, umbelliferone, luceriferases, e.g., firefly luciferase and bacterial luciferase (U.S. Pat. No. 4,737,456), luciferin, 2,3-dihydrophthalazinediones, horseradish peroxidase (HRP), alkaline phosphatase, -galactosidase, glucoamylase, lysozyme, saccharide oxidases, e.g., glucose oxidase, galactose oxidase, and glucose-6-phosphate dehydrogenase, heterocyclic oxidases such as uricase and xanthine oxidase, coupled with an enzyme that employs hydrogen peroxide to oxidize a dye precursor such as HRP, lactoperoxidase, or microperoxidase, biotin/avidin, spin labels, bacteriophage labels, stable free radicals, and the like.
[0087] In certain embodiments, a capture anti-PLBL2 antibody is immobilized on a solid phase. In some embodiments, the solid phase used for immobilization is any inert support or carrier that is essentially water insoluble and useful in immunometric assays, including supports in the form of, e.g., surfaces, particles, porous matrices, beads and the like. Examples of commonly used supports include small sheets, SEPHADEX, gels, polyvinyl chloride, plastic beads, and assay plates or test tubes manufactured from polyethylene, polypropylene, polystyrene, and the like, including 96-well microtiter plates, as well as particulate materials such as filter paper, agarose, cross-linked dextran, and other polysaccharides. Alternatively, reactive water-insoluble matrices such as cyanogen-bromide-activated carbohydrates and the reactive substrates described in U.S. Pat. Nos. 3,969,287; 3,691,016; 4,195,128; 4,247,642; 4,229,537; and 4,330,440 are suitably employed for capture-reagent immobilization. In some embodiments, the immobilized capture reagents are coated on a microtiter plate that can be used to analyze several samples at one time. Exemplary microtiter plates include, but are not limited to, MICROTEST, MAXISORP, NUNC MAXISORB, and IMMULON. The solid phase is coated with the capture reagents as defined above, which may be linked by a non-covalent or covalent interaction or physical linkage as desired. Techniques for attachment include those described in U.S. Pat. No. 4,376,110 and the references cited therein. If covalent, the plate or other solid phase is incubated with a cross-linking agent together with the capture reagent under conditions well known in the art such as for one hour at room temperature. In some embodiments, the plates are stacked and coated long in advance of the assay itself, and then the assay is carried out simultaneously on several samples in a manual, semi-automatic, or automatic fashion, such as by using robotics.
[0088] In some embodiments, the coated plates are treated with a blocking agent that binds non-specifically to and saturates the binding sites to prevent unwanted binding of the free ligand to the excess sites on the wells of the plate. Examples of appropriate blocking agents for this purpose include but are not limited to, e.g., gelatin, bovine serum albumin, egg albumin, casein, and non-fat milk. The blocking treatment typically takes place under conditions of ambient temperatures for a period of time, typically about 1-4 hours.
[0089] In some embodiments, after coating and blocking, the sample to be analyzed, appropriately diluted, is added to the immobilized phase. Exemplary buffers that may be used for dilution for this purpose include, but are not limited to, (a) phosphate-buffered saline (PBS) containing 0.5% BSA, 0.05% TWEEN 20 detergent (P20), 0.05% PROCLIN 300 antibiotic, 5 mM EDTA, 0.25% 3-((3-cholamidopropyl)dimethylammonio)-1-propanesulphonate (CHAPS) surfactant, 0.2% beta-gamma globulin, and 0.35M NaCl; (b) PBS containing 0.5% bovine serum albumin (BSA), 0.05% P20, and 0.05% PROCLIN 300, pH 7; (c) PBS containing 0.5% BSA, 0.05% P20, 0.05% PROCLIN 300, 5 mM EDTA, and 0.35 M NaCl, pH 6.35; (d) PBS containing 0.5% BSA, 0.05% P20, 0.05% PROCLIN 300, 5 mM EDTA, 0.2% beta-gamma globulin, and 0.35 M NaCl; and (e) PBS containing 0.5% BSA, 0.05% P20, 0.05% PROCLIN 300, 5 mM EDTA, 0.25% CHAPS, and 0.35 M NaCl.
[0090] The conditions for incubation of sample and immobilized capture reagent are selected to maximize sensitivity of the assay and to minimize dissociation, and to ensure that any analyte of interest present in the sample (such as hamster PLBL2) binds to the immobilized capture reagent. Optionally, the sample is separated (for example, by washing) from the immobilized capture reagents to remove uncaptured material. The solution used for washing is generally a buffer (e.g., washing buffer). A cross-linking agent or other suitable agent may also be added at this stage to allow the now-bound material of interest (e.g., hamster PLBL2) to be covalently attached to the capture reagents if there is any concern that the captured material of interest may dissociate to some extent in the subsequent steps.
[0091] The immobilized capture reagents with any bound material of interest present are contacted with a detection anti-PLBL2 antibody. In some embodiments, the detection antibody is biotinylated. In some embodiments, the detection means for the biotinylated label is avidin or streptavidin-HRP. In some embodiments, the readout of the detection means is fluorimetric or colorimetric.
[0092] The level of any free material of interest from the sample (e.g., hamster PLBL2) that is now bound to the capture reagents is measured or quantified using a detection means for the detection antibody. In some embodiments, the measuring or quantifying comprises comparing the reaction that occurs as a result of the above steps with a standard curve to determine the level of material of interest (e.g., hamster PLBL2) compared to a known amount.
[0093] The antibody added to the immobilized capture reagents will be either directly labeled, or detected indirectly by addition, after washing off of excess first antibody, of a molar excess of a second, labeled antibody directed against IgG of the animal species of the first antibody. In the latter, indirect assay, labeled antisera against the first antibody are added to the sample so as to produce the labeled antibody in situ.
[0094] The label used for either the first or second antibody is any detectable functionality that does not interfere with the binding of free material of interest (e.g., hamster PLBL2) to the first or second antibodies. Examples of suitable labels include those known for use in immunoassay, such as those enumerated above.
[0095] Conventional methods are available to bind these labels covalently to proteins or polypeptides. For instance, coupling agents such as dialdehydes, carbodiimides, dimaleimides, bis-imidates, bis-diazotized benzidine, and the like may be used to tag the antibodies with the above-described fluorescent, chemiluminescent, and enzyme labels. See, for example, U.S. Pat. No. 3,940,475 (fluorimetry) and U.S. Pat. No. 3,645,090 (enzymes); Hunter et al., Nature 144:945 (1962); David et al., Biochemistry, 13:1014-1021 (1974); Pain et al., J. Immunol. Methods 40:219-230 (1981); and Nygren, J. Histochem. and Cytochem., 30:407-412 (1982). In some embodiments, the label is biotin using streptavidin-HRP for detection means.
[0096] The conjugation of such label, including the enzymes, to the antibody is a standard manipulative procedure for one of ordinary skill in immunoassay techniques. See, for example, O'Sullivan et al. Methods for the Preparation of Enzyme-antibody Conjugates for Use in Enzyme Immunoassay, in Methods in Enzymology, ed. J. J. Langone and H. Van Vunakis, Vol. 73 (Academic Press, New York, N.Y., 1981), pp. 147-166.
[0097] Following the addition of last labeled antibody, the amount of bound antibody is determined by removing excess unbound labeled antibody through washing and then measuring or quantifying the amount of the attached label using a detection method appropriate to the label, and correlating the measured amount with the amount of the antibody of interest in the biological sample. For example, in the case of enzymes, the amount of color developed and measured will be a direct measurement allowing quantification of the amount of the antibody of interest present. In one embodiment, HRP is the label and the color is detected using the substrate OPD at 490-nm absorbance.
[0098] In one example, after an enzyme-labeled second antibody directed against the first unlabeled antibody is washed from the immobilized phase, color or chemiluminiscence is developed and measured by incubating the immobilized capture reagent with a substrate of the enzyme. Then the concentration of the material of interest (e.g., hamster PLBL2) is calculated by comparing with the color or chemiluminescence generated by the standard run in parallel.
Polypeptides
Exemplary Anti-Hamster PLBL2 Antibodies
[0099] Polypeptides for use in any of the assay methods described herein are provided. In one aspect, isolated antibodies that bind hamster PLBL2 are provided. In some embodiments, an anti-PLBL2 antibody comprises at least one, two, three, four, five, or six CDRs selected from (a) CDRH1 comprising the amino acid sequence of SEQ ID NO: 15; (b) CDRH2 comprising the amino acid sequence of SEQ ID NO: 16; (c) CDRH3 comprising the amino acid sequence of SEQ ID NO: 17; (d) CDRL1 comprising the amino acid sequence of SEQ ID NO: 20; (e) CDRL2 comprising the amino acid sequence of SEQ ID NO: 21; and (f) CDRL3 comprising the amino acid sequence of SEQ ID NO: 22. In some embodiments, an anti-PLBL2 antibody comprises a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 14. In some embodiments, an anti-PLBL2 antibody comprises a variable light chain region comprising the amino acid sequence of SEQ ID NO: 19. In some embodiments, an anti-PLBL2 antibody (19C10) comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 13 and a light chain comprising the amino acid sequence of SEQ ID NO: 18. In another embodiment, the antibody comprises the CDR sequences that are 95% or more identical to the CDR sequences of SEQ ID NO: 13 and SEQ ID NO: 18.
[0100] In another aspect, an anti-PLBL2 antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 14. In certain embodiments, a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-PLBL2 antibody comprising that sequence retains the ability to bind to PLBL2. In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 14. In certain embodiments, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). Optionally, the anti-PLBL2 antibody comprises the VH sequence in SEQ ID NO: 14, including post-translational modifications of that sequence.
[0101] In another aspect, an anti-PLBL2 antibody is provided, wherein the antibody comprises a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 19. In certain embodiments, a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-PLBL2 antibody comprising that sequence retains the ability to bind to PLBL2. In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 19. In certain embodiments, the substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). Optionally, the anti-PLBL2 antibody comprises the VL sequence in SEQ ID NO: 19, including post-translational modifications of that sequence.
[0102] In certain embodiments, an anti-PLBL2 antibody comprises at least one, two three, four, five, or six CDRs selected from (a) CDRH1 comprising the amino acid sequence of SEQ ID NO: 5; (b) CDRH2 comprising the amino acid sequence of SEQ ID NO: 6; (c) CDRH3 comprising the amino acid sequence of SEQ ID NO: 7; (d) CDRL1 comprising the amino acid sequence of SEQ ID NO: 10; (e) CDRL2 comprising the amino acid sequence of SEQ ID NO: 11; and (f) CDRL3 comprising the amino acid sequence of SEQ ID NO: 12. In some embodiments, an anti-PLBL2 antibody comprises a variable heavy chain region comprising the amino acid sequence of SEQ ID NO: 4. In some embodiments, an anti-PLBL2 antibody comprises a variable light chain region comprising the amino acid sequence of SEQ ID NO: 9. In some embodiments, an anti-PLBL2 antibody (15G11) comprises a heavy chain comprising the amino acid sequence of SEQ ID NO: 3 and a light chain comprising the amino acid sequence of SEQ ID NO: 8. In another embodiment, the antibody comprises the CDR sequences that are 95% or more identical to the CDR sequences of SEQ ID NO: 3 and SEQ ID NO: 8.
[0103] In another aspect, an anti-PLBL2 antibody comprises a heavy chain variable domain (VH) sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 4. In certain embodiments, a VH sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-PLBL2 antibody comprising that sequence retains the ability to bind to PLBL2. In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 4. In certain embodiments, substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). Optionally, the anti-PLBL2 antibody comprises the VH sequence in SEQ ID NO: 4, including post-translational modifications of that sequence.
[0104] In another aspect, an anti-PLBL2 antibody is provided, wherein the antibody comprises a light chain variable domain (VL) having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% sequence identity to the amino acid sequence of SEQ ID NO: 9. In certain embodiments, a VL sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions, or deletions relative to the reference sequence, but an anti-PLBL2 antibody comprising that sequence retains the ability to bind to PLBL2. In certain embodiments, a total of 1 to 10 amino acids have been substituted, inserted and/or deleted in SEQ ID NO: 9. In certain embodiments, the substitutions, insertions, or deletions occur in regions outside the CDRs (i.e., in the FRs). Optionally, the anti-PLBL2 antibody comprises the VL sequence in SEQ ID NO: 9, including post-translational modifications of that sequence.
[0105] In another aspect, an anti-PLBL2 antibody is provided, wherein the antibody comprises a VH as in any of the embodiments provided above, and a VL as in any of the embodiments provided above.
[0106] In a further aspect, also provided is an antibody that binds to the same epitope as an anti-PLBL2 antibody described herein. For example, in certain embodiments, an antibody is provided that binds to the same epitope as an anti-PLBL2 antibody comprising a VH sequence of SEQ ID NO: 14 and a VL sequence of SEQ ID NO: 19. For example, in certain embodiments, an antibody is provided that binds to the same epitope as an anti-PLBL2 antibody comprising a VH sequence of SEQ ID NO: 4 and a VL sequence of SEQ ID NO: 9.
[0107] In a further aspect of the invention, an anti-PLBL2 antibody according to any of the above embodiments is a monoclonal antibody, including a chimeric, humanized or human antibody. In one embodiment, an anti-PLBL2 antibody is an antibody fragment, e.g., a Fv, Fab, Fab, scFv, diabody, or F(ab)2 fragment. In another embodiment, the antibody is a full length antibody, e.g., an intact IgG1 antibody or other antibody class or isotype as defined herein. In another embodiment, the antibody is a multispecific antibody, a bispecific antibody, a half antibody or an antibody fragment. Exemplary recombinant polypeptides
[0108] Also provided are recombinant polypeptides and preparations thereof, samples of which may be assayed by the methods described herein. Examples of such recombinant polypeptides include but are not limited to immunoglobulins, immunoadhesins, antibodies, enzymes, hormones, fusion proteins, Fc-containing proteins, immunoconjugates, cytokines and interleukins, mammalian proteins, such as, e.g., renin; a hormone; a growth hormone, including human growth hormone and bovine growth hormone; growth hormone releasing factor; parathyroid hormone; thyroid stimulating hormone; lipoproteins; alpha-1-antitrypsin; insulin A-chain; insulin B-chain; proinsulin; follicle stimulating hormone; calcitonin; luteinizing hormone; glucagon; dotting factors such as factor VIIIC, factor IX, tissue factor, and von Willebrands factor; anti-clotting factors such as Protein C; atrial natriuretic factor; lung surfactant; a plasminogen activator, such as urokinase or human urine or tissue-type plasminogen activator (t-PA); bombesin; thrombin; hemopoietic growth factor; tumor necrosis factor-alpha and -beta; enkephalinase; RANTES (regulated on activation normally T-cell expressed and secreted); human macrophage inflammatory protein (MIP-1-alpha); a serum albumin such as human serum albumin; Muellerian-inhibiting substance; relaxin A-chain; relaxin B-chain; prorelaxin; mouse gonadotropin-associated peptide; an enzyme; a microbial protein, such as beta-lactamase; DNase; IgE; a cytotoxic T-lymphocyte associated antigen (CTLA), such as CTLA-4; inhibin; activin; vascular endothelial growth factor (VEGF); receptors for hormones or growth factors; protein A or D; rheumatoid factors; a neurotrophic factor such as bone-derived neurotrophic factor (BDNF), neurotrophin-3, -4, -5, or -6 (NT-3, NT-4, NT-5, or NT-6), or a nerve growth factor such as NGF-b; platelet-derived growth factor (PDGF); fibroblast growth factor such as aFGF and bFGF; epidermal growth factor (EGF); transforming growth factor (TGF) such as TGF-alpha and TGF-beta, including TGF-1, TGF-2, TGF-3, TGF-4, or TGF-5; insulin-like growth factor-I and -II (IGF-I and IGF-II); des(1-3)-IGF-I (brain IGF-I), insulin-like growth factor binding proteins (IGFBPs); a cytokine; CD proteins such as CD3, CD4, CD8, CD19 and CD20; erythropoietin; osteoinductive factors; immunotoxins; a fusion polypeptide, i.e. a polypeptide comprised on two or more heterologous polypeptides or fragments thereof and encoded by a recombinant nucleic acid; an Fc-containing polypeptide, for example, a fusion protein comprising an immunoglobulin Fc region, or fragment thereof, fused to a second polypeptide; an immunoconjugate; a bone morphogenetic protein (BMP); an interferon such as interferon-alpha, -beta, and -gamma; colony stimulating factors (CSFs), e.g., M-CSF, GM-CSF, and G-CSF; interleukins (ILs), e.g., IL-1 to IL-10; superoxide dismutase; T-cell receptors; surface membrane proteins; decay accelerating factor; viral antigen such as, for example, a portion of the AIDS envelope; transport proteins; homing receptors; addressins; regulatory proteins; integrins such as CD11 a, CD11b, CD11 c, CD18, an ICAM, VLA-4 and VCAM; a tumor associated antigen such as CA125 (ovarian cancer antigen) or HER2, HER3 or HER4 receptor; immunoadhesins; and fragments and/or variants of any of the above-listed proteins as well as antibodies, including antibody fragments, binding to a protein, including, for example, any of the above-listed proteins.
[0109] In some embodiments, the polypeptide preparation for use in any of the assay methods described herein contains an antibody of interest, i.e. the recombinant polypeptide produced by a host cell is an antibody.
[0110] Molecular targets for such antibodies include CD proteins and their ligands, such as, but not limited to: (i) CD3, CD4, CD8, CD19, CD11a, CD20, CD22, CD34, CD40, CD79 (CD79a), and CD79 (CD79b); (ii) members of the ErbB receptor family such as the EGF receptor, HER2, HER3 or HER4 receptor; (iii) cell adhesion molecules such as LFA-1, Mac1, p150,95, VLA-4, ICAM-1, VCAM and v/3 integrin, including either alpha or beta subunits thereof (e.g., anti-CD11a, anti-CD18 or anti-CD11b antibodies); (iv) growth factors such as VEGF; IgE; blood group antigens; flk2/flt3 receptor; obesity (OB) receptor; mpl receptor; CTLA-4; protein C, BR3, c-met, tissue factor, 7 etc; and (v) cell surface and transmembrane tumor-associated antigens (TAA), such as those described in U.S. Pat. No. 7,521,541.
[0111] Other exemplary antibodies include those selected from, and without limitation, anti-estrogen receptor antibody, anti-progesterone receptor antibody, anti-p53 antibody, anti-HER-2/neu antibody, anti-EGFR antibody, anti-cathepsin D antibody, anti-Bcl-2 antibody, anti-E-cadherin antibody, anti-CA125 antibody, anti-CA15-3 antibody, anti-CA19-9 antibody, anti-c-erbB-2 antibody, anti-P-glycoprotein antibody, anti-CEA antibody, anti-retinoblastoma protein antibody, anti-ras oncoprotein antibody, anti-Lewis X antibody, anti-Ki-67 antibody, anti-PCNA antibody, anti-CD3 antibody, anti-CD4 antibody, anti-CD5 antibody, anti-CD7 antibody, anti-CD8 antibody, anti-CD9/p24 antibody, anti-CD10 antibody, anti-CD11a antibody, anti-CD11c antibody, anti-CD13 antibody, anti-CD14 antibody, anti-CD15 antibody, anti-CD19 antibody, anti-CD20 antibody, anti-CD22 antibody, anti-CD23 antibody, anti-CD30 antibody, anti-CD31 antibody, anti-CD33 antibody, anti-CD34 antibody, anti-CD35 antibody, anti-CD38 antibody, anti-CD41 antibody, anti-LCA/CD45 antibody, anti-CD45RO antibody, anti-CD45RA antibody, anti-CD39 antibody, anti-CD100 antibody, anti-CD95/Fas antibody, anti-CD99 antibody, anti-CD106 antibody, anti-ubiquitin antibody, anti-CD71 antibody, anti-c-myc antibody, anti-cytokeratins antibody, anti-vimentins antibody, anti-HPV proteins antibody, anti-kappa light chains antibody, anti-lambda light chains antibody, anti-melanosomes antibody, anti-prostate specific antigen antibody, anti-S-100 antibody, anti-tau antigen antibody, anti-fibrin antibody, anti-keratins antibody and anti-Tn-antigen antibody.
Polyclonal Antibodies
[0112] In some embodiments, antibodies are polyclonal antibodies. Polyclonal antibodies are preferably raised in animals by multiple subcutaneous (sc) or intraperitoneal (ip) injections of the relevant antigen and an adjuvant. It may be useful to conjugate the relevant antigen to a polypeptide that is immunogenic in the species to be immunized, e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor using a bifunctional or derivatizing agent, for example, maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide (through lysine residues), glutaraldehyde, succinic anhydride, SOCl.sub.2, or R.sup.1NCNR, where R and R.sup.1 are different alkyl groups.
[0113] Animals are immunized against the antigen, immunogenic conjugates, or derivatives by combining, e.g., 100 g or 5 g of the polypeptide or conjugate (for rabbits or mice, respectively) with 3 volumes of Freund's complete adjuvant and injecting the solution intradermally at multiple sites. One month later the animals are boosted with to 1/10 the original amount of peptide or conjugate in Freund's complete adjuvant by subcutaneous injection at multiple sites. Seven to 14 days later the animals are bled and the serum is assayed for antibody titer. Animals are boosted until the titer plateaus. In some embodiments, the animal is boosted with the conjugate of the same antigen, but conjugated to a different polypeptide and/or through a different cross-linking reagent. Conjugates also can be made in recombinant cell culture as polypeptide fusions. Also, aggregating agents such as alum are suitably used to enhance the immune response.
Monoclonal Antibodies
[0114] In some embodiments, antibodies are monoclonal antibodies. Monoclonal antibodies are obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies comprising the population are identical and/or bind the same epitope except for possible variants that arise during production of the monoclonal antibody, such variants generally being present in minor amounts. Thus, the modifier monoclonal indicates the character of the antibody as not being a mixture of discrete or polyclonal antibodies.
[0115] For example, the monoclonal antibodies may be made using the hybridoma method first described by Kohler et al., Nature 256:495 (1975), or may be made by recombinant DNA methods (U.S. Pat. No. 4,816,567).
[0116] In the hybridoma method, a mouse or other appropriate host animal, is immunized as herein described to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the polypeptide used for immunization. Alternatively, lymphocytes may be immunized in vitro. Lymphocytes then are fused with myeloma cells using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, pp. 59-103 (Academic Press, 1986)).
[0117] The hybridoma cells thus prepared are seeded and grown in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.
[0118] In some embodiments, the myeloma cells are those that fuse efficiently, support stable high-level production of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. Among these, in some embodiments, the myeloma cell lines are murine myeloma lines, such as those derived from MOPC-21 and MPC-11 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, Calif. USA, and SP-2 or X63-Ag8-653 cells available from the American Type Culture Collection, Rockville, Md. USA. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol. 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications pp. 51-63 (Marcel Dekker, Inc., New York, 1987)).
[0119] Culture medium in which hybridoma cells are growing is assayed for production of monoclonal antibodies directed against the antigen. In some embodiments, the binding specificity of monoclonal antibodies produced by hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA).
[0120] The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson et al., Anal. Biochem. 107:220 (1980).
[0121] After hybridoma cells are identified that produce antibodies of the desired specificity, affinity, and/or activity, the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, Monoclonal Antibodies: Principles and Practice pp. 59-103 (Academic Press, 1986)). Suitable culture media for this purpose include, for example, D-MEM or RPMI-1640 medium. In addition, the hybridoma cells may be grown in vivo as ascites tumors in an animal.
[0122] The monoclonal antibodies secreted by the subclones are suitably separated from the culture medium, ascites fluid, or serum by conventional immunoglobulin purification procedures such as, for example, polypeptide A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.
[0123] DNA encoding the monoclonal antibodies is readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). In some embodiments, the hybridoma cells serve as a source of such DNA. Once isolated, the DNA may be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, human embryonic kidney (HEK) 293 cells, Chinese Hamster Ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin polypeptide, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. Review articles on recombinant expression in bacteria of DNA encoding the antibody include Skerra et al., Curr. Opinion in Immunol. 5:256-262 (1993) and Plckthun, Immunol. Revs., 130:151-188 (1992).
[0124] In a further embodiment, antibodies or antibody fragments can be isolated from antibody phage libraries generated using the techniques described in McCafferty et al., Nature 348:552-554 (1990). Clackson et al., Nature 352:624-628 (1991) and Marks et al., J. Mol. Biol. 222:581-597 (1991) describe the isolation of murine and human antibodies, respectively, using phage libraries. Subsequent publications describe the production of high affinity (nM range) human antibodies by chain shuffling (Marks et al., Bio/Technology 10:779-783 (1992)), as well as combinatorial infection and in vivo recombination as a strategy for constructing very large phage libraries (Waterhouse et al., Nuc. Acids. Res. 21:2265-2266 (1993)). Thus, these techniques are viable alternatives to traditional monoclonal antibody hybridoma techniques for isolation of monoclonal antibodies.
[0125] The DNA also may be modified, for example, by substituting the coding sequence for human heavy- and light chain constant domains in place of the homologous murine sequences (U.S. Pat. No. 4,816,567; Morrison et al., Proc. Natl Acad. Sci. USA 81:6851 (1984)), or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide.
[0126] Typically such non-immunoglobulin polypeptides are substituted for the constant domains of an antibody, or they are substituted for the variable domains of one antigen-combining site of an antibody to create a chimeric bivalent antibody comprising one antigen-combining site having specificity for an antigen and another antigen-combining site having specificity for a different antigen.
[0127] In some embodiments of any of the methods described herein, the antibody is IgA, IgD, IgE, IgG, or IgM. In some embodiments, the antibody is an IgG monoclonal antibody.
Antibody Fragments
[0128] In some embodiments, an antibody is an antibody fragment. Various techniques have been developed for the production of antibody fragments. Traditionally, these fragments were derived via proteolytic digestion of intact antibodies (see, e.g., Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117 (1992) and Brennan et al., Science 229:81 (1985)). However, these fragments can now be produced directly by recombinant host cells. For example, the antibody fragments can be isolated from the antibody phage libraries discussed above. Alternatively, Fab-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab).sub.2 fragments (Carter et al., Bio/Technology 10:163-167 (1992)). According to another approach, F(ab).sub.2 fragments can be isolated directly from recombinant host cell culture. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner. In other embodiments, the antibody of choice is a single chain Fv fragment (scFv). See WO 93/16185; U.S. Pat. No. 5,571,894; and U.S. Pat. No. 5,587,458. The antibody fragment may also be a linear antibody, e.g., as described in U.S. Pat. No. 5,641,870 for example. Such linear antibody fragments may be monospecific or bispecific.
[0129] In some embodiments, fragments of the antibodies described herein are provided. In some embodiments, the antibody fragment is an antigen binding fragment. In some embodiments, the antigen binding fragment is selected from the group consisting of a Fab fragment, a Fab fragment, a F(ab).sub.2 fragment, a scFv, a Fv, and a diabody.
Polypeptide Variants and Modifications
[0130] Amino acid sequence modification(s) of the polypeptides, including antibodies, described herein may be used in the methods of assaying polypeptide preparations (e.g., antibodies) described herein.
Variant Polypeptides
[0131] Polypeptide variant means a polypeptide, for example, an active polypeptide, as defined herein having at least about 80% amino acid sequence identity with a full-length native sequence of the polypeptide, a polypeptide sequence lacking the signal peptide, an extracellular domain of a polypeptide, with or without the signal peptide. Such polypeptide variants include, for instance, polypeptides wherein one or more amino acid residues are added, or deleted, at the N or C-terminus of the full-length native amino acid sequence. Ordinarily, a polypeptide variant will have at least about 80% amino acid sequence identity, alternatively at least about any of 85%, 90%, 95%, 96%, 97%, 98%, or 99% amino acid sequence identity, to a full-length native sequence polypeptide sequence, a polypeptide sequence lacking the signal peptide, an extracellular domain of a polypeptide, with or without the signal peptide. Optionally, variant polypeptides will have no more than one conservative amino acid substitution as compared to the native polypeptide sequence, alternatively no more than about any of 2, 3, 4, 5, 6, 7, 8, 9, or 10 conservative amino acid substitution as compared to the native polypeptide sequence.
[0132] The variant polypeptide may be truncated at the N-terminus or C-terminus, or may lack internal residues, for example, when compared with a full length native polypeptide. Certain variant polypeptides may lack amino acid residues that are not essential for a desired biological activity. These variant polypeptides with truncations, deletions, and insertions may be prepared by any of a number of conventional techniques. Desired variant polypeptides may be chemically synthesized. Another suitable technique involves isolating and amplifying a nucleic acid fragment encoding a desired variant polypeptide, by polymerase chain reaction (PCR). Oligonucleotides that define the desired termini of the nucleic acid fragment are employed at the 5 and 3 primers in the PCR. Preferably, variant polypeptides share at least one biological and/or immunological activity with the native polypeptide disclosed herein.
[0133] Amino acid sequence insertions include amino- and/or carboxyl-terminal fusions ranging in length from one residue to polypeptides containing a hundred or more residues, as well as intrasequence insertions of single or multiple amino acid residues. Examples of terminal insertions include an antibody with an N-terminal methionyl residue or the antibody fused to a cytotoxic polypeptide. Other insertional variants of the antibody molecule include the fusion to the N- or C-terminus of the antibody to an enzyme or a polypeptide which increases the serum half-life of the antibody.
[0134] For example, it may be desirable to improve the binding affinity and/or other biological properties of the polypeptide. Amino acid sequence variants of the polypeptide are prepared by introducing appropriate nucleotide changes into the antibody nucleic acid, or by peptide synthesis. Such modifications include, for example, deletions from, and/or insertions into and/or substitutions of, residues within the amino acid sequences of the polypeptide. Any combination of deletion, insertion, and substitution is made to arrive at the final construct, provided that the final construct possesses the desired characteristics. The amino acid changes also may alter post-translational processes of the polypeptide (e.g., antibody), such as changing the number or position of glycosylation sites.
[0135] Guidance in determining which amino acid residue may be inserted, substituted or deleted without adversely affecting the desired activity may be found by comparing the sequence of the polypeptide with that of homologous known polypeptide molecules and minimizing the number of amino acid sequence changes made in regions of high homology.
[0136] A useful method for identification of certain residues or regions of the polypeptide (e.g., antibody) that are preferred locations for mutagenesis is called alanine scanning mutagenesis as described by Cunningham and Wells, Science 244:1081-1085 (1989). Here, a residue or group of target residues are identified (e.g., charged residues such as Arg, Asp, His, Lys, and Glu) and replaced by a neutral or negatively charged amino acid (most preferably Alanine or Polyalanine) to affect the interaction of the amino acids with antigen. Those amino acid locations demonstrating functional sensitivity to the substitutions then are refined by introducing further or other variants at, or for, the sites of substitution. Thus, while the site for introducing an amino acid sequence variation is predetermined, the nature of the mutation per se need not be predetermined. For example, to analyze the performance of a mutation at a given site, ala scanning or random mutagenesis is conducted at the target codon or region and the expressed antibody variants are screened for the desired activity.
[0137] Another type of variant is an amino acid substitution variant. These variants have at least one amino acid residue in the antibody molecule replaced by a different residue. The sites of greatest interest for substitutional mutagenesis include the hypervariable regions, but FR alterations are also contemplated. Conservative substitutions are shown in the Table 1 below under the heading of preferred substitutions. If such substitutions result in a change in biological activity, then more substantial changes, denominated exemplary substitutions in the Table 1, or as further described below in reference to amino acid classes, may be introduced and the products screened.
TABLE-US-00001 TABLE 1 Original Exemplary Conservative Residue Substitutions Substitutions Ala (A) Val; Leu; Ile Val Arg (R) Lys; Gln; Asn Lys Asn (N) Gln; His; Asp, Lys; Arg Gln Asp (D) Glu; Asn Glu Cys (C) Ser; Ala Ser Gln (Q) Asn; Glu Asn Glu (E) Asp; Gln Asp Gly (G) Ala Ala His (H) Asn; Gln; Lys; Arg Arg Ile (I) Leu; Val; Met; Ala; Phe; Norleucine Leu Leu (L) Norleucine; Ile; Val; Met; Ala; Phe Ile Lys (K) Arg; Gln; Asn Arg Met (M) Leu; Phe; Ile Leu Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Tyr Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Val; Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) Ile; Leu; Met; Phe; Ala; Norleucine Leu
[0138] Substantial modifications in the biological properties of the polypeptide are accomplished by selecting substitutions that differ significantly in their effect on maintaining (a) the structure of the polypeptide backbone in the area of the substitution, for example, as a sheet or helical conformation, (b) the charge or hydrophobicity of the molecule at the target site, or (c) the bulk of the side chain. Amino acids may be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, Biochemistry second ed., pp. 73-75, Worth Publishers, New York (1975)): [0139] (1) non-polar: Ala (A), Val (V), Leu (L), Ile (I), Pro (P), Phe (F), Trp (W), Met (M) [0140] (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gln (Q) [0141] (3) acidic: Asp (D), Glu (E) [0142] (4) basic: Lys (K), Arg (R), His(H)
[0143] Alternatively, naturally occurring residues may be divided into groups based on common side-chain properties: [0144] (1) hydrophobic: Norleucine, Met, Ala, Val, Leu, Ile; [0145] (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gln; [0146] (3) acidic: Asp, Glu; [0147] (4) basic: His, Lys, Arg; [0148] (5) residues that influence chain orientation: Gly, Pro; [0149] (6) aromatic: Trp, Tyr, Phe.
[0150] Non-conservative substitutions will entail exchanging a member of one of these classes for another class.
[0151] Any cysteine residue not involved in maintaining the proper conformation of the antibody also may be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking. Conversely, cysteine bond(s) may be added to the polypeptide to improve its stability (particularly where the antibody is an antibody fragment such as an Fv fragment).
[0152] One example of substitutional variant involves substituting one or more hypervariable region residues of a parent antibody (e.g., a humanized antibody). Generally, the resulting variant(s) selected for further development will have improved biological properties relative to the parent antibody from which they are generated. A convenient way for generating such substitutional variants involves affinity maturation using phage display. Briefly, several hypervariable region sites (e.g., 6-7 sites) are mutated to generate all possible amino substitutions at each site. The antibody variants thus generated are displayed in a monovalent fashion from filamentous phage particles as fusions to the gene III product of M13 packaged within each particle. The phage-displayed variants are then screened for their biological activity (e.g., binding affinity) as herein disclosed. In order to identify candidate hypervariable region sites for modification, alanine scanning mutagenesis can be performed to identify hypervariable region residues contributing significantly to antigen binding. Alternatively, or additionally, it may be beneficial to analyze a crystal structure of the antigen-antibody complex to identify contact points between the antibody and target. Such contact residues and neighboring residues are candidates for substitution according to the techniques elaborated herein. Once such variants are generated, the panel of variants is subjected to screening as described herein and antibodies with superior properties in one or more relevant assays may be selected for further development.
[0153] Another type of amino acid variant of the polypeptide alters the original glycosylation pattern of the antibody. The polypeptide may comprise non-amino acid moieties. For example, the polypeptide may be glycosylated. Such glycosylation may occur naturally during expression of the polypeptide in the host cell or host organism, or may be a deliberate modification arising from human intervention. By altering is meant deleting one or more carbohydrate moieties found in the polypeptide, and/or adding one or more glycosylation sites that are not present in the polypeptide.
[0154] Glycosylation of polypeptide is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
[0155] Addition of glycosylation sites to the polypeptide is conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
[0156] Removal of carbohydrate moieties present on the polypeptide may be accomplished chemically or enzymatically or by mutational substitution of codons encoding for amino acid residues that serve as targets for glycosylation. Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo- and exo-glycosidases.
[0157] Other modifications include deamidation of glutaminyl and asparaginyl residues to the corresponding glutamyl and aspartyl residues, respectively, hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, methylation of the a-amino groups of lysine, arginine, and histidine side chains, acetylation of the N-terminal amine, and amidation of any C-terminal carboxyl group.
Chimeric Polypeptides
[0158] The polypeptide described herein may be modified in a way to form chimeric molecules comprising the polypeptide fused to another, heterologous polypeptide or amino acid sequence. In some embodiments, a chimeric molecule comprises a fusion of the polypeptide with a tag polypeptide which provides an epitope to which an anti-tag antibody can selectively bind. The epitope tag is generally placed at the amino- or carboxyl-terminus of the polypeptide. The presence of such epitope-tagged forms of the polypeptide can be detected using an antibody against the tag polypeptide. Also, provision of the epitope tag enables the polypeptide to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag.
Obtaining Polypeptides for Use in the Assay Methods
[0159] The polypeptides used in the assay methods described herein may be obtained using methods well-known in the art, including the recombination methods. The following sections provide guidance regarding these methods.
(A) Polynucleotides
[0160] Polynucleotide, or nucleic acid, as used interchangeably herein, refer to polymers of nucleotides of any length, and include DNA and RNA.
[0161] Polynucleotides encoding polypeptides may be obtained from any source including, but not limited to, a cDNA library prepared from tissue believed to possess the polypeptide mRNA and to express it at a detectable level. Accordingly, polynucleotides encoding polypeptide can be conveniently obtained from a cDNA library prepared from human tissue. The polypeptide-encoding gene may also be obtained from a genomic library or by known synthetic procedures (e.g., automated nucleic acid synthesis).
[0162] For example, the polynucleotide may encode an entire immunoglobulin molecule chain, such as a light chain or a heavy chain. A complete heavy chain includes not only a heavy chain variable region (V.sub.H) but also a heavy chain constant region (C.sub.H), which typically will comprise three constant domains: C.sub.II1, C.sub.II2 and C.sub.II3; and a hinge region. In some situations, the presence of a constant region is desirable.
[0163] Other polypeptides which may be encoded by the polynucleotide include antigen-binding antibody fragments such as single domain antibodies (dAbs), Fv, scFv, Fab and F(ab).sub.2 and minibodies. Minibodies are (typically) bivalent antibody fragments from which the C.sub.H1 and C.sub.K or C.sub.L domain has been excised. As minibodies are smaller than conventional antibodies they should achieve better tissue penetration in clinical/diagnostic use, but being bivalent they should retain higher binding affinity than monovalent antibody fragments, such as dAbs. Accordingly, unless the context dictates otherwise, the term antibody as used herein encompasses not only whole antibody molecules but also antigen-binding antibody fragments of the type discussed above. Preferably each framework region present in the encoded polypeptide will comprise at least one amino acid substitution relative to the corresponding human acceptor framework. Thus, for example, the framework regions may comprise, in total, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, or fifteen amino acid substitutions relative to the acceptor framework regions.
[0164] Suitably, the polynucleotides described herein may be isolated and/or purified. In some embodiments, the polynucleotides are isolated polynucleotides.
[0165] The term isolated polynucleotide is intended to indicate that the molecule is removed or separated from its normal or natural environment or has been produced in such a way that it is not present in its normal or natural environment. In some embodiments, the polynucleotides are purified polynucleotides. The term purified is intended to indicate that at least some contaminating molecules or substances have been removed.
[0166] Suitably, the polynucleotides are substantially purified, such that the relevant polynucleotides constitutes the dominant (i.e., most abundant) polynucleotides present in a composition.
(B) Expression of Polynucleotides
[0167] The description below relates primarily to production of polypeptides by culturing cells transformed or transfected with a vector containing polypeptide-encoding polynucleotides. It is, of course, contemplated that alternative methods, which are well known in the art, may be employed to prepare polypeptides. For instance, the appropriate amino acid sequence, or portions thereof, may be produced by direct peptide synthesis using solid-phase techniques (see, e.g., Stewart et al., Solid-Phase Peptide Synthesis W. H. Freeman Co., San Francisco, Calif. (1969); Merrifield, J. Am. Chem. Soc. 85:2149-2154 (1963)). In vitro protein synthesis may be performed using manual techniques or by automation. Automated synthesis may be accomplished, for instance, using an Applied Biosystems Peptide Synthesizer (Foster City, Calif.) using manufacturer's instructions. Various portions of the polypeptide may be chemically synthesized separately and combined using chemical or enzymatic methods to produce the desired polypeptide.
[0168] Polynucleotides as described herein are inserted into an expression vector(s) for production of the polypeptides. The term control sequences refers to DNA sequences necessary for the expression of an operably linked coding sequence in a particular host organism. The control sequences include, but are not limited to, promoters (e.g., naturally-associated or heterologous promoters), signal sequences, enhancer elements, and transcription termination sequences.
[0169] A polynucleotide is operably linked when it is placed into a functional relationship with another polynucleotide sequence. For example, nucleic acids for a presequence or secretory leader is operably linked to nucleic acids for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation. Generally, operably linked means that the nucleic acid sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase. However, enhancers do not have to be contiguous. Linking is accomplished by ligation at convenient restriction sites. If such sites do not exist, the synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice.
[0170] For antibodies, the light and heavy chains can be cloned in the same or different expression vectors. The nucleic acid segments encoding immunoglobulin chains are operably linked to control sequences in the expression vector(s) that ensure the expression of immunoglobulin polypeptides.
[0171] The vectors containing the polynucleotide sequences (e.g., the variable heavy and/or variable light chain encoding sequences and optional expression control sequences) can be transferred into a host cell by well-known methods, which vary depending on the type of cellular host. For example, calcium chloride transfection is commonly utilized for prokaryotic cells, whereas calcium phosphate treatment, electroporation, lipofection, biolistics or viral-based transfection may be used for other cellular hosts. (See generally Sambrook et al., Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Press, 2nd ed., 1989). Other methods used to transform mammalian cells include the use of polybrene, protoplast fusion, liposomes, electroporation, and microinjection. For production of transgenic animals, transgenes can be microinjected into fertilized oocytes, or can be incorporated into the genome of embryonic stem cells, and the nuclei of such cells transferred into enucleated oocytes.
(C) Vectors
[0172] The term vector includes expression vectors and transformation vectors and shuttle vectors.
[0173] The term expression vector means a construct capable of in vivo or in vitro expression.
[0174] The term transformation vector means a construct capable of being transferred from one entity to another entitywhich may be of the species or may be of a different species. If the construct is capable of being transferred from one species to anothersuch as from an Escherichia coli plasmid to a bacterium, such as of the genus Bacillus, then the transformation vector is sometimes called a shuttle vector. It may even be a construct capable of being transferred from an E. coli plasmid to an Agrobacterium to a plant.
[0175] Vectors may be transformed into a suitable host cell as described below to provide for expression of a polypeptide. Various vectors are publicly available. The vector may, for example, be in the form of a plasmid, cosmid, viral particle, or phage. The appropriate nucleic acid sequence may be inserted into the vector by a variety of procedures. In general, DNA is inserted into an appropriate restriction endonuclease site(s) using techniques known in the art. Construction of suitable vectors containing one or more of these components employs standard ligation techniques which are known to the skilled artisan.
[0176] The vectors may be for example, plasmid, virus or phage vectors provided with an origin of replication, optionally a promoter for the expression of the said polynucleotide and optionally a regulator of the promoter. Vectors may contain one or more selectable marker genes which are well known in the art.
[0177] These expression vectors are typically replicable in the host organisms either as episomes or as an integral part of the host chromosomal DNA.
(D) Host Cells
[0178] The host cell may be a bacterium, a yeast or other fungal cell, insect cell, a plant cell, or a mammalian cell, for example. Typically, host cells do not contain exogenous nucleic acids encoding recombinant polypeptides of interest or products, although host cells may contain exogenous nucleic acids encoding polypeptides, the expression of which confer desirable traits on the cells under certain conditions, for example, nucleic acids that encode polypeptides conferring antibiotic resistance.
[0179] A transgenic multicellular host organism which has been genetically manipulated may be used to produce a polypeptide. The organism may be, for example, a transgenic mammalian organism (e.g., a transgenic goat or mouse line).
[0180] Suitable prokaryotes include but are not limited to eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as E. coli. Various E. coli strains are publicly available, such as E. coli K12 strain MM294 (ATCC 31,446); E. coli X1776 (ATCC 31,537); E. coli strain W3110 (ATCC 27,325) and K5 772 (ATCC 53,635). Other suitable prokaryotic host cells include Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis (e.g., B. licheniformis 41P), Pseudomonas such as P. aeruginosa, and Streptomyces. These examples are illustrative rather than limiting. Strain W3110 is one particularly preferred host or parent host because it is a common host strain for recombinant polynucleotide product fermentations. Preferably, the host cell secretes minimal amounts of proteolytic enzymes. For example, strain W3110 may be modified to effect a genetic mutation in the genes encoding polypeptides endogenous to the host, with examples of such hosts including E. coli W3110 strain 1A2, which has the complete genotype tonA; E. coli W3110 strain 9E4, which has the complete genotype tonA ptr3; E. coli W3110 strain 27C7 (ATCC 55,244), which has the complete genotype tonA ptr3 phoA E15 (argF-lac)169 degP ompT kan; E. coli W3110 strain 37D6, which has the complete genotype tonA ptr3 phoA E15 (argF-lac) 169 degP ompT rbs7 ilvG kan; E. coli W3110 strain 40B4, which is strain 37D6 with a non-kanamycin resistant degP deletion mutation; and an E. coli strain having mutant periplasmic protease. Alternatively, in vitro methods of cloning, e.g., PCR or other nucleic acid polymerase reactions, are suitable.
[0181] In these prokaryotic hosts, one can make expression vectors, which will typically contain expression control sequences compatible with the host cell (e.g., an origin of replication). In addition, any number of a variety of well-known promoters will be present, such as the lactose promoter system, a tryptophan (trp) promoter system, a beta-lactamase promoter system, or a promoter system from phage lambda. The promoters will typically control expression, optionally with an operator sequence, and have ribosome binding site sequences and the like, for initiating and completing transcription and translation.
[0182] Eukaryotic microbes may be used for expression. Eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for polypeptide-encoding vectors. Saccharomyces cerevisiae is a commonly used lower eukaryotic host microorganism. Others include Schizosaccharomyces pombe; Kluyveromyces hosts such as, e.g., K. lactis (MW98-8C, CBS683, CBS4574), K. fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K. waltii (ATCC 56,500), K. drosophilarum (ATCC 36,906), K. thermotolerans, and K. marxianus; yarrowia (EP 402,226); Pichia pastoris; Candida; Trichoderma reesia; Neurospora crassa; Schwanniomyces such as Schwanniomyces occidentalis; and filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium, and Aspergillus hosts such as A. nidulans, and A. niger. Methylotropic yeasts are suitable herein and include, but are not limited to, yeast capable of growth on methanol selected from the genera consisting of Hansenula, Candida, Kloeckera, Pichia, Saccharomyces, Torulopsis, and Rhodotorula. Saccharomyces is a preferred yeast host, with suitable vectors having expression control sequences (e.g., promoters), an origin of replication, termination sequences and the like as desired. Typical promoters include 3-phosphoglycerate kinase and other glycolytic enzymes. Inducible yeast promoters include, among others, promoters from alcohol dehydrogenase, isocytochrome C, and enzymes responsible for maltose and galactose utilization.
[0183] In addition to microorganisms, mammalian tissue cell culture may also be used to express and produce the polypeptides as described herein and in some instances are preferred (See Winnacker, From Genes to Clones VCH Publishers, N.Y., N.Y. (1987). For some embodiments, eukaryotic cells may be preferred, because a number of suitable host cell lines capable of secreting heterologous polypeptides (e.g., intact immunoglobulins) have been developed in the art, and include CHO cell lines, various Cos cell lines, HeLa cells, preferably, myeloma cell lines, or transformed B-cells or hybridomas. In some embodiments, the mammalian host cell is a CHO cell.
[0184] In some embodiments, the host cell is a vertebrate host cell. Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR(CHO or CHO-DP-12 line); mouse sertoli cells; monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells; MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2).
Recombinant Methods
[0185] Recombinant polypeptides of interest, also referred to herein as products, such as antibodies, may be produced using recombinant methods and compositions, e.g., as described in U.S. Pat. No. 4,816,567. In some embodiments, isolated nucleic acid encoding a recombinant polypeptide such as an antibody are provided. Such nucleic acids may encode an amino acid sequence comprising the VL and/or an amino acid sequence comprising the VH of the antibody (e.g., the light and/or heavy chains of the antibody). In some embodiments, one or more vectors (e.g., expression vectors) comprising such nucleic acid are provided. In some embodiments, a host cell is transformed or transfected with such nucleic acid to generate a recombinant polypeptide-expressing cell or product cell. In one such embodiment, a recombinant polypeptide-expressing cell comprises (e.g., has been transformed with): (1) a vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and an amino acid sequence comprising the VH of the antibody, or (2) a first vector comprising a nucleic acid that encodes an amino acid sequence comprising the VL of the antibody and a second vector comprising a nucleic acid that encodes an amino acid sequence comprising the VH of the antibody.
[0186] In some embodiments, the host cell is eukaryotic, e.g. a Chinese Hamster Ovary (CHO) cell. In some embodiments, a method of making a recombinant polypeptide is provided, wherein the method comprises culturing a recombinant polypeptide-expressing cell comprising nucleic acid encoding the product, as provided above, under conditions suitable for expression of the product, and optionally recovering the product from the cell (or cell culture medium).
Articles of Manufacture
[0187] The polypeptides used in the methods described herein may be contained within an article of manufacture. The article of manufacture may comprise a container containing the polypeptide(s). In some embodiments, the article of manufacture comprises:(a) a container comprising a composition comprising the polypeptide(s) described herein within the container; and (b) a package insert with instructions for using the polypeptide(s) in the assay method.
[0188] The article of manufacture comprises a container and a label or package insert on or associated with the container. Suitable containers include, for example, bottles, vials, test tubes etc. The containers may be formed from a variety of materials such as glass or plastic. The container holds or contains a polypeptide composition. At least one active agent in the composition is the polypeptide. The label or package insert indicates that the composition's use in an assay with specific guidance regarding amounts and incubation times. The article of manufacture may further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters.
[0189] All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features.
EXAMPLES
[0190] The following are examples of methods and compositions of the invention. It is understood that various other embodiments may be practiced, given the general description provided above.
[0191] As used in the Examples below and elsewhere herein, PLB2 and PLBL2 and PLBD2 are used interchangeably and refer to the enzyme phospholipase B-like 2 or its synonym, phospholipase B-domain-like 2.
Example 1
General Methods
[0192] MAb Feedstocks
[0193] MAb feedstocks for all examples were selected from industrial, pilot or small scale cell culture batches at Genentech (South San Francisco, Calif., U.S.A.). After a period of cell culture fermentation, the cells were separated and, in certain instances, the clarified fluid (harvested cell culture fluid, HCCF) was purified by Protein A chromatography and one or more additional chromatography steps and filtration steps as indicated in the Examples below. HCCF or in-process pools at various steps of purification were used to investigate the performance of the ELISA assay described in Examples 3 and 5. The results of using the Example 3 ELISA assay are described in Example 4 and the results of using the Example 5 ELISA assay are described in Example 6.
[0194] Spectrophotometric Method for MAb Quantification
[0195] The concentration of antibody was determined via absorbance at 280 and 320 nm using a UV-visible spectrophotometer (8453 model G1103A; Agilent Technologies; Santa Clara, Calif., U.S.A.) or NanoDrop 1000 model ND-1000 (Thermo Fisher Scientific; Waltham, Mass., U.S.A.). Species other than antibody (i.e. impurities) were too low in concentration to have an appreciable effect on UV absorbance. As needed, samples were diluted with an appropriate non-interfering diluent in the range of 0.1-1.0 absorbance unit. Sample preparation and UV measurements were performed in duplicate and the average value was recorded. The mAb absorption coefficients ranged from 1.42 to 1.645/mg.Math.ml.Math.cm.
[0196] Affinity Chromatographic/HPLC Method for Product Quantification (Product Concentration Assay)
[0197] The product concentration assay is an affinity chromatographic method for the measurement of polypeptides that bind to Protein A. The method may use HPLC as a means for carrying out the affinity chromatography. Products that may be measured by this assay include any Fc-containing polypeptide and include for example, but are not limited to, monoclonal antibodies, bispecific or multispecific antibodies, antibody fragments, including half antibodies, and immunoadhesins. An affinity chromatography column (2.1-mm diameter30-mm length, 20-m particle size) containing immobilized Protein A (approximately 1 mg) and an approximate volume of 0.1 mL was used in the method. Protein A affinity chromatography columns can be made by methods known in the art and are also available commercially, e.g., from Life Technologies. Samples and four standards of differing IgG concentration were applied to the column (20 uL standard injection volume) in a Phosphate Buffered Saline loading buffer. Typically, the samples were Harvested Cell Culture Fluid (HCCF) and the product was eluted from the column with 2% acetic acid/100 mM glycine (pH 2.5) at a flow rate of 2 mL/min. The peak area of the eluted material was compared to the peak areas of the four point IgG standard curve, using the extinction coefficient of the appropriate product, to calculate the amount of product analyte. The range of the assay was typically 0.025 mg/mL-4.0 mg/mL. Product concentration was determined according to the following formula: mg/mL IgG=HPLC value (mg/mL)(extinction coefficient of standard material/extinction coefficient of sample material).
[0198] Total CHO Host Cell Protein (CHOP) Quantification
[0199] An ELISA was used to quantify the levels of the total host cell proteins called CHOP. The ELISAs used to detect CHO proteins in products were based upon a sandwich ELISA format. Affinity-purified polyclonal antibody to CHOP was coated onto a 96-well microtiter plate. Standards, controls, and samples were then loaded in duplicate into separate wells. CHOP, if present in the sample, will bind to the coat antibody (polyclonal anti-CHOP). After an incubation step, anti-CHOP polyclonal antibody-conjugated to horseradish peroxidase (HRP) was added to the plate. After a final wash step, CHOP was quantified by adding a solution of tetramethyl benzidine (TMB), also available as SUREBLUE RESERVE from KPL, Kirkegaard & Perry Laboratories, Inc., Gaithersburg, Md., cat no. 53-00-03), which when acted on by the HRP enzyme produces a colorimetric signal. The optical density (OD) at 450 nm was measured in each well. A five-parameter curve-fitting program (SOFTMAX Pro, Molecular Devices, Sunnyvale, Calif.) was used to generate a standard curve, and sample CHOP concentrations were computed from the standard curve. The assay range for the total CHOP ELISA was from 5 to 320 ng/ml. CHOP concentration, in ng/mL, refers to the amount of CHOP in a sample using the CHOP standard as a calibrator. CHOP ratio (in ng/mg or ppm) refers to the calculated ratio of CHOP concentration to product concentration and, in certain instances, was the reported value for the test methods. The Total CHOP ELISA may be used to quantify total CHOP levels in a sample but does not quantify the concentration of individual proteins.
[0200] Commercially Available PLBL2 ELISA Assay Kits
[0201] We tested whether either of two commercially available kits marketed for the purpose of detecting PLBL2 would be capable of detecting PLBL2 in recombinant antibody preparations and if so, whether they would provide adequate quantification. The first kit tested was ELISA Assay Kit for human Phospholipase B (PLB) E92048Hu from USCN Life Science Inc. This kit is described as a sandwich ELISA for in vitro quantitative measurement of PLB in human tissue homogenates and other biological fluids. Samples tested in this assay included one known positive source (a recombinant antibody preparation purified from CHO cells) of hamster PLBL2 where the level of PLBL2 impurity had been determined using a mass spectrometry assay (described further below) to be approximately 300 ng/mg. A second recombinant antibody preparation purified from CHO cells and known to have no detectable PLBL2 was also tested. Although a standard curve was generated showing detection of the human PLBL2 standard included in the kit over the range of 0.3-20 ng/ml (
[0202] The other kit tested was Hamster putative phospholipase B-like 2 (PLBD2) ELISA kit, catalog CSB-EL018125Ha from CUSABIO. This kit claims to provide quantitative determination of hamster putative phospholipase B-like (PLBD2) concentrations in serum, plasma, tissue homogenates, cell lysates. The same samples as tested in the USCN Life Science Inc. kit were also assayed in this kit. Although a standard curve was generated showing detection of the hamster PLBL2 standard included in the kit over the range of 0.12-8 ng/ml (
[0203] We therefore concluded that these commercially available assays did not quantify hamster PLBL2 in samples that were known to be positive for hamster PLBL2. One explanation is that the anti-PLBL2 antibodies in these assays are of low affinity for the hamster (CHO)-PLBL2 found in our samples. Another explanation is that the anti-PLBL2 antibodies were unable to detect CHO-PLBL2 when it appeared in the sample matrix that contained high levels of recombinant human IgG, as in our samples. These results indicated a need to develop new anti-PLBL2 antibodies and new assay conditions to enable the detection and accurate quantification of PLBL2 impurity in our recombinant antibody preparations. Those efforts are described in the Examples below.
Example 2
Generation of Antibodies that Bind Hamster PLBL2
[0204] Identification of PLBL2 as an impurity in an antibody preparation prompted us to synthesize the gene, and then express and purify hamster PLBL2. The literature on PLBL2 describes it as a lysosomal enzyme of approximately 66 kD molecular weight (F. Deuschl et al., FEBS Lett 580:5747-5752 (2006)). As with other lysosomal enzymes this protein contains multiple post translational modifications with mannose-6-phosphate, and is originally synthesized as a pre-proenzyme. During processing, a leader sequence is clipped off, and a proteolytic clip occurs, resulting in the protein running as three bands on SDS-PAGE gels: intact PLBL2 (MW 66 kD), an N-terminal domain (28 kD) and a C-terminal domain (40 kD). Clipping occurs at acidic pH levels. Although the N-domain and C-domains separate on SDS-PAGE, the fragments probably do not separate in native conditions, since we have observed that strong solvents (e.g., urea, guanidine, or ethanol) were needed to separate the fragments. Additionally, other laboratories that have purified PLBL2 for crystallography studies have also observed this clip and have been unable to separate intact from clipped proteins with chromatographic methods (F. Deuschl et al., FEBS Lett 580:5747-5752 (2006); A. Jensen et al., Biochem Journal 402, 449-458 (2007), F. Lakomek et al., BMC Structural Biology 9:56 (2009)).
[0205] DNA encoding soluble hamster (Cricetulus griseus) PLBL2 was synthesized from publicly available sequence information (see Table of Sequences below for exemplary nucleic acid and amino acid sequences) and cloned into a standard mammalian expression vector using typical methods known in the art including the addition of a histidine (his) tag. Soluble PLBL2 was transiently expressed in CHO-K1 cells (ATCC CRL9618). Cell culture supernatants were harvested (referred to as HCCF) and PLBL2 was purified using the following methods.
[0206] Harvested Cell Culture Fluid (HCCF) was ultrafiltered (UF) 10-fold by Tangential Flow Filtration (TFF), using 10 kDa molecular weight cutoff (MWCO) membranes. The UF HCCF was diafiltered (DF) against 10 volumes of a phosphate-buffered saline (PBS), NaCl buffer. The UF/DF HCCF was applied to a Ni-NTA immobilized metal affinity chromatography (IMAC) column (QIAGEN, Cat. No. 30622) and eluted with an increasing imidazole gradient. The Ni-NTA pool was conditioned with a buffer containing sodium sulfate, and then applied to an Octyl-Sepharose CL-4B hydrophobic interaction chromatography (HIC) column (GE Healthcare Life Sciences, Product No. 17-0790-01). The Octyl-Sepharose column was eluted with a decreasing sodium sulfate gradient. The Octyl-Sepharose pool was re-chromatographed on a Ni-NTA column and step-eluted with a high concentration of imidazole. The Ni-NTA re-chromatography pool was concentrated using centrifugal filtration units equipped with 10 kDa molecular weight cutoff membranes (Millipore). The concentrated Ni-NTA re-chromatography pool was formulated on a Superdex 200 size-exclusion chromatography (SEC) column (GE Healthcare Life Sciences, Product No. 17-1043-02). Fractions from the Superdex 200 column were collected and analyzed by sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), high pressure liquid chromatography (HPLC) and by Western Blot methods (using antibodies against total Chinese Hamster Ovary Proteins, CHOP (Genentech, Inc.), and commercially available antibodies against Phospholipase B2) to determine purity.
[0207] To generate monoclonal antibodies, five Balb/c mice (Charles River Laboratories International, Inc., Hollister, Calif.) were immunized with the purified recombinant soluble PLBL2 at 3-4 day intervals, in each footpad and intraperitoneally, in an adjuvant containing metabolizable squalene (4% v/v), Tween 80 (0.2% v/v), trehalose 6,6-dimycolate (0.05% w/v) and monophosphoryl lipid A (0.05% w/v; all components obtained from Sigma Aldrich, USA). After 6 injections, serum titers were evaluated by standard enzyme-linked immunosorbant assay (ELISA) to identify mice with positive serum titers to PLBL2. B cells from spleens and lymph nodes from two mice, demonstrating the highest titers, were fused with mouse myeloma cells by electrofusion (Hybrimune; Harvard Apparatus, Inc., Holliston, Mass.). After 7 days, approximately 5000 colonies were picked into 96 well tissue culture plates containing hybridoma culture medium by using Clonepix-FL (Molecular Devices, Sunnyvale, Calif.). The hybridoma supernatants were harvested and screened for PLBL2 specific antibody production by direct ELISA. 25 clones showing specific binding to PLBL2 protein by ELISA were further ranked based on their affinity as measured by OCTET (ForteBio, Inc., Menlo Park, Calif.). Mouse hybridoma supernatants were diluted to 5 g/ml in kinetics buffer (ForteBio, Inc., Menlo Park, Calif.) or used neat (if concentration was less than 5 mg/ml) and captured on anti-mouse IgG (Fv) sensor tips (ForteBio, Inc., Menlo Park, Calif.), followed by dipping the sensors in PLBL2 protein at 10 g/ml. The association and dissociation kinetic measurements were determined by using ForteBio data analysis software. All 25 clones were further characterized by Western blot for binding to C terminal, N terminal and whole PLBL2. Hybridoma supernatants for clones 1.26G6, 1.20B5, 1.19C10, 1.15G11, 1.4E2, 1.39C10 and 1.30F3 showing immunobinding to either C or N terminal or intact PLBL2 protein were purified by affinity chromatography (MabSelect SuRe; GE Healthcare Bio-Sciences, Piscataway, N.J.), sterile-filtered, and stored at 4 C. in PBS. Four of the 7 antibodies with high yield were selected for biotinylation. Binding activity for both biotinylated and unbiotinylated antibodies were confirmed by Octet. The purified antibodies were then evaluated for possible use in development of an ELISA assay. Two antibodies, 1.19C10 and 1.15G11 were selected for ELISA assay development.
[0208] The antibodies 1.19C10 and 1.15G11 were both identified as IgG1, kappa using Isostrip Mouse mAb Isotyping Kit (Roche Applied Biosciences, Indianapolis, Ind.). DNA encoding each of these antibodies were cloned and expressed transiently in either 293 cells or CHO cells. To obtain antibody variable sequences from clone 1.15G11 and 1.19C10 for transient expression in CHO cells, a 5 rapid amplification of cDNA ends (5RACE) method was used, which was based on those methods previously described (see, e.g., Nature Methods 2, 629-630 (2005) and Rapid amplification of 5 cDNA ends, in Molecular Cloning: A Laboratory Manual (eds. Sambrook, J. & Russell, D. W.) Chapter 8 Protocol 9, 8.54-8.60 (Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA, 2001)). Total RNA was extracted from cultured hybridoma cells (at least 10.sup.6 cells) with RNeasy Plus kit (Qiagen, Valencia, Calif.) and cDNA was prepared with SMARTer RACE cDNA amplification kit (Clontech Inc., Mountain View, Calif.). To amplify the variable regions of heavy and light chain, universal primer A mix targeting to the oligos tagging at the 5 end of cDNA (included in SMARTer RACE cDNA amplification kit) and a reverse primer targeting to the constant region of mouse IgG heavy chain and kappa light chain were used respectively in Polymerase Chain Reaction (PCR). The PCR condition was setup as following: 1 L cDNA, 5 L 10 universal primer mix, 1 L 10 uM reverse primers, 45 L PCR premix (Life Technologies Inc. Foster City, Calif.); 94 C., 2 min followed by 94 C. 30 sec, 55 C. 30 sec, 72 C. 30 sec for 30 cycles and 72 C. 10 min. The PCR products were resolved on DNA agarose gel and PCR products with expected size (700 bp for heavy chain and 500 bp for light chain) were purified from gel for sequencing analysis to determine the DNA sequences of variable region of heavy and light chain (VH and VK).
[0209] To clone the VH/VK regions described above into antibody expression vectors, we used the In-Fusion cloning method (Clontech Inc.) and the following primers: 1.15G11 heavy chain, forward primer 5-ACT GGA GCG TAC GCT GAA GTG AAG CTT GAG GAG TCT-3(SEQ ID NO:23), reverse primer 5-AAG ACC GAT GGG CCC TTG GTG GAG GCT GAG GAG ACG GTG ACT GAG GTT C-3 (SEQ ID NO:24); 1.19C10 heavy chain, forward primer 5-ACT GGA GCG TAC GCT GAG GTG CAG CTT CAG GAG TCA-3 (SEQ ID NO:25), reverse primer 5-AAG ACC GAT GGG CCC TTG GTG GAG GCT GAG GAG ACT GTG AGA GTG GTG C-3(SEQ ID NO:26). For both 1.15G11 and 1.19C10 light chain, forward primer 5-GCA ACT GCA ACC GGT GTA CAT TCA GAC ATT GTG ATG ACC CAG TCT-3 (SEQ ID NO:27), reverse primer 5-GGT GCA GCC ACG GTC CGC TTC AGC TCC AGC TTG GTA CC-3 (SEQ ID NO:28). 1 L of cDNA was used as template in PCR under the same condition described previously. PCR products were then purified with PCR clean-up kit (Qiagen Inc.) for subcloning into antibody expression vectors. Mouse IgG1 expression vector was linearized with BsiWI and ApaI digestion, and mouse kappa expression vector was digested with AgeI and BssHII. For In-Fusion cloning reaction, 50 ng linearized vector DNA and 50 ng VH or VK PCR products were mix together with 5 In-Fusion enzymes and then incubated at 50 C. for 15 min. 3 L of In-Fusion reaction was used for transformation and plating on carbenicillin (50 g/mL) selective LB agar plates. Single colonies were picked and cultured for plasmid DNA purification. Clones with in-frame VH or VK insert were identified with sequencing analysis.
[0210] The recombinant antibodies were purified as described above and compared to the purified hybridoma-derived antibodies and found to comparable by both direct ELISA and OCTET (ForteBio, Inc., Menlo Park, Calif.) (assayed as described above). The recombinant antibodies produced as described above are referred to, respectively, as 19C10 and 5G11. Amino acid sequence information for 19C10 and 5G11 are provided in the Table of Sequences.
[0211] To generate polyclonal antibodies, three serum pathogen-free New Zealand white female rabbits (Antibody Solutions, Mountain View, Calif.) were immunized with purified recombinant PLBL2 (as described above) at two-week intervals, subcutaneously in the nape, in an adjuvant containing hydrogel and muramyl dipeptide (MDP). Each injection contained 150 ug of purified recombinant soluble PLBL2. A total of six injections were administered on days 0, 21, 49, 63, 84, and 112. Each rabbit was bled a total of 7 times on days 42, 70, 77, 91, 98, 119 and 126 to test antibody titers. The rabbits were exsanguinated on day 134. As a control, pre-immune serum from each rabbit was collected on day 0 prior to injection.
[0212] To determine antibody reactivity to PLBL2, antiserum was used in a solution phase capture method. In the solution phase capture method the pre-immune and anti-sera from the three different rabbits (Rabbit A, B and C) were serially diluted from 1/1000 initial dilution. The diluted sera were incubated with a fixed concentration of biotinylated PLBL2 at 3 ug/mL for 2 hr in a non-binding 96-well plate. The solution was then transferred to Pierce NeutrAvidin Coated Clear 96-Well Plate with Superblock Blocking buffer (Pierce Prod# 15129) and incubated for 1 hour to capture the biotinylated PLBL2. After the incubation step, unbound materials were washed away using Wash Buffer (0.05% Polysorbate 20/PBS [Corning Cellgro Cat. No. 99-717-CM]). Peroxidase conjugated AffiniPure goat anti-rabbit IgG (Jackson Immunoresearch Cat. No. 111-035-144) was diluted in Assay Diluent at a dilution factor of 1/20,000 and added to the wells of the microtiter plate. After a 2 hr. incubation step with peroxidase conjugated goat anti-rabbit IgG at room temperature, a final wash step with Wash Buffer (described above) was performed. Subsequently, color was developed by adding a solution of TMB (50 ul/well) (SUREBLUE RESERVE from KPL, Kirkegaard & Perry Laboratories, Inc., Gaithersburg, Md., cat no. 53-00-03) followed by incubation at room temperature for 10-20 minutes. Detection was carried out by assessing optical density (OD) at 450 nm in each well using a Molecular Devices SpectraMax M5e. A five-parameter curve-fitting program (SoftMax Pro v5.2 rev C) was used to process the data.
[0213] Based on the solution phase capture experiment described above, the anti-sera from all three rabbits were found to have developed good quality antibodies against PLBL2. The pre-immune serum for all three rabbits did not have affinity for PLBL2. Since all three rabbits had a similar response curve to PLBL2, antisera from exsanguination bleeds from all three rabbits were combined into a single lot for the polyclonal PLBL2 ELISA assay (described below in Example 5).
[0214] The pooled rabbit antiserum was initially fractionated with 60% ammonium sulfate, which precipitated all of the antibodies in the serum. Affinity chromatography was used to select for the antibodies produced against PLBL2. PLBL2 was immobilized on Glyceryl-CPG, and the gel was packed into a chromatography column. The 60% ammonium sulfate pellet was dissolved in PBS, pH 7.2, and was loaded to the PLBL2-CPG column. After the loading was complete, the column was washed with PBS+0.02% NaN.sub.3, pH 7.2. The antibodies against PLBL2 were eluted from the affinity column with PBS, pH 2.0, collecting the elution pool into a 1.0 M Tris, pH 7.5-8.0 solution. Lastly, the purified anti-PLBL2 antibodies were concentrated and then buffer-exchanged into PBS+0.02% NaN.sub.3, pH 7.2, using size-exclusion chromatography. The affinity purified rabbit polyclonal antibodies were used in the polyclonal PLBL2 ELISA described below in Example 5.
Example 3
Murine Monoclonal Anti-Hamster PLBL2 ELISA Assay
[0215] An ELISA assay to detect and quantify the CHOP impurity, PLBL2, in recombinant polypeptide samples, such as recombinant antibody or immunoadhesin preparations, was developed. The procedure is as follows. Murine monoclonal antibody 19C10 was coated onto a half area 96-well microtiter plate at a concentration of 0.5 g/mL in carbonate buffer (0.05M sodium carbonate, pH 9.6), overnight at 2-8 C. After coating, the plate was blocked with Blocking Buffer (0.15M NaCl, 0.1M sodium phosphate, 0.1% fish gelatin, 0.05% polysorbate 20, 0.05% Proclin 300 [Sigma-Aldrich]; also referred to as Assay Diluent) to prevent non-specific sticking of proteins. Standards, controls, and samples were diluted in Assay Diluent (0.15M NaCl, 0.1M sodium phosphate, 0.1% fish gelatin, 0.05% polysorbate 20, 0.05% Proclin 300 [Sigma-Aldrich]) then loaded in duplicate into separate wells and incubated for 2 hrs at room temperature (22-27 C.). PLBL2, if present in the sample, would bind to the coat (also referred to herein as capture) antibody. After the incubation step described above, unbound materials were washed away using Wash Buffer (0.05% polysorbate 20/PBS [Corning cellgro Cat. No. 99-717-CM]) and the 15G11 anti-PLBL2 murine monoclonal antibody conjugated to biotin was diluted in Assay Diluent to a concentration of 0.03125 g/mL and added to the wells of the microtiter plate.
[0216] Biotin conjugation was carried out as follows. A biotinylation kit was purchased from Pierce Thermo Scientific, (P/N 20217, E-Z Link NHS-Biotin), and streptavidin-HRP (SA-HRP) from Jackson Immuno Cat. No. 016-030-084. Instructions in the Pierce Kit were followed. Briefly, IgG was dialyzed into PBS, pH 7.4, and biotin was added to the protein and mixed at room temperature for 1 hr. The labeled antibody was then dialized against PBS, pH 7.4 to remove excess biotin, filtered, and protein concentration determined by A280.
[0217] After a 2 hr. incubation step with biotinylated 15G11 at room temperature, Streptavidin HRP (1:200,000 dilution in Assay Diluent) was added to the microtiter plate wells. After a final wash step with Wash Buffer (described above), color was developed (for PLBL2 quantification) by adding a solution of TMB (50 l/well) (SUREBLUE RESERVE from KPL, Kirkegaard & Perry Laboratories, Inc., Gaithersburg, Md., cat no. 53-00-03) followed by incubation at room temperature for 10-20 minutes. Detection was carried out by assessing optical density (OD) at 450 nm in each well using a Molecular Devices SpectraMax M5e. A four-parameter curve-fitting program (SoftMax Pro v5.2 rev C) was used to generate a standard curve, and sample PLBL2 concentrations were computed from the linear range of the standard curve.
[0218] As shown in
Example 4
Results Using Monoclonal PLBL2 ELISA Assay
[0219] Using the hamster PLBL2 ELISA assay described above in Example 3, we assessed a variety of monoclonal antibody (mAb) preparations produced in CHO cells to quantify the amount of contaminating PLBL2 under different conditions. We assessed multiple runs of purified preparations as well as harvested cell culture fluid (HCCF), which was not purified. For comparison, in certain cases, we also quantified the amount of PLBL2 peptides by LC-MS/MS. The LC-MS/MS method was performed as follows.
[0220] For quantification of PLBL2 by LC-MS/MS, a Waters Acquity H-Class Bio UPLC and AB Sciex TripleTOF 5600+ mass spectrometer were used. Samples and calibration standards (recombinant PLBL2 spiked into a recombinant humanized monoclonal antibody preparation obtained from a mouse NS0 cell line [the NS0 cell line does not contain hamster PLBL2]) were reduced and digested by trypsin. A total of 40 g digested sample was injected onto the UPLC, using a Waters BEH300 C18 column, particle size 1.7 m. A linear gradient of acetonitrile was used to elute the peptides, at a flow rate of 300 l/min and a column temperature of 60 C.
[0221] Peptides eluting from the UPLC were introduced to the mass spectrometer by electrospray ionization in positive ionization mode. Ion source temperature was set at 400 C., with an IonSpray voltage of 5500 v. and declustering potential of 76 v. A collision energy setting of 32 was used for the fragmentation of selected peptide ions. The mass spectrometer was operated in multiple reaction monitoring high resolution (MRM.sup.HR) mode, using four specific PLBL2 peptides and their fragment ion transitions. The parent ions were selected by the quadrupole mass spectrometer with a mass to charge (m/z) selection window of 1.2 amu. Fragment ions of each parent ion were separated by the time-of-flight mass spectrometer and selected for quantification post data acquisition with a selection window of 0.025 amu.
[0222] The concentration of PLBL2 in samples was determined by measuring the specific signal responses of the four transitions, calibrated by those from the standards in the range of 2-500 ppm using a linear fit. Table 2 below shows the list of PLBL2 peptides monitored by LC-MS/MS. Representative standard curves for each of the peptides monitored by LC-MS/MS are shown in
TABLE-US-00002 TABLE2 ListofPLBL2PeptidesMonitoredbyLC-MS/MS TripleTOF5600+ ScanCycle Fragment Scan SEQID Ionof Parent Fragment # ScanType Peptide NO: Interest m/z m/z 1 TOFMS N/A N/A N/A N/A 2 ProductIon SVLLDAASGQLR 29 +2y8 615.3461 817.4163 3 ProductIon GLEDSYEGR 30 +2y7 513.2304 855.3479 4 ProductIon AFIPNGPSPGSR 31 +2y9 600.3120 868.4272 5 ProductIon VTSFSLAK 32 +2y6 426.7449 652.3665
[0223] Tables 3 and 4 below show the PLBL2 ratio in various purification runs of two different mAb preparations, mAb A and mAb B, as determined by both LC-MS/MS and by the hamster PLBL2 ELISA assay described in Example 3. Just as for CHOP ratio described above, PLBL2 ratio is provided as ng/mg or parts-per-million (ppm) and refers to the calculated ratio of PLBL2 concentration to product (mAb) concentration. The results shown in Tables 3 and 4 indicate that the PLBL2 ELISA assay was able to quantitate PLBL2 levels in two different mAb preparations over a wide range and under different purification processes (each run number indicates a different purification process).
TABLE-US-00003 TABLE 3 PLBL2 Ratio in Various Lots of mAb A PLBL2 by LC-MS/MS RUN NUMBER PLBL2 by ELISA (ng/mg) (ng/mg) 1 83 87 2 122 90 3 34 32 4 137 103 5 242 141 6 328 241 7 273 154 8 0.2 <2 9 0.4 <2 10 0.3 <2 11 0.2 <2
TABLE-US-00004 TABLE 4 PLBL2 Ratio in Various Lots of mAb B PLBL2 by LC-MS/MS RUN NUMBER PLBL2 by ELISA (ng/mg) (ng/mg) 1 26 N/A 2 32 N/A 3 41 46 4 56 61 5 39 N/A
[0224] We also assessed the ability of the PLBL2 ELISA assay described in Example 3 to determine levels of contaminating PLBL2 in unpurified HCCF for a wide number of mAb preparations, some of which were IgG1 and some of which were IgG4. Those results are shown in
[0225] In addition, we assessed PLBL2 clearance through a three-column chromatography purification process with a final ultrafiltration/diafiltration (UFDF) step of mAb G using the monoclonal PLBL2 ELISA assay described in Example 3. The results are shown in
Example 5
Rabbit Polyclonal Anti-Hamster PLBL2 ELISA Assay
[0226] An ELISA assay to detect and quantify the CHOP impurity, PLBL2, in recombinant polypeptide samples, such as recombinant antibody or immunoadhesin preparations, was developed. The procedure was as follows. Affinity purified rabbit polyclonal antibody was coated onto a half area 96-well microtiter plate at a concentration of 0.5 ug/mL in carbonate buffer (0.05M sodium carbonate, pH 9.6), overnight at 2-8 C. After coating, the plate was blocked with Blocking Buffer (0.15M NaCl, 0.1M sodium phosphate, 0.1% fish gelatin, 0.05% Polysorbate 20, 0.05% Proclin 300 [Sigma-Aldrich]) to prevent non-specific sticking of proteins. Standards, controls, and samples were diluted in Assay Diluent (0.15M NaCl, 0.1M sodium phosphate, 0.1% fish gelatin, 0.05% Polysorbate 20, 0.05% Proclin 300 [Sigma-Aldrich]) then loaded in duplicate into separate wells and incubated for 2 hr at room temperature (22-27 C.). PLBL2, if present in the sample, would bind to the coat (also referred to herein as capture) antibody. After the incubation step described above, unbound materials were washed away using Wash Buffer (0.05% Polysorbate 20/PBS [Corning Cellgro Cat. No. 99-717-CM]) and the affinity purified rabbit polyclonal antibody conjugated to horseradish peroxidase (HRP) was diluted in Assay Diluent to a concentration of 40 ng/mL and added to the wells of the microtiter plate.
[0227] HRP conjugation was carried out as follows. A HRP conjugation kit was purchased from Pierce Thermo Scientific, (P/N 31489, E-Z Link Plus Activated Peroxidase and Kit). Instructions in the Pierce Kit were followed. Briefly, IgG was dialyzed into Carbonate-Bicarbonate buffer, pH 9.4, and EZ-Link Plus Activated Peroxidase was added to the protein and mixed at room temperature for 1 hr. Sodium cyanoborohydride and Quenching buffer were added subsequently to stabilize the conjugation and quench the reaction. The labeled antibody was then dialyzed against PBS, pH 7.4, filtered, and protein concentration determined by A280.
[0228] After a 2 hr. incubation step with HRP conjugated rabbit polyclonal antibody at room temperature, a final wash step with Wash Buffer (described above) was performed. Afterwards, color was developed (for PLBL2 quantification) by adding a solution of TMB (50 ul/well) (SUREBLUE RESERVE from KPL, Kirkegaard & Perry Laboratories, Inc., Gaithersburg, Md., cat no. 53-00-03) followed by incubation at room temperature for 10-20 minutes. Detection was carried out by assessing optical density (OD) at 450 nm in each well using a Molecular Devices SpectraMax M5e. A five-parameter curve-fitting program (SoftMax Pro v5.2 rev C) was used to generate a standard curve, and sample PLBL2 concentrations were computed from the linear range of the standard curve.
[0229] As shown in
Example 6
Results Using Polyclonal PLBL2 ELISA Assay
[0230] We assessed PLBL2 clearance through a three-column chromatography purification process with a final ultrafiltration/diafiltration (UFDF) step of mAb G using the polyclonal PLBL2 ELISA assay described in Example 5. The results are shown in
[0231] In addition, we compared the quantities of PLBL2 detected using the monoclonal assay to the quantities of PLBL2 detected using the polyclonal assay in seven different runs of mAb A (including different stages of purification as indicated in Table 5) and one run of mAb B. The results are presented in Table 5. As can be seen, the relative % difference between the results obtained using each assay indicates that the two assays yield comparable results.
TABLE-US-00005 TABLE 5 Comparison of monoclonal PLBL2 assay results to polyclonal PLBL2 assay results. PLBL2 PLBL2 value value from from monoclonal polyclonal ELISA ELISA Relative % Sample (ng/mL) (ng/mL) difference mAb A Run 1 4,399 3,870 13 mAb A Run 2 41,984 38,528 9 mAb A Run 3 (HCCF) 6,616 5,756 14 mAb A Run 4 (ProA) 16,302 13,762 17 mAb A Run 5 4,700 3,874 19 (column 1) mAb A Run 6 <1.4 2.3 n/a (column 2) mAb A Run 7 (UFDF) 28.98 27.37 17 mAb B Run 1 5928 7144 19 Relative % Difference = [(MAb pAb)/((Mab + pAb)/2)] * 100
Conclusion
[0232] Taken together, these data indicate that each of the monoclonal and polyclonal PLBL2 ELISA assays described herein is robust, specific and sensitive. We have shown that each assay is capable of accurately quantitating contaminating hamster PLBL2 CHOP in numerous different MAb preparations representing a wide range of PLBL2 levels and under a variety of purification conditions. We have also shown that the PLBL2 ELISA assay can be used to monitor impurity clearance during each step of the purification process. Therefore, each of the monoclonal and polyclonal PLBL2 ELISA assays described herein is an effective tool for monitoring clearance during development of purification processes as well as for quantitating PLBL2 levels in the final product.
Example 7
Use of PLBL2 ELISA Assays to Screen or Select Cell Lines
[0233] As discussed above and as shown in
[0234] Prior to generating the results described below, we did not think such a clone selection strategy would be feasible. This is because we hypothesized that the differences in PLBL2 levels observed between different product lines (see
[0235] To explore the feasibility of a low PLBL2/high product concentration clone selection strategy, we used methods described above to measure PLBL2 levels, total CHOP levels, and product concentration in day 14 HCCF samples from multiple clonal lines of six different recombinant protein product CHO cell lines (Product J, Product K, Product L, Product M, Product N, and Product O). The results from duplicate 2L bioreactor cultures for each clonal cell line are shown in
[0236] Surprisingly, however, the observation for product concentration described above did not hold true for PLBL2 levels. As can be seen in
[0237] The usefulness of carrying out this selection strategy can be seen, for example, by examining the results for Product L clonal cell lines (
[0238] Another way to analyze the data presented in
[0239] Such an analysis allows for rapid comparison of the desired attributes across multiple clonal cell lines of a particular product cell line and simple selection of the line with the lowest ratio, i.e. the lowest level of PLBL2 and the highest level of product concentration. For example, for Product L, it was not clear from the data presented in
[0240] To further investigate the extent of variability across multiple clonal cell lines of a particular product cell line, we analyzed 48 different recombinant CHO cell lines expressing Product P. The PLBL2/product ratio of each of the 48 cell lines of Product P is shown in
[0241] We next investigated the apparent lack of correlation between PLBL2 concentration and product concentration by measuring the levels of total CHOP, PLBL2, and product concentrations in day 14 HCCF samples from shake flask cultures of the 48 Product P cell lines described above. With this substantially larger data set involving a single product, we could more accurately quantify the correlations between these three measurements. FIG. 11A shows that there was a weak linear correlation between PLBL2 concentration and product concentration: the coefficient of determination (R.sup.2) associated with the linear regression was low (<0.12). This weak correlation demonstrates the feasibility of selecting for cell lines with the desired traits of high recombinant protein productivity and low PLBL2 levels relative to other cell lines. In contrast,
[0242] To determine whether different CHO host cell lines yield different levels of PLBL2 and to distinguish any such differences from the effects of recombinant protein on PLBL2 levels in cell culture, we used the PLBL2 ELISA to measure PLBL2 levels in 2 L bioreactor cultures of three different CHO host cell linesHost 1, Host 2, and Host 3that did not express any product genes. These bioreactor cultures, also known as blank runs because no products were generated, were analyzed for viable cell density and viability using the Vi-Cell XR (Catalog No. 731050, Beckman Coulter, Inc., Brea, Calif., USA). Cell growth was also assessed throughout the duration of the cultivation based on packed cell volume (PCV) by centrifuging (820 g, 10 min) culture samples in KIMAX calibrated sedimentation tubes (Catalog no. 45225-10, Kimble Chase, Vineland, N.J., USA). We measured PLBL2 levels in both the HCCF and whole cell culture fluid (WCCF) for these blank runs. The WCCF samples were comprised of both cells and HCCF. Therefore, PLBL2 levels measured in WCCF samples reflects a combination of the total intracellular and extracellular concentration of PLBL2 in the cultures. Using the PLBL2 ELISA assay, we quantified the differences across the three CHO host cell lines with respect to PLBL2 profiles in both HCCF (
[0243] Although Host 3 generated the overall lowest levels of PLBL2 in both HCCF and WCCF, all three CHO host cell lines showed different growth profiles (data not shown). Therefore, to negate the impact of differences in cell growth on PLBL2 levels, we further analyzed these three cell lines by normalizing PLBL2 production to the viable cell volume on a per day basis. To calculate the cell-specific PLBL2 productivity in Host 1, Host 2 and Host 3, we plotted PLBL2 concentration against the corresponding volumetric integrated viable packed cell volume (IVPCV). To minimize complications from cell death and PLBL2 release from the associated cell lysis, we limited use of the data to that at which the culture viabilities exceeded 70%. The resulting slope obtained from the linear regression provided an estimate of the cell-specific PLBL2 productivity, in units of mg of PLBL2 per unit viable cell volume per day. As shown in
[0244] The results discussed above show that the PLBL2 ELISA assays described herein can be used to assess PLBL2 levels across multiple recombinant product CHO cell lines as well as multiple CHO host cell lines thus enabling the selection of recombinant lines or host lines with desirable attributes such as low PLBL2 concentrations and, in the case recombinant product CHO cell lines, high product concentration. Such an approach to cell line selection is important for the optimization of recombinant manufacturing processes, for example, to reduce the burden on downstream purification processes.
TABLE-US-00006 TABLEOFSEQUENCES SEQID NO: Description Sequence 1 HamsterPLBL2 atggcggcccccatggaccggagccccggcggccgggcgg DNA tccgggcgctgaggctagcgctggcgctggcctcgctgac (GenBank tgaggtgttgctgaattgcccggcgggcgccctccccacg AccessionNo.: caggggcccggcaggcggcgccaaaacctcgacccgccgg EGW13853) tctcccgcgtccgctcggtgctgctggacgccgcgtcggg tcagctgcgcctggtggacggcatccatccctacgcggtg gcctgggccaacctcaccaacgccattcgcgagaccgggt gggcctatctggacttgggtacaaatggaagctacaatga cagcctgcaggcctatgcagctggtgtggtggaggcttct gtgtctgaggagctcatctacatgcactggatgaacacaa tggtcaactactgtggccccttcgagtatgaagttggcta ctgtgagaagctcaagagcttcctggagatcaacctggag tggatgcagagggagatggaactcagccaggactctccat attggcaccaggtgcggctgaccctcctgcagctgaaagg cctagaggacagctacgaaggccgtttgaccttcccaact gggaggttcaccattaaacccttggggttcctcctgctgc agattgccggagacctggaagacctagagcaagccctgaa taagaccagcaccaagctttccctgggctccggttcctgc tccgctatcatcaagttgctgccaggcgcacgtgacctcc tggtggcacacaacacatggaactcctaccagaacatgct acgcatcatcaagaagtaccagctgcagttccggcagggg cctcaagaggcgtaccccctgattgctggcaacaatttgg tcttttcgtcttacccgggcaccatcttctctggcgatga cttctacatcctgggcagtgggctggtcaccctggagacc accattggcaacaagaatccagccctgtggaagtacgtgc agccccagggctgtgtgctggagtggattcgaaacatcgt ggccaaccgcctggccttggacggggccacctgggcagac atcttcaagcagttcaatagtggcacgtataataaccaat ggatgattgtggactacaaggcattcatccccaacgggcc cagccctggaagccgagtgcttaccatcctagaacagatc ccgggcatggtggtggtggccgacaagactgaagatctct acaagacaacctactgggctagctacaacatcccgttctt tgagattgtgttcaacgccagtgggctgcaggacttggtg gcccaatatggagattggttttcctacactaagaaccctc gagctcagatcttccagagggaccagtcgctggtggagga catgaattccatggtccggctcataaggtacaacaacttc cttcacgaccctctgtcactgtgtgaagcctgtatcccga agcccaatgcagagaatgccatctctgcccgctctgacct caatcctgccaatggctcctacccatttcaagccctgtac cagcgtccccacggtggcatcgatgtgaaggtgaccagct tttcactggccaagcgcatgagcatgctggcagccagtgg cccaacgtgggatcagttgcccccattccagtggagttta tcgccgttccgcagcatgcttcacatgggccagcctgatc tctggacattctcacccatcagtgtcccatgggactga 2 HamsterPLBL2 MAAPMDRSPGGRAVRALRLALALASLTEVLLNCPAGALPT Protein QGPGRRRQNLDPPVSRVRSVLLDAASGQLRLVDGIHPYAV (GenBank AWANLTNAIRETGWAYLDLGTNGSYNDSLQAYAAGVVEAS AccessionNo.: VSEELIYMHWMNTMVNYCGPFEYEVGYCEKLKSFLEINLE EGW13853) WMQREMELSQDSPYWHQVRLTLLQLKGLEDSYEGRLTFPT GRFTIKPLGFLLLQIAGDLEDLEQALNKTSTKLSLGSGSC SAIIKLLPGARDLLVAHNTWNSYQNMLRIIKKYQLQFRQG PQEAYPLIAGNNLVFSSYPGTIFSGDDFYILGSGLVTLET TIGNKNPALWKYVQPQGCVLEWIRNIVANRLALDGATWAD IFKQFNSGTYNNQWMIVDYKAFIPNGPSPGSRVLTILEQI PGMVVVADKTEDLYKTTYWASYNIPFFEIVFNASGLQDLV AQYGDWFSYTKNPRAQIFQRDQSLVEDMNSMVRLIRYNNF LHDPLSLCEACIPKPNAENAISARSDLNPANGSYPFQALY QRPHGGIDVKVTSFSLAKRMSMLAASGPTWDQLPPFQWSL SPFRSMLHMGQPDLWTFSPISVPWD 3 15G11heavy EVKLEESGGGLVQPGGSTKLSCAASGFTFSDAWMDWVRQCPEK chain(mu-IgG1) GLEWVAEISSKANNRATYYAESVKGRFTISRDDSKSCVYLQMN SLRAEDTGIYYCTRRGYTMDYWGQGTSVTVSSASTKGPSVYPL APGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSISSGVHTFP AVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKI VPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCVV VDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSEL PIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVY TIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYK NTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNH HTEKSLSHSPGK 4 15G11heavy EVKLEESGGGLVQPGGSTKLSCAASGFTFSDAWMDWVRQCPEK chainvariable GLEWVAEISSKANNRATYYAESVKGRFTISRDDSKSCVYLQMN region(VH) SLRAEDTGIYYCTRRGYTMDYWGQGTSVTVSS 5 15G11CDRH1 GFTFSDAWMD 6 15G11CDRH2 EISSKANNRATYYAESVKG 7 15G11CDRH3 TRRGYTMDY 8 15G11light DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQQKPGQS chain PKALIFSASYRFSGVPDRFTGSGSGTDFTLTISNVQSEDLAEY (mu-kappa) FCQQYNNFPFTFGSGTKLELKRADAAPTVSIFPPSSEQLTSGG ASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST YSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 9 15G11light DIVMTQSQKFMSTSVGDRVSVTCKASQNVDTNVAWYQQKPGQS chainvariable PKALIFSASYRFSGVPDRFTGSGSGTDFTLTISNVQSEDLAEY region(VL) FCQQYNNFPFTFGSGTKLELK 10 15G11CDRL1 KASQNVDTNVA 11 15G11CDRL2 SASYRFS 12 15G11CDRL3 QQYNNFPFT 13 19C10heavy EVQLQESGPCLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGN chain(mu-IgG1) KLESMGYISYSGSTYYNPSLKSRISITRDTSKNQYYLQLNSVT TEDTATYYCARIASWITTYFDYWGQGTTLTVSSASTKGPSVYP LAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTF PAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKK IVPRDCGCKPCICTVPEVSSVFIFPPKPKDVLTITLTPKVTCV VVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSE LPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQV YTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENY KNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHN HHTEKSLSHSPGK 14 19C10heavy EVQLQESGPCLVKPSQTLSLTCSVTGDSITSGYWNWIRKFPGN chainvariable KLESMGYISYSGSTYYNPSLKSRISITRDTSKNQYYLQLNSVT region(VH) TEDTATYYCARIASWITTYFDYWGQGTTLTVSS 15 19C10CDRH1 GDSITSGYWN 16 19C10CDRH2 YISYSGSTYYNPSLKS 17 19C10CDRH3 ARIASWITTYFDY 18 19C10light DIVMTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRRNGS chain PRLLIKYASESISGIPSRFSGSGSGTDFILSINSVESEDIADY (mu-kappa) YCQQSNSWPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGG ASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDST YSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC 19 19C10light DIVMTQSPAILSVSPGERVSFSCRASQSIGTSIHWYQQRRNGS chainvariable PRLLIKYASESISGIPSRFSGSGSGTDFILSINSVESEDIADY region(VL) YCQQSNSWPYTFGGGTKLELK 20 19C10CDRL1 RASQSIGTSIH 21 19C10CDRL2 YASESIS 22 19C10CDRL3 QQSNSWPYT