CHIMERIC ANTIGEN RECEPTORS TARGETING B-CELL MATURATION ANTIGEN AND USES THEREOF
20180360880 ยท 2018-12-20
Assignee
Inventors
Cpc classification
A61K39/4611
HUMAN NECESSITIES
A61K35/17
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
C12N2740/10043
CHEMISTRY; METALLURGY
C07K2317/73
CHEMISTRY; METALLURGY
C07K2317/34
CHEMISTRY; METALLURGY
A61K39/464417
HUMAN NECESSITIES
C07K2317/92
CHEMISTRY; METALLURGY
A61K2239/38
HUMAN NECESSITIES
C07K16/2878
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
C07K14/705
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
Abstract
The presently disclosed subject matter provides for methods and compositions for treating multiple myeloma. It relates to chimeric antigen receptors (CARs) that specifically target B cell maturation antigen (BMCA), and immunoresponsive cells comprising such CARs. The presently disclosed BMCA-specific CARs have enhanced immune-activating properties, including anti-tumor activity.
Claims
1. A chimeric antigen receptor (CAR), comprising an extracellular antigen-binding domain that specifically binds to B cell maturation antigen (BMCA), a transmembrane domain and an intracellular domain, wherein the extracellular antigen-binding domain comprises a heavy chain variable region and a light chain variable region, wherein: (a) the heavy chain variable region comprises an amino acid sequence that is at least about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of: SEQ ID NOS: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, and 65; and/or the light chain variable region comprises an amino acid sequence that is at least about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, and 66; and/or (b) the heavy chain variable region comprises a CDR1, a CDR2, and a CDR3 of a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, or 65, and/or the light chain variable region comprises a CDR1, a CDR2, and a CDR3 of a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, or 66; and/or (c) the heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 91, 97, 103, 109, 115, 121, 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, and 187, and conservative modifications thereof; and/or the light chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 94, 100, 106, 112, 118, 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, and 190, and conservative modifications thereof.
2. The CAR of claim 1, wherein the extracellular antigen-binding domain of the CAR binds to B cell maturation antigen (BMCA) with a binding affinity (K.sub.D) of from about 1?10.sup.?9M to about 3?10.sup.?6M.
3. The CAR of claim 1, wherein the extracellular antigen-binding domain of the CAR binds to B cell maturation antigen (BMCA) with a binding affinity (K.sub.D) of from about 1?10.sup.?9M to about 1?10.sup.?8M.
4. The CAR of claim 1, wherein (a) the heavy chain variable region comprises an amino acid sequence that is at least about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of: SEQ ID NOS: 21, 53, 57, 61, and 65; and/or (b) the light chain variable region comprises an amino acid sequence that is at least about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98% or about 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 22, 54, 58, 62, and 66.
5. The CAR of claim 1, wherein (a) the heavy chain variable region comprises the CDR1, CDR2, and CDR3 of a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 21, 53, 57, 61, or 65; and (b) the light chain variable region comprises the CDR1, CDR2, and CDR3 of a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO: 22, 54, 58, 62, or 66.
6. The CAR of claim 1, wherein (a) the heavy chain variable region comprises an amino acid sequence selected from the group consisting of: SEQ ID NOS:1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, and 65 and conservative modifications thereof; and/or (b) the light chain variable region comprises an amino acid sequence selected from the group consisting of: SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, and 66 and conservative modifications thereof.
7. The CAR of claim 6, wherein (a) the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO:21, SEQ ID NO:53, SEQ ID NO:57, SEQ ID NO:61, or SEQ ID NO:65; and/or (b) the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO:22, SEQ ID NO:54, SEQ ID NO:58, SEQ ID NO:62 or SEQ ID NO:6.
8. (canceled)
9. (canceled)
10. (canceled)
11. (canceled)
12. (canceled)
13. (canceled)
14. (canceled)
15. (canceled)
16. (canceled)
17. (canceled)
18. (canceled)
19. (canceled)
20. (canceled)
21. (canceled)
22. (canceled)
23. The CAR of claim 6, wherein the extracellular antigen-binding domain comprises: (a) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:1, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:2; (b) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:5, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:6; (c) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:9, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:10; (d) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:13, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:14; (e) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:17, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:18; (f) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:21, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:22; (g) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:25, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:26; (h) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:29, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:30; (i) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:33, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:34; (j) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:37, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:38; (k) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:41, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:42; (l) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:45, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:46; (m) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:49, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:50; (n) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:53, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:54; (o) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:57, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:58; (p) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:61, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:62; or (q) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:65, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:66.
24. The CAR of claim 23, wherein the extracellular antigen-binding domain comprises: (a) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:21, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:22; (b) a heavy chain variable region comprising amino acids having the amino acid sequence set forth in SEQ ID NO:53; and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:54; (c) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:57; and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:58; (d) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:61, and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:62; or (e) a heavy chain variable region comprising the amino acid sequence set forth in SEQ ID NO:65; and a light chain variable region comprising the amino acid sequence set forth in SEQ ID NO:66.
25. (canceled)
26. (canceled)
27. (canceled)
28. (canceled)
29. The CAR of claim 1, wherein the extracellular antigen-binding domain comprises a linker between the heavy chain variable region and the light chain variable region.
30. The CAR of claim 1, wherein (a) the heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 91, 97, 103, 109, 115, 121, 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, and 187, and conservative modifications thereof and (b) the light chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 94, 100, 106, 112, 118, 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, and 190, and conservative modifications thereof.
31. The CAR of claim 30, wherein (a) the heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 90, 96, 102, 108, 114, 120, 126, 132, 138, 144, 150, 156, 162, 168, 174, 180, and 186, and conservative modifications thereof; and (b) the light chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 93, 99, 105, 111, 117, 123, 129, 135, 141, 147, 153, 159, 165, 171, 177, 183, and 189, and conservative modifications thereof.
32. The CAR of claim 30, wherein (a) the heavy chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 89, 95, 101, 107, 113, 119, 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, and 185, and conservative modifications thereof; and (b) the light chain variable region comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 92, 98, 104, 110, 116, 122, 128, 134, 140, 146, 152, 158, 164, 170, 176, 182, and 188, and conservative modifications thereof.
33. (canceled)
34. The CAR of claim 1, wherein the heavy chain variable region comprises: (a) the amino acid sequence set forth in SEQ ID NO: 89 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 90 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 91 or a conservative modification thereof; (b) the amino acid sequence set forth in SEQ ID NO: 95 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 96 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 97 or a conservative modification thereof; (c) the amino acid sequence set forth in SEQ ID NO: 101 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 102 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 103 or a conservative modification thereof; (d) the amino acid sequence set forth in SEQ ID NO: 107 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 108 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 109 or a conservative modification thereof; (e) the amino acid sequence set forth in SEQ ID NO: 113 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 114 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 115 or a conservative modification thereof; (f) the amino acid sequence set forth in SEQ ID NO: 119 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 120 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 121 or a conservative modification thereof; (g) the amino acid sequence set forth in SEQ ID NO: 125 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 126 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 127 or a conservative modification thereof; (h) the amino acid sequence set forth in SEQ ID NO: 131 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 132 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 133 or a conservative modification thereof; (i) the amino acid sequence set forth in SEQ ID NO: 137 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 138 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 139 or a conservative modification thereof; (j) the amino acid sequence set forth in SEQ ID NO: 143 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 144 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 145 or a conservative modification thereof; (k) the amino acid sequence set forth in SEQ ID NO: 149 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 150 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 151 or a conservative modification thereof; (l) the amino acid sequence set forth in SEQ ID NO: 155 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 156 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 157 or a conservative modification thereof; (m) the amino acid sequence set forth in SEQ ID NO: 161 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 162 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 163 or a conservative modification thereof; (n) the amino acid sequence set forth in SEQ ID NO: 167 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 168 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 169 or a conservative modification thereof; (o) the amino acid sequence set forth in SEQ ID NO: 173 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 174 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 175 or a conservative modification thereof; (p) the amino acid sequence set forth in SEQ ID NO: 179 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 180 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 181 or a conservative modification thereof; or (q) the amino acid sequence set forth in SEQ ID NO: 185 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 186 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 187 or a conservative modification thereof.
35. The CAR of claim 34, wherein the heavy chain variable region comprises: (a) the amino acid sequence set forth in SEQ ID NO: 167 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 168 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 169 or a conservative modification thereof; (b) the amino acid sequence set forth in SEQ ID NO: 173 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 174 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 175 or a conservative modification thereof; (c) the amino acid sequence set forth in SEQ ID NO: 185 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 186 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 187 or a conservative modification thereof; (d) the amino acid sequence set forth in SEQ ID NO: 119 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 120 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 121 or a conservative modification thereof; or (e) the amino acid sequence set forth in SEQ ID NO: 179 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 180 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 181 or a conservative modification thereof.
36. (canceled)
37. (canceled)
38. (canceled)
39. (canceled)
40. The CAR of claim 1, wherein the light chain variable region comprises: (a) the amino acid sequence set forth in SEQ ID NOs: 92 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 93 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 94 or a conservative modification thereof; (b) the amino acid sequence set forth in SEQ ID NO: 98 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 99 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 100 or a conservative modification thereof; (c) the amino acid sequence set forth in SEQ ID NO: 104 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 105 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 106 or a conservative modification thereof; (d) the amino acid sequence set forth in SEQ ID NO: 110 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 111 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 112 or a conservative modification thereof; (e) the amino acid sequence set forth in SEQ ID NO: 116 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 117 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 118 or a conservative modification thereof; (f) the amino acid sequence set forth in SEQ ID NO: 122 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 123 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 124 or a conservative modification thereof; (g) the amino acid sequence set forth in SEQ ID NO: 128 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 129 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 130 or a conservative modification thereof; (h) the amino acid sequence set forth in SEQ ID NO: 134 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 135 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 136 or a conservative modification thereof; (i) the amino acid sequence set forth in SEQ ID NO: 140 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 141 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 142 or a conservative modification thereof; (j) the amino acid sequence set forth in SEQ ID NO: 146 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 147 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 148 or a conservative modification thereof; (k) the amino acid sequence set forth in SEQ ID NO: 152 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 153 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 154 or a conservative modification thereof; (l) the amino acid sequence set forth in SEQ ID NO: 158 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 159 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 160 or a conservative modification thereof; (m) the amino acid sequence set forth in SEQ ID NO: 164 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 165 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 166 or a conservative modification thereof; (n) the amino acid sequence set forth in SEQ ID NO: 170 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 171 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 172 or a conservative modification thereof; (o) the amino acid sequence set forth in SEQ ID NO: 176 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 177 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 178 or a conservative modification thereof; (p) the amino acid sequence set forth in SEQ ID NO: 182 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 183 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 184 or a conservative modification thereof; or (q) the amino acid sequence set forth in SEQ ID NO: 188 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 189 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 190 or a conservative modification thereof.
41. The CAR of claim 40, wherein the light chain variable region comprises: (a) the amino acid sequence set forth in SEQ ID NO: 170 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 171 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 172 or a conservative modification thereof; (b) the amino acid sequence set forth in SEQ ID NO: 176 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 177 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 178 or a conservative modification thereof; (c) the amino acid sequence set forth in SEQ ID NO: 188 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 189 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 190 or a conservative modification thereof; (d) the amino acid sequence set forth in SEQ ID NO: 122 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 123 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 124 or a conservative modification thereof; or (e) the amino acid sequence set forth in SEQ ID NO: 182 or a conservative modification thereof, the amino acid sequence set forth in SEQ ID NO: 183 or a conservative modification thereof, and the amino acid sequence set forth in SEQ ID NO: 184 or a conservative modification thereof.
42. (canceled)
43. (canceled)
44. (canceled)
45. (canceled)
46. The CAR of claim 1, wherein the extracellular antigen-binding domain comprises: (a) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 89, 90, and 91; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 92, 93, and 94; (b) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 95, 96, and 97; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 98, 99, and 100; (c) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 101, 102, and 103; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 104, 105, and 106; (d) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 107, 108, and 109; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 110, 111, and 112; (e) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 113, 114, and 115; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 116, 117, and 118; (f) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 119, 120, and 121; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 122, 123, and 124; (g) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 125, 126, and 127; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 128, 129, and 130; (h) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 131, 132, and 133; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 134, 135, and 136; (i) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 137, 138, and 139; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 140, 141, and 142; (j) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 143, 144, and 145; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 146, 147, and 148; (k) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 149, 150, and 151; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 152, 153, and 154; (l) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 155, 156, and 157; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 158, 159, and 160; (m) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 161, 162, and 163; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 164, 165, and 166; (n) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 167, 168, and 169; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 170, 171, and 172; (o) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 173, 174, and 175; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 176, 177, and 178; (p) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 179, 180, and 181; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 182, 183, and 184; or (q) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 185, 186, and 187; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 188, 189, and 190.
47. The CAR of claim 46, wherein the extracellular antigen-binding domain comprises: (a) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 167, 168, and 169; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 170, 171, and 172; (b) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 173, 174, and 175; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 176, 177, and 178; (c) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 185, 186, and 187; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 188, 189, and 190; (d) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 119, 120, and 121; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 122, 123, and 124; (e) a heavy chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 179, 180, and 181; and a light chain variable region comprising the amino acid sequences set forth in SEQ ID NOs: 182, 183, and 184.
48. (canceled)
49. (canceled)
50. (canceled)
51. (canceled)
52. The CAR of claim 1, wherein the BCMA comprises the amino acid sequence set forth in SEQ ID NO:71.
53. The CAR of claim 1, wherein the extracellular antigen-binding domain binds to an epitope region comprising residues within amino acids 14-22 of SEQ ID NO:71.
54. (canceled)
55. (canceled)
56. The CAR of claim 1, wherein the extracellular antigen-binding domain comprises a signal peptide that is covalently joined to the N-terminus of the extracellular antigen-binding domain.
57. The CAR of claim 1, wherein the transmembrane domain comprises a CD8 polypeptide, a CD28 polypeptide, a CD3? polypeptide, a CD4 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a CTLA-4 polypeptide, a PD-1 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof.
58. The CAR of claim 57, wherein the transmembrane domain comprises a CD8 polypeptide or a CD28 polypeptide.
59. (canceled)
60. The CAR of claim 1, wherein the intracellular domain comprises a CD3? polypeptide.
61. The CAR of claim 60, wherein the intracellular domain further comprises at least one signaling region.
62. The CAR of claim 61, wherein the at least one signaling region comprises a CD28 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP-10 polypeptide, a PD-1 polypeptide, a CTLA-4 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof.
63. The CAR of claim 61, wherein the at least one signaling region comprises a co-stimulatory signaling region.
64. The CAR of claim 63, wherein the co-stimulatory signaling region comprises a CD28 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP-10 polypeptide, or a combination thereof.
65. The CAR of claim 64, wherein the co-stimulatory signaling region comprises a CD28 polypeptide or a 4-1BB polypeptide.
66. (canceled)
67. The CAR of claim 65, wherein (a) the transmembrane domain comprises a CD28 polypeptide, the intracellular domain comprises a CD3? polypeptide, and the co-stimulatory signaling domain comprises a CD28 polypeptide; or (b) the transmembrane domain comprises a CD8 polypeptide, the intracellular domain comprises a CD3? polypeptide, and the co-stimulatory signaling domain comprises a 4-1BB polypeptide.
68. (canceled)
69. The CAR of claim 1, wherein the CAR is recombinantly expressed or expressed from a vector.
70. (canceled)
71. (canceled)
72. An immunoresponsive cell comprising the CAR of claim 1.
73. (canceled)
74. The immunoresponsive cell of claim 72, wherein the CAR is constitutively expressed on the surface of the immunoresponsive cell.
75. The immunoresponsive cell of claim 72, wherein the immunoresponsive cell is further transduced with at least one co-stimulatory ligand such that the immunoresponsive cell expresses the at least one co-stimulatory ligand.
76. (canceled)
77. (canceled)
78. (canceled)
79. The immunoresponsive cell of claim 72, wherein the immunoresponsive cell is selected from the group consisting of a T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a human embryonic stem cell, a lymphoid progenitor cell, a T cell-precursor cell, and a pluripotent stem cell from which lymphoid cells may be differentiated.
80. (canceled)
81. A nucleic acid molecule encoding the chimeric antigen receptor (CAR) of claim 1.
82. The nucleic acid molecule of claim 81, comprising nucleic acids having the sequence set forth in SEQ ID NO:207, SEQ ID NO:208, SEQ ID NO:209, SEQ ID NO:230, SEQ ID NO:231, SEQ ID NO:232, SEQ ID NO:233, SEQ ID NO:234, or SEQ ID NO:235, or a sequence that is at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, or at least about 99% homologous thereto.
83. (canceled)
84. (canceled)
85. (canceled)
86. (canceled)
87. (canceled)
88. (canceled)
89. (canceled)
90. (canceled)
91. (canceled)
92. A vector comprising the nucleic acid molecule of claim 81.
93. (canceled)
94. A host cell comprising the nucleic acid molecule of claim 81.
95. (canceled)
96. A method of reducing tumor burden in a subject, or of reducing or lengthening survival of a subject having a neoplasm, the method comprising administering an effective amount of the immunoresponsive cell of claim 72 to the subject.
97. The method of claim 96, wherein the method reduces the number of tumor cells, reduces tumor size, or eradicates the tumor in the subject.
98. (canceled)
99. (canceled)
100. The method of claim 96, wherein the tumor or neoplasm is selected from the group consisting of multiple myeloma, Non-Hodgkin Lymphoma, Hodgkin Lymphoma, Chronic Lymphocytic Leukemia (CLL), glioblastoma, and Waldenstrom's Macroglobulinemia.
101. (canceled)
102. (canceled)
103. (canceled)
104. (canceled)
105. (canceled)
106. (canceled)
107. (canceled)
108. A method for producing an immunoresponsive cell that binds to B cell maturation antigen (BMCA), comprising introducing into the immunoresponsive cell a nucleic acid sequence that encodes the chimeric antigen receptor (CAR) of claim 1.
109. A pharmaceutical composition comprising an effective amount of the immunoresponsive cell of claim 72 and a pharmaceutically acceptable excipient.
110. (canceled)
111. (canceled)
112. (canceled)
113. A kit for treating a neoplasm, the kit comprising the immunoresponsive cell of claim 72 and written instructions for using the immunoresponsive cell for treating a subject having a neoplasm.
114. (canceled)
115. The kit of claim 113, wherein the neoplasm is selected from the group consisting of multiple myeloma, Non-Hodgkin Lymphoma, Hodgkin Lymphoma, Chronic Lymphocytic Leukemia (CLL), glioblastoma, and Waldenstrom's Macroglobulinemia.
116. (canceled)
117. The CAR of claim 1, wherein the extracellular antigen-binding domain is a single-chain variable fragment (scFv), a Fab that is optionally crosslinked, or a F(ab).sub.2.
118. The CAR of claim 1, wherein the extracellular antigen-binding domain is a human scFv, and/or the heavy chain variable region is a human heavy chain variable region, and/or the light chain variable region is a human light chain variable region.
119. The CAR of claim 1, wherein the extracellular antigen-binding domain binds to a non-linear epitope of BCMA.
120. A CAR comprising an extracellular antigen-binding domain that specifically binds to B cell maturation antigen (BCMA), a transmembrane domain and an intracellular domain, wherein the extracellular antigen-binding domain binds to BMCA with a binding affinity (K.sub.D) of from about 1?10.sup.?9M to about 3?10.sup.?6M and comprises a human heavy chain variable region and a human light chain variable region.
121. The CAR of claim 120, wherein the extracellular antigen-binding domain of the CAR binds to BMCA with a binding affinity (K.sub.D) of from about 1?10.sup.?9M to about 1?10.sup.?8M.
122. The CAR of claim 120, wherein the extracellular antigen-binding domain binds to a non-linear epitope of BCMA.
123. The CAR of claim 120, wherein the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 21, 53, 57, 61, or 65; and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO: 22, 54, 58, 62, or 66.
124. The CAR of claim 120, wherein: the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 21, and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO: 22; the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 53 and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO: 54; the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 57 and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO: 58; the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 61 and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO:62; or the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 65 and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO: 66.
125. The CAR of claim 120, wherein: the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 21 and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 22; the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 53 and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 54; the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 57 and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 58; the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 61 and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO:62; or the heavy chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 65 and the light chain variable region comprises the amino acid sequence set forth in SEQ ID NO: 66.
126. The CAR of claim 1, wherein the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 21 and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO: 22; the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 53 and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO: 54; the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 57 and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO: 58; the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 61 and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO:62; or the heavy chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a heavy chain variable region sequence set forth in SEQ ID NO: 65 and the light chain variable region comprises an amino acid sequence that is at least about 95% homologous to, or a CDR1, a CDR2, and a CDR3 of, a light chain variable region sequence set forth in SEQ ID NO: 66.
127. The CAR of claim 61, wherein the at least one signaling region comprises a CD3? polypeptide and a co-stimulatory domain, which optionally comprises a 4-1BB polypeptide or a CD28 polypeptide.
Description
BRIEF DESCRIPTION OF THE FIGURES
[0034] The following Detailed Description, given by way of example, but not intended to limit the invention to specific embodiments described, may be understood in conjunction with the accompanying drawings.
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
DETAILED DESCRIPTION OF THE INVENTION
[0057] The presently disclosed subject matter generally provides chimeric antigen receptors (CARs) targeting BCMA. In one non-limiting example, the CAR comprises an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen-binding domain specifically binds to BCMA. The presently disclosed subject matter also provides immunoresponsive cells (e.g., T cell, a Natural Killer (NK) cell, a cytotoxic T lymphocyte (CTL), a regulatory T cell, a human embryonic stem cell, a lymphoid progenitor cell, a T cell-precursor cell, and a pluripotent stem cell from which lymphoid cells may be differentiated) expressing the BCMA-targeted CARs, and methods of using such immunoresponsive cells for treating a tumor, e.g., multiple myeloma.
I. Definitions
[0058] Unless defined otherwise, all technical and scientific terms used herein have the meaning commonly understood by a person skilled in the art to which this invention belongs. The following references provide one of skill with a general definition of many of the terms used in this invention: Singleton et al., Dictionary of Microbiology and Molecular Biology (2nd ed. 1994); The Cambridge Dictionary of Science and Technology (Walker ed., 1988); The Glossary of Genetics, 5th Ed., R. Rieger et al. (eds.), Springer Verlag (1991); and Hale & Marham, The Harper Collins Dictionary of Biology (1991). As used herein, the following terms have the meanings ascribed to them below, unless specified otherwise.
[0059] As used herein, the term about or approximately means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, about can mean within 3 or more than 3 standard deviations, per the practice in the art. Alternatively, about can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value.
[0060] As used herein, the term cell population refers to a group of at least two cells expressing similar or different phenotypes. In non-limiting examples, a cell population can include at least about 10, at least about 100, at least about 200, at least about 300, at least about 400, at least about 500, at least about 600, at least about 700, at least about 800, at least about 900, at least about 1000 cells expressing similar or different phenotypes.
[0061] As used herein, the term antibody means not only intact antibody molecules, but also fragments of antibody molecules that retain immunogen-binding ability. Such fragments are also well known in the art and are regularly employed both in vitro and in vivo. Accordingly, as used herein, the term antibody means not only intact immunoglobulin molecules but also the well-known active fragments F(ab).sub.2, and Fab. F(ab).sub.2, and Fab fragments that lack the Fe fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983). The antibodies of the invention comprise whole native antibodies, bispecific antibodies; chimeric antibodies; Fab, Fab, single chain V region fragments (scFv), fusion polypeptides, and unconventional antibodies.
[0062] As used herein, the term single-chain variable fragment or scFv is a fusion protein of the variable regions of the heavy (V.sub.H) and light chains (V.sub.L) of an immunoglobulin (e.g., mouse or human) covalently linked to form a V.sub.H::V.sub.L heterodimer. The heavy (V.sub.H) and light chains (V.sub.L) are either joined directly or joined by a peptide-encoding linker (e.g., 10, 15, 20, 25 amino acids), which connects the N-terminus of the V.sub.H with the C-terminus of the V.sub.L, or the C-terminus of the V.sub.H with the N-terminus of the V.sub.L. The linker is usually rich in glycine for flexibility, as well as serine or threonine for solubility. The linker can link the heavy chain variable region and the light chain variable region of the extracellular antigen-binding domain. Non-limiting examples of linkers are disclosed in Shen et al., Anal. Chem. 80(6):1910-1917 (2008) and WO 2014/087010, the contents of which are hereby incorporated by reference in their entireties. In certain embodiments, the linker is a G4S linker.
[0063] In a non-limiting example, the linker comprises amino acids having the sequence set forth in SEQ ID NO:210 as provided below.
TABLE-US-00001 [SEQ ID NO: 210] GGGGSGGGGSGGGGS.
[0064] In certain embodiments, the nucleic acid sequence encoding the amino acid sequence of SEQ ID NO:210 is set forth in SEQ ID NO:211, which is provided below:
TABLE-US-00002 [SEQ ID NO: 211] GGTGGAGGTGGATCAGGTGGAGGTGGATCTGGTGGAGGTGGATCT.
[0065] In one non-limiting example, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69 as provided below.
TABLE-US-00003 [SEQ ID NO: 69] SRGGGGSGGGGSGGGGSLEMA
[0066] In certain embodiments, the nucleic acid sequence encoding the amino acid sequence of SEQ ID NO:69 is set forth in SEQ ID NO:70, which is provided below:
TABLE-US-00004 [SEQ ID NO: 70] tctagaggtggtggtggtagcggcggcggcggctctggtggtggtggatc cctcgagatggcc
[0067] Despite removal of the constant regions and the introduction of a linker, scFv proteins retain the specificity of the original immunoglobulin. Single chain Fv polypeptide antibodies can be expressed from a nucleic acid comprising V.sub.H- and V.sub.L-encoding sequences as described by Huston, et al. (Proc. Nat. Acad. Sci. USA, 85:5879-5883, 1988). See, also, U.S. Pat. Nos. 5,091,513, 5,132,405 and 4,956,778; and U.S. Patent Publication Nos. 20050196754 and 20050196754. Antagonistic scFvs having inhibitory activity have been described (see, e.g., Zhao et al., Hyrbidoma (Larchmt) 2008 27(6):455-51; Peter et al., J Cachexia Sarcopenia Muscle 2012 Aug. 12; Shieh et al., J Imunol 2009 183(4):2277-85; Giomarelli et al., Thromb Haemost 2007 97(6):955-63; Fife eta., J Clin Invst 2006 116(8):2252-61; Brocks et al., Immunotechnology 1997 3(3):173-84; Moosmayer et al., Ther Immunol 1995 2(10:31-40). Agonistic scFvs having stimulatory activity have been described (see, e.g., Peter et al., J Bioi Chern 2003 25278(38):36740-7; Xie et al., Nat Biotech 1997 15(8):768-71; Ledbetter et al., Crit Rev Immunol 1997 17(5-6):427-55; Ho et al., BioChim Biophys Acta 2003 1638(3):257-66).
[0068] As used herein, F(ab) refers to a fragment of an antibody structure that binds to an antigen but is monovalent and does not have a Fc portion, for example, an antibody digested by the enzyme papain yields two F(ab) fragments and an Fc fragment (e.g., a heavy (H) chain constant region; Fc region that does not bind to an antigen).
[0069] As used herein, F(ab).sub.2 refers to an antibody fragment generated by pepsin digestion of whole IgG antibodies, wherein this fragment has two antigen binding (ab) (bivalent) regions, wherein each (ab) region comprises two separate amino acid chains, a part of a H chain and a light (L) chain linked by an SS bond for binding an antigen and where the remaining H chain portions are linked together. A F(ab).sub.2 fragment can be split into two individual Fab fragments.
[0070] As used herein, the term vector refers to any genetic element, such as a plasmid, phage, transposon, cosmid, chromosome, virus, virion, etc., which is capable of replication when associated with the proper control elements and which can transfer gene sequences into cells. Thus, the term includes cloning and expression vehicles, as well as viral vectors and plasmid vectors.
[0071] As used herein, the term expression vector refers to a recombinant nucleic acid sequence, i.e. recombinant DNA molecule, containing a desired coding sequence and appropriate nucleic acid sequences necessary for the expression of the operably linked coding sequence in a particular host organism. Nucleic acid sequences necessary for expression in prokaryotes usually include a promoter, an operator (optional), and a ribosome binding site, often along with other sequences. Eukaryotic cells are known to utilize promoters, enhancers, and termination and polyadenylation signals.
[0072] As used herein, CDRs are defined as the complementarity determining region amino acid sequences of an antibody which are the hypervariable regions of immunoglobulin heavy and light chains. See, e.g., Kabat et al., Sequences of Proteins of Immunological Interest, 4th U. S. Department of Health and Human Services, National Institutes of Health (1987). Generally, antibodies comprise three heavy chain and three light chain CDRs or CDR regions in the variable region. CDRs provide the majority of contact residues for the binding of the antibody to the antigen or epitope. In certain embodiments, the CDRs regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242).
[0073] As used herein, the term affinity is meant a measure of binding strength. Without being bound to theory, affinity depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, and on the distribution of charged and hydrophobic groups. Affinity also includes the term avidity, which refers to the strength of the antigen-antibody bond after formation of reversible complexes. Methods for calculating the affinity of an antibody for an antigen are known in the art, comprising use of binding experiments to calculate affinity. Antibody activity in functional assays (e.g., flow cytometry assay) is also reflective of antibody affinity. Antibodies and affinities can be phenotypically characterized and compared using functional assays (e.g., flow cytometry assay).
[0074] Nucleic acid molecules useful in the methods of the invention include any nucleic acid molecule that encodes a polypeptide of the invention or a fragment thereof. Such nucleic acid molecules need not be 100% identical with an endogenous nucleic acid sequence, but will typically exhibit substantial identity. Polynucleotides having substantial identity to an endogenous sequence are typically capable of hybridizing with at least one strand of a double-stranded nucleic acid molecule. By hybridize is meant pair to form a double-stranded molecule between complementary polynucleotide sequences (e.g., a gene described herein), or portions thereof, under various conditions of stringency. (See, e.g., Wahl, G. M. and S. L. Berger (1987) Methods Enzymol. 152:399; Kimmel, A. R. (1987) Methods Enzymol. 152:507).
[0075] For example, stringent salt concentration will ordinarily be less than about 750 mM NaCl and 75 mM trisodium citrate, preferably less than about 500 mM NaCl and 50 mM trisodium citrate, and more preferably less than about 250 mM NaCl and 25 mM trisodium citrate. Low stringency hybridization can be obtained in the absence of organic solvent, e.g., formamide, while high stringency hybridization can be obtained in the presence of at least about 35% formamide, and more preferably at least about 50% formamide. Stringent temperature conditions will ordinarily include temperatures of at least about 30? C., more preferably of at least about 37? C., and most preferably of at least about 42? C. Varying additional parameters, such as hybridization time, the concentration of detergent, e.g., sodium dodecyl sulfate (SDS), and the inclusion or exclusion of carrier DNA, are well known to those skilled in the art. Various levels of stringency are accomplished by combining these various conditions as needed. In a preferred: embodiment, hybridization will occur at 30? C. in 750 mM NaCl, 75 mM trisodium citrate, and 1% SDS. In a more preferred embodiment, hybridization will occur at 37? C. in 500 mM NaCl, 50 mM trisodium citrate, 1% SDS, 35% formamide, and 100 ?g/ml denatured salmon sperm DNA (ssDNA). In a most preferred embodiment, hybridization will occur at 42? C. in 250 mM NaCl, 25 mM trisodium citrate, 1% SDS, 50% formamide, and 200 ?g/ml ssDNA. Useful variations on these conditions will be readily apparent to those skilled in the art.
[0076] For most applications, washing steps that follow hybridization will also vary in stringency. Wash stringency conditions can be defined by salt concentration and by temperature. As above, wash stringency can be increased by decreasing salt concentration or by increasing temperature. For example, stringent salt concentration for the wash steps will preferably be less than about 30 mM NaCl and 3 mM trisodium citrate, and most preferably less than about 15 mM NaCl and 1.5 mM trisodium citrate. Stringent temperature conditions for the wash steps will ordinarily include a temperature of at least about 25? C., more preferably of at least about 42? C., and even more preferably of at least about 68? C. In a preferred embodiment, wash steps will occur at 25? C. in 30 mM NaCl, 3 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 42? C. in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. In a more preferred embodiment, wash steps will occur at 68? C. in 15 mM NaCl, 1.5 mM trisodium citrate, and 0.1% SDS. Additional variations on these conditions will be readily apparent to those skilled in the art. Hybridization techniques are well known to those skilled in the art and are described, for example, in Benton and Davis (Science 196:180, 1977); Grunstein and Rogness (Proc. Natl. Acad. Sci., USA 72:3961, 1975); Ausubel et al. (Current Protocols in Molecular Biology, Wiley Interscience, New York, 2001); Berger and Kimmel (Guide to Molecular Cloning Techniques, 1987, Academic Press, New York); and Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York.
[0077] By substantially identical is meant a polypeptide or nucleic acid molecule exhibiting at least 50% identity to a reference amino acid sequence (for example, any one of the amino acid sequences described herein) or nucleic acid sequence (for example, any one of the nucleic acid sequences described herein). Preferably, such a sequence is at least 60%, more preferably 80% or 85%, and more preferably 90%, 95% or even 99% identical at the amino acid level or nucleic acid to the sequence used for comparison.
[0078] Sequence identity is typically measured using sequence analysis software (for example, Sequence Analysis Software Package of the Genetics Computer Group, University of Wisconsin Biotechnology Center, 1710 University Avenue, Madison, Wis. 53705, BLAST, BESTFIT, GAP, or PILEUP/PRETTYBOX programs). Such software matches identical or similar sequences by assigning degrees of homology to various substitutions, deletions, and/or other modifications. In an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e-3 and e-100 indicating a closely related sequence.
[0079] As used herein, the term analog refers to a structurally related polypeptide or nucleic acid molecule having the function of a reference polypeptide or nucleic acid molecule.
[0080] As used herein, the term ligand refers to a molecule that binds to a receptor. In particular, the ligand binds a receptor on another cell, allowing for cell-to-cell recognition and/or interaction.
[0081] As used herein, the term disease refers to any condition or disorder that damages or interferes with the normal function of a cell, tissue, or organ. Examples of diseases include neoplasia or pathogen infection of cell.
[0082] As used herein, the term effective amount refers to an amount sufficient to have a therapeutic effect. In certain embodiments, an effective amount is an amount sufficient to arrest, ameliorate, or inhibit the continued proliferation, growth, or metastasis (e.g., invasion, or migration) of a neoplasia.
[0083] As used herein, the term heterologous nucleic acid molecule or polypeptide refers to a nucleic acid molecule (e.g., a cDNA, DNA or RNA molecule) or polypeptide that is not normally present in a cell or sample obtained from a cell. This nucleic acid may be from another organism, or it may be, for example, an mRNA molecule that is not normally expressed in a cell or sample.
[0084] As used herein, the term immunoresponsive cell refers to a cell that functions in an immune response or a progenitor, or progeny thereof.
[0085] As used herein, the term modulate refers positively or negatively alter. Exemplary modulations include an about 1%, about 2%, about 5%, about 10%, about 25%, about 50%, about 75%, or about 100% change.
[0086] As used herein, the term increase refers to alter positively by at least about 5%, including, but not limited to, alter positively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
[0087] As used herein, the term reduce refers to alter negatively by at least about 5% including, but not limited to, alter negatively by about 5%, by about 10%, by about 25%, by about 30%, by about 50%, by about 75%, or by about 100%.
[0088] As used herein, the term isolated cell refers to a cell that is separated from the molecular and/or cellular components that naturally accompany the cell.
[0089] As used herein, the term isolated, purified, or biologically pure refers to material that is free to varying degrees from components which normally accompany it as found in its native state. Isolate denotes a degree of separation from original source or surroundings. Purify denotes a degree of separation that is higher than isolation. A purified or biologically pure protein is sufficiently free of other materials such that any impurities do not materially affect the biological properties of the protein or cause other adverse consequences. That is, a nucleic acid or peptide of this invention is purified if it is substantially free of cellular material, viral material, or culture medium when produced by recombinant DNA techniques, or chemical precursors or other chemicals when chemically synthesized. Purity and homogeneity are typically determined using analytical chemistry techniques, for example, polyacrylamide gel electrophoresis or high performance liquid chromatography. The term purified can denote that a nucleic acid or protein gives rise to essentially one band in an electrophoretic gel. For a protein that can be subjected to modifications, for example, phosphorylation or glycosylation, different modifications may give rise to different isolated proteins, which can be separately purified.
[0090] As used herein, the term secreted is meant a polypeptide that is released from a cell via the secretory pathway through the endoplasmic reticulum, Golgi apparatus, and as a vesicle that transiently fuses at the cell plasma membrane, releasing the proteins outside of the cell.
[0091] As used herein, the term specifically binds or specifically binds to or specifically target is meant a polypeptide or fragment thereof that recognizes and binds a biological molecule of interest (e.g., a polypeptide), but which does not substantially recognize and bind other molecules in a sample, for example, a biological sample, which naturally includes a polypeptide of the invention.
[0092] As used herein, the term treating or treatment refers to clinical intervention in an attempt to alter the disease course of the individual or cell being treated, and can be performed either for prophylaxis or during the course of clinical pathology. Therapeutic effects of treatment include, without limitation, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastases, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. By preventing progression of a disease or disorder, a treatment can prevent deterioration due to a disorder in an affected or diagnosed subject or a subject suspected of having the disorder, but also a treatment may prevent the onset of the disorder or a symptom of the disorder in a subject at risk for the disorder or suspected of having the disorder.
[0093] As used herein, the term subject refers to any animal (e.g., a mammal), including, but not limited to, humans, non-human primates, rodents, and the like (e.g., which is to be the recipient of a particular treatment, or from whom cells are harvested).
II. B Cell Maturation Antigen (BCMA)
[0094] BCMA is an ideal target for Adoptive T cell therapy (e.g., CAR therapy) as BCMA is involved in B cell differentiation and signaling and is known to be expressed on non-malignant differentiated B cells and plasma cells. While there might be risk of inducing a B cell aplasia, B cell aplasias induced by the CD19 CAR have been remarkably well tolerated. Several groups have confirmed BCMA multiple myeloma (MM) surface expression, with one group finding it as an alternative to CD138 as a FACS marker for malignant plasma cells from fresh or frozen patient bone marrow samples with mean relative mean fluorescence intensity (MFI) between 9-16 (n=35)..sup.1,2
[0095] In certain non-limiting embodiments, BCMA is human BCMA having the amino acid sequence set forth in SEQ ID NO:71, or fragments thereof.
[0096] SEQ ID NO:71 is provided below:
TABLE-US-00005 [SEQ ID NO: 71] MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVK GTNAILWTCLGLSLIISLAVEVLMELLRKINSEPLKDEFKNTGSGLLGMA NIDLEKSRTGDEIILPRGLEYTVEECTCEDCIKSKPKVDSDHCFPLPAME EGATILVTTKTNDYCKSLPAALSATEIEKSISAR
III. Chimeric Antigen Receptor (CAR)
[0097] Chimeric antigen receptors (CARs) are engineered receptors, which graft or confer a specificity of interest onto an immune effector cell. CARs can be used to graft the specificity of a monoclonal antibody onto a T cell; with transfer of their coding sequence facilitated by retroviral vectors.
[0098] There are three generations of CARs. First generation CARs are typically composed of an extracellular antigen binding domain (e.g., a single-chain variable fragments (scFv)) fused to a transmembrane domain, fused to cytoplasmic/intracellular domain of the T cell receptor chain. First generation CARs typically have the intracellular domain from the CD3?-chain, which is the primary transmitter of signals from endogenous TCRs. First generation CARs can provide de novo antigen recognition and cause activation of both CD4.sup.+ and CD8.sup.+ T cells through their CD3? chain signaling domain in a single fusion molecule, independent of HLA-mediated antigen presentation. Second generation CARs add intracellular domains from various co-stimulatory molecules (e.g., CD28, 4-1BB, ICOS, OX40) to the cytoplasmic tail of the CAR to provide additional signals to the T cell. Second generation CARs comprise those that provide both co-stimulation (e.g., CD28 or 4-1BB) and activation (CD3?). Preclinical studies have indicated that Second Generation CARs can improve the anti-tumor activity of T cells. For example, robust efficacy of Second Generation CAR modified T cells was demonstrated in clinical trials targeting the CD19 molecule in patients with chronic lymphoblastic leukemia (CLL) and acute lymphoblastic leukemia (ALL). Third generation CARs comprise those that provide multiple co-stimulation (e.g., CD28 and 4-1BB) and activation (CD3?).
[0099] In accordance with the presently disclosed subject matter, the CARs comprise an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen-binding domain binds to BCMA. In certain embodiments, the extracellular antigen-binding domain is a scFv. In certain embodiments, the extracellular antigen-binding domain is a Fab, which is optionally crosslinked. In a certain embodiments, the extracellular binding domain is a F(ab).sub.2. In certain embodiments, any of the foregoing molecules may be comprised in a fusion protein with a heterologous sequence to form the extracellular antigen-binding domain. In one specific non-limiting embodiment, the extracellular antigen-binding domain comprises a human scFv that binds specifically to human BCMA.
[0100] In certain non-limiting embodiments, the extracellular antigen-binding domain of a CAR has a high binding specificity as well as high binding affinity to the BCMA. For example, in such embodiments, the extracellular antigen-binding domain of the CAR (embodied, for example, in a human scFv or an analog thereof) binds to BCMA with a dissociation constant (K.sub.D) of about 3?10.sup.?6 M or less. In certain embodiments, the K.sub.D is about 1?10.sup.?6 M or less, about 1?10.sup.?7 M or less, about 1?10.sup.?8 M or less, or about 1?10.sup.?9 M or less, about 1?10.sup.?10 M or less, or about 1?10.sup.?11 M or less. In certain embodiments, the K.sub.D is about 1?10.sup.?8 M or less. In certain embodiments, the K.sub.D is from about 1?10.sup.?11 M to about 3?10.sup.?6 M, such as from about 1?10.sup.?11 M to about 1?10.sup.40 M, from about 1?10.sup.?1? M to about 1?10.sup.?9M, from about 1?10.sup.?9M to about 1?10.sup.?8 M, from about 1?10.sup.?8M to about 1?10.sup.?7 M, or from about 1?10.sup.?7 M to about 1?10.sup.?6 M, or from about 1?10.sup.?6 M to about 3?10.sup.?6 M. In certain embodiments, the K.sub.D is from about 1?10.sup.?9M to about 1?10.sup.?8 M. In certain embodiments, the K.sub.D is from about 1?10.sup.?9M to about 1.5?10.sup.?9 M. In certain embodiments, the K.sub.D is about 1.2?10.sup.?9M. In certain embodiments, the K.sub.D is from about 4?10.sup.?9 M to about 5?10.sup.?9 M. In certain embodiments, the K.sub.D is about 5?10.sup.?9 M. In certain embodiments, the K.sub.D is about 4.8?10.sup.?9 M. In certain embodiments, the K.sub.D is from about 8?10.sup.?9M to about 9?10.sup.?9 M. In certain embodiments, the K.sub.D is about 8?10.sup.?9 M. In certain embodiments, the K.sub.D is about 8.1?10.sup.?9M.
[0101] Binding of the extracellular antigen-binding domain (embodiment, for example, in a human scFv or an analog thereof) of a presently disclosed CAR to BCMA can be confirmed by, for example, enzyme-linked immunosorbent assay (ELISA), radioimmunoassay (RIA), FACS analysis, bioassay (e.g., growth inhibition), or Western Blot assay. Each of these assays generally detect the presence of protein-antibody complexes of particular interest by employing a labeled reagent (e.g., an antibody, or a scFv) specific for the complex of interest. For example, the scFv can be radioactively labeled and used in a radioimmunoassay (RIA) (see, for example, Weintraub, B., Principles of Radioimmunoassays, Seventh Training Course on Radioligand Assay Techniques, The Endocrine Society, March, 1986, which is incorporated by reference herein). The radioactive isotope can be detected by such means as the use of a ? counter or a scintillation counter or by autoradiography. In certain embodiments, the BCMA-targeted extracellular antigen-binding domain is labeled with a fluorescent marker. Non-limiting examples of fluorescent markers include green fluorescent protein (GFP), blue fluorescent protein (e.g., EBFP, EBFP2, Azurite, and mKalama1), cyan fluorescent protein (e.g., ECFP, Cerulean, and CyPet), and yellow fluorescent protein (e.g., YFP, Citrine, Venus, and YPet). In certain embodiments, the BCMA-targeted human scFv is labeled with GFP.
[0102] In certain embodiments, the extracellular antigen-binding domain of a presently disclosed CAR comprises a single-chain variable fragment (scFv). In one specific non-limiting embodiment, the extracellular antigen-binding domain of a presently disclosed CAR comprises a human scFv that specifically binds to human BCMA. In certain embodiments, the scFv are identified by screening scFv phage library with BCMA-Fc fusion protein.
[0103] Extracellular Antigen Binding Domain of a CAR
[0104] In certain embodiments, the extracellular antigen-binding domain (e.g., human scFv) comprises a heavy chain variable region comprising amino acids having a sequence selected from the group consisting of: SEQ ID NOS:1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, and 65. The nucleic acid sequences encoding the amino acid sequence of SEQ ID NOS:1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, and 65 are 3, 7, 11, 15, 19, 23, 27, 31, 35, 39, 43, 47, 51, 55, 59, 63, and 67, respectively. In certain embodiments, the extracellular antigen-binding domain (e.g., human scFv) comprises a light chain variable region comprising amino acids having a sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, and 66. The nucleic acid sequences encoding the amino acid sequence of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, and 66 are 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, and 68, respectively. The sequences of SEQ ID NOS:1-68 are described in the following Tables 1-17.
[0105] In certain embodiments, the extracellular antigen-binding domain (e.g., scFv) comprises heavy and light chain variable regions comprising amino acid sequences that are homologous to the amino acid sequences described herein and as disclosed in Tables 1-17. For example, and not by way of limitation, the extracellular antigen-binding domain (e.g., scFv) comprises a heavy chain variable region comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, and 65.
[0106] In certain embodiments, the extracellular antigen-binding domain (e.g., scFv) comprises a light chain variable region comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, and 66 are 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, and 68.
[0107] In certain embodiments, the extracellular antigen-binding domain (e.g., scFv) comprises (a) a heavy chain variable region comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 1, 5, 9, 13, 17, 21, 25, 29, 33, 37, 41, 45, 49, 53, 57, 61, and 65; and (b) a light chain variable region comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to an amino acid sequence selected from the group consisting of SEQ ID NOS: 2, 6, 10, 14, 18, 22, 26, 30, 34, 38, 42, 46, 50, 54, 58, 62, and 66 are 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, and 68.
[0108] The presently disclosed subject matter further provides extracellular antigen-binding domains (e.g., scFv) that comprise heavy chain variable region and light chain variable region CDRs, e.g., CDR1s, CDR2s and CDR3s, as disclosed herein in Tables 1-17. The CDR regions are delineated using the Kabat system (Kabat, E. A., et al. (1991) Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242). The presently disclosed subject matter further provides extracellular antigen-binding domains (e.g., scFv) that comprise conservative modifications of the antibody sequences disclosed herein. For example, and not by way of limitation, an extracellular antigen-binding domains (e.g., scFv) of the presently disclosed subject matter comprises a heavy chain variable region comprising CDR1, CDR2 and CDR3 sequences and a light chain variable region comprising CDR1, CDR2 and CDR3 sequences, wherein one or more of these CDR sequences comprise specified amino acid sequences disclosed herein, or conservative modifications thereof, and wherein the extracellular antigen-binding domains retain the desired functional properties.
[0109] In certain embodiments, the presently disclosed subject matter provides an extracellular antigen-binding domain (e.g., scFv) comprising a heavy chain variable region, wherein the heavy chain variable region comprises: (a) a CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 89, 95, 101, 107, 113, 119, 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, and 185, and conservative modifications thereof; (b) a CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 90, 96, 102, 108, 114, 120, 126, 132, 138, 144, 150, 156, 162, 168, 174, 180, and 186, and conservative modifications thereof; and (c) a CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 91, 97, 103, 109, 115, 121, 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, and 187, and conservative modifications thereof.
[0110] In certain embodiments, the extracellular antigen-binding domain (e.g., scFv) comprises a light chain variable region, wherein the light chain variable region comprises: (a) a CDR1 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 92, 98, 104, 110, 116, 122, 128, 134, 140, 146, 152, 158, 164, 170, 176, 182, and 188, and conservative modifications thereof; (b) a CDR2 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 93, 99, 105, 111, 117, 123, 129, 135, 141, 147, 153, 159, 165, 171, 177, 183, and 189, and conservative modifications thereof; and (c) a CDR3 comprising an amino acid sequence selected from the group consisting of SEQ ID NOS: 94, 100, 106, 112, 118, 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, and 190, and conservative modifications thereof.
[0111] The presently disclosed subject matter provides an extracellular antigen-binding domain (e.g., scFv) comprising a heavy chain variable region comprising CDR1, CDR2, and CDR3 sequences and a light chain variable region comprising CDR1, CDR2, and CDR3 sequences, wherein: (a) the heavy chain variable region CDR3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 91, 97, 103, 109, 115, 121, 127, 133, 139, 145, 151, 157, 163, 169, 175, 181, and 187, and conservative modifications thereof; and (b) the light chain variable region CDR3 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 94, 100, 106, 112, 118, 124, 130, 136, 142, 148, 154, 160, 166, 172, 178, 184, and 190, and conservative modifications thereof; wherein the extracellular antigen-binding domain specifically binds to a BCMA polypeptide (e.g., a human BCMA polypeptide). In certain embodiments, the heavy chain variable region CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, 185, 191, 197, 203, 209, 215, 221, 227, 233, 239, 245, 251, 257, 263, 305, 317, 329, 341, 353, 365, 377, and 389, and conservative modifications thereof; and (b) the light chain variable region CDR2 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 93, 99, 105, 111, 117, 123, 129, 135, 141, 147, 153, 159, 165, 171, 177, 183, and 189, and conservative modifications thereof; wherein the extracellular antigen-binding domain specifically binds to a BCMA polypeptide (e.g., a human BCMA polypeptide). In certain embodiments, the heavy chain variable region CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOs: 89, 95, 101, 107, 113, 119, 125, 131, 137, 143, 149, 155, 161, 167, 173, 179, and 185, and conservative modifications thereof; and (b) the light chain variable region CDR1 comprises an amino acid sequence selected from the group consisting of SEQ ID NOS: 92, 98, 104, 110, 116, 122, 128, 134, 140, 146, 152, 158, 164, 170, 176, 182, and 188, and conservative modifications thereof; wherein the extracellular antigen-binding domain specifically binds to a BCMA polypeptide (e.g., a human BCMA polypeptide).
[0112] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO: 72 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-192 scFv (also referred to as ET140-42 scFv).
[0113] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:1 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:2, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 1. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:1, as shown in Table 1. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:1, as shown in Table 1. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:2, as shown in Table 1. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:2, as shown in Table 1. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:1 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:2, as shown in Table 1. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:89 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:90 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:91 or conservative modifications thereof, as shown in Table 1. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:92 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:93 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:94 or conservative modifications thereof, as shown in Table 1. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:89 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:90 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:91 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:92 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:93 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:94 or conservative modifications thereof, as shown in Table 1. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:89, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:90, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:91, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:92, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:93, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:94.
TABLE-US-00006 TABLE 1 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H VSSNSAAWN [SEQ YRSKWYN [SEQ ID ARQGYSYYGYSDV ID NO: 89] NO: 90] [SEQ ID NO: 91] V.sub.L SSNIGHND [SEQ ID FDD [SEQ ID NO: 93 AAWDGSLNAFV NO: 92] [SEQ ID NO: 94] Full V.sub.H QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRG LEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTP EDTAVYYCARQGYSYYGYSDVWGQGTLVTVSS [SEQ ID NO: 1] DNA Caggtacagctgcagcagtcaggtccaggactggtgaagccctcgcagaccctctcactcacctgtgcc atctccggggacagtgtctctagcaacagtgctgcttggaactggatcaggcagtccccatcgagaggcc ttgagtggctgggaaggacatactacaggtccaagtggtataatgattatgcagtatctgtgaaaagtcga ataaccatcaacccagacacatccaagaaccagttctccctgcagctgaactctgtgactcccgaggaca cggctgtgtattactgtgcgcgccagggttactcttactacggttactctgatgrnggggtcaaggtactct ggtgaccgtctcctca [SEQ ID NO: 3] Full V.sub.L QSVLTQPPSVSVAPRQRVTISCSGSSSNIGHNDVSWYQHLPGKAPR LLIYFDDLLPSGVSDRFSASKSGTSASLAISGLQSEDEADYYCAAW DGSLNAFVFGTGTKVTVLG [SEQ ID NO: 2] DNA Cagtctgtgctgactcagccaccctcggtgtctgtagcccccaggcagagggtcaccatctcgtgttctg gaagcagctccaacatcggacataatgatgtaagctggtaccagcatctcccagggaaggctcccagac tcctcatctattttgatgacctgctgccgtcaggggtctctgaccgattctctgcctccaagtctggcacctca gcctccctggccatcagtgggctccagtctgaggatgaggctgattattactgtgcagcatgggatggca gcctgaatgcctttgtcttcggaactgggaccaaggtcaccgtcctaggt [SEQ ID NO: 4] scFv QSVLTQPPSVSVAPRQRVTISCSGSSSNIGHNDVSWYQHLPGKAPR LLIYFDDLLPSGVSDRFSASKSGTSASLAISGLQSEDEADYYCAAW DGSLNAFVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAQVQL QQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWL GRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTA VYYCARQGYSYYGYSDVWGQGTLVTVSS [SEQ ID NO: 72]
[0114] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:73 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-197 scFv (also referred to as ET140-47 scFv).
[0115] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:5 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:6, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:5, as shown in Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:5, as shown in Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:6, as shown in Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:6, as shown in Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:5 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:6, as shown in Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:95 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:96 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:97 or conservative modifications thereof, as shown in Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:98 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:99 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:100 or conservative modifications thereof, as shown in Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:95 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:96 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:97 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:98 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:99 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:100 or conservative modifications thereof, as shown in Table 2. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:95, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:96, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:97, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:98, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:99, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:100.
TABLE-US-00007 TABLE 2 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H VSSNSAAWN [SEQ ID YRSKWYN [SEQ ARYGFSGSRFYDT NO: 95] ID NO: 96] [SEQ ID NO: 97] V.sub.L SSNIGNNA [SEQ ID FDD [SEQ ID AAWDDSLNGYV NO: 98] NO: 99] [SEQ ID NO: 100] Full V.sub.H QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSR GLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSV TPEDTAVYYCARYGFSGSRFYDTWGQGTLVTVSS [SEQ ID NO: 5] DNA Caggtacagctgcagcagtcaggtccaggactggtgaagccctcgcagaccctctcactcacctgtgc catctccggggacagtgtctctagcaacagtgctgcttggaactggatcaggcagtccccatcgagagg ccttgagtggctgggaaggacatactacaggtccaagtggtataatgattatgcagtatctgtgaaaagtc gaataaccatcaacccagacacatccaagaaccagttctccctgcagctgaactctgtgactcccgagg acacggctgtgtattactgtgcgcgctacggtttctctggttctcgtttctacgatacttggggtcaaggtac tctggtgaccgtctcctca [SEQ ID NO: 7] Full V.sub.L QPVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWYQQLPGKAP KLLIYFDDLLSSGVSDRFSGSKSGTSASLAISGLQSEDEADYYCAA WDDSLNGYVFGTGTKVTVLG [SEQ ID NO: 6] DNA Cagcctgtgctgactcagccaccctcggtgtctgaagcccccaggcagagggtcaccatctcctgttct ggaagcagctccaacatcggaaataatgctgtaaactggtaccagcagctcccaggaaaggctcccaa actcctcatctattttgatgatctgctgtcctcaggggtctctgaccgattctctggctccaagtctggcacct cagcctccctggccatcagtgggctccagtctgaagatgaggctgattattactgtgcagcatgggatga cagcctgaatggttatgtcttcggaactgggaccaaggtcaccgtcctaggt [SEQ ID NO: 8] scFv QPVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWYQQLPGKAP KLLIYFDDLLSSGVSDRFSGSKSGTSASLAISGLQSEDEADYYCAA WDDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAQ VQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRG LEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTP EDTAVYYCARYGFSGSRFYDTWGQGTLVTVSS [SEQ ID NO: 73]
[0116] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:74 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-180 scFv (also referred to as ET140-30 scFv).
[0117] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:9 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:10, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 3. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:9, as shown in Table 3. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:9, as shown in Table 3. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:10, as shown in Table 3. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:10, as shown in Table 3. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:9 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:10, as shown in Table 3. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:101 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:102 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:103 or conservative modifications thereof, as shown in Table 3. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:104 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:105 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:106 or conservative modifications thereof, as shown in Table 3. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:101 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:102 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:103 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:104 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:105 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:106 or conservative modifications thereof, as shown in Table 3. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:101, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:102, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:103, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:104, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:105, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:106.
TABLE-US-00008 TABLE 3 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GGTFSSYA [SEQ ID IIPILGIA [SEQ ID ARSGYSKSIVSYMD NO: 101] NO: 102] Y [SEQ ID NO: 103] V.sub.L SSNIGSNV [SEQ ID RNN [SEQ ID AAWDDSLSGYV NO: 104] NO: 105] [SEQ ID NO: 106] Full V.sub.H EVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGL EWMGRIIPILGIANYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDT AVYYCARSGYSKSIVSYMDYWGQGTLVTVSS [SEQ ID NO: 9] DNA Gaggtccagctggtgcagtctggagctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaa ggatctggaggcaccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttga gtggatgggaaggatcatccctatccttggtatagcaaactacgcacagaagttccagggcagagtcacc atgaccgaggacacatctacagacacagcctacatggagctgagcagcctgagatctgaggacacggc cgtgtattactgtgcgcgctctggttactctaaatctatcgtttcttacatggattactggggtcaaggtactct ggtgaccgtctcctca [SEQ ID NO: 11] Full V.sub.L LPVLTQPPSTSGTPGQRVTVSCSGSSSNIGSNVVFWYQQLPGTAPK LVIYRNNQRPSGVPDRFSVSKSGTSASLAISGLRSEDEADYYCAAW DDSLSGYVFGTGTKVTVLG [SEQ ID NO: 10] DNA Ctgcctgtgctgactcagcccccctccacgtctgggacccccgggcagagggtcaccgtctcttgttctg gaagcagctccaacatcggaagtaatgttgtattctggtaccagcagctcccaggcacggcccccaaact tgtcatctataggaataatcaacggccctcaggggtecctgaccgattctctgtctccaagtctggcacctc agcctccctggccatcagtgggctccggtccgaggacgaggctgattattattgtgcagatgggatgac agcctgagtggttatgtatcggaactgggaccaaggtcaccgtcctaggt [SEQ ID NO: 12] scFv LPVLTQPPSTSGTPGQRVTVSCSGSSSNIGSNVVFWYQQLPGTAPK LVIYRNNQRPSGVPDRFSVSKSGTSASLAISGLRSEDEADYYCAAW DDSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQL VQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWM GRIIPILGIANYAQKFQGRVTMTEDTSTDTAYMELSSLRSEDTAVY YCARSGYSKSIVSYMDYWGQGTLVTVSS [SEQ ID NO: 74]
[0118] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:75 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-172 scFv (also referred to as ET140-22 scFv).
[0119] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:13 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:14, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 4. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:13, as shown in Table 4. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:13, as shown in Table 4. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:14, as shown in Table 4. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:14, as shown in Table 4. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:13 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:14, as shown in Table 4. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:107 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:108 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:109 or conservative modifications thereof, as shown in Table 4. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:110 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:111 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:112 or conservative modifications thereof, as shown in Table 4. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:107 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:108 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:109 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:110 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:111 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:112 or conservative modifications thereof, as shown in Table 4. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:107, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:108, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:109, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:110, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:111, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:112.
TABLE-US-00009 TABLE 4 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GYTFTSYY [SEQ ID INPSGGST [SEQ ID ARSQWGGVLDY NO: 107] NO: 108] [SEQ ID NO: 109] V.sub.L SSNIGARYD [SEQ ID GNN [SEQ ID NO: QSYDSSLSASV [SEQ NO: 110] 111] ID NO: 112] Full V.sub.H EVQLVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQ GLEWMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRS EDTAVYYCARSQWGGVLDYWGQGTLVTVSS [SEQ ID NO: 13] DNA Gaggtccagctggtacagtctggggctgaggtgaagaagcctggggcctcagtgaaggtttcctgcaa ggcatctggatacaccttcaccagctactatatgcactgggtgcgacaggcccctggacaagggcttgag tggatgggaataatcaaccctagtggtggtagcacaagctacgcacagaagttccagggcagagtcacc atgaccagggacacgtccacgagcacagtctacatggagctgagcagcctgagatctgaggacacggc cgtgtattactgtgcgcgctctcagtggggtggtgttctggattactggggtcaaggtactctggtgaccgt ctcctca [SEQ ID NO: 15] Full V.sub.L QSVVTQPPSVSGAPGQRVTISCSGSSSNIGARYDVQWYQQLPGTAP KLLIFGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQS YDSSLSASVFGGGTKLTVLG [SEQ ID NO: 14] DNA Cagtctgtcgtgacgcagccgccctcagtgtctggggccccagggcagagggtcaccatctcctgcag tgggagcagctccaacatcggggcacgttatgatgttcagtggtaccagcagcttccaggaacagcccc caaactcctcatctttggtaacaacaatcggccctcaggggtccctgaccgattctctggctccaagtctgg cacgtcagcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatg acagcagcctgagtgcttcggtgttcggcggagggaccaagctgaccgtcctaggt [SEQ ID NO: 16] scFv QSVVTQPPSVSGAPGQRVTISCSGSSSNIGARYDVQWYQQLPGTAP KLLIFGNNNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQS YDSSLSASVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAEVQ LVQSGAEVKKPGASVKVSCKASGYTFTSYYMHWVRQAPGQGLE WMGIINPSGGSTSYAQKFQGRVTMTRDTSTSTVYMELSSLRSEDT AVYYCARSQWGGVLDYWGQGTLVTVSS [SEQ ID NO: 75]
[0120] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:76 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-157 scFv (also referred to as ET140-7 scFv).
[0121] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:17 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:18, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 5. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:17, as shown in Table 5. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:17, as shown in Table 5. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:18, as shown in Table 5. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:18, as shown in Table 5. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:17 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:18, as shown in Table 5. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:113 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:114 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:115 or conservative modifications thereof, as shown in Table 5. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:116 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:117 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:118 or conservative modifications thereof, as shown in Table 5. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:113 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:114 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:115 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:116 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:117 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:118 or conservative modifications thereof, as shown in Table 5. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:113, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:114, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:115, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:116, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:117, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:118.
TABLE-US-00010 TABLE 5 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GGTFSSYA [SEQ ID IIPILGIA [SEQ ID ARTGYESWGSYEVI NO: 113] NO: 114] DR [SEQ ID NO: 115] V.sub.L SSNIGSNT [SEQ ID SNN [SEQ ID NO: 117] AAWDDSLNGVV NO: 116] [SEQ ID NO: 118] Full V.sub.H QVQLVESGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGL EWMGRIIPILGIANYAQKFQGRVTITADESTSTAYMELSSLRSEDTA VYYCARTGYESWGSYEVIDRWGQGTLVTVSS [SEQ ID NO: 17] DNA Caggtgcagctggtggagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaa ggcttctggaggcaccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttga gtggatgggaaggatcatccctatccttggtatagcaaactacgcacagaagttccagggcagagtcacg attaccgcggacgaatccacgagcacagcctacatggagctgagcagcctgagatctgaggacacggc cgtatattactgtgcgcgcactggttacgaatcttggggttcttacgaagttatcgatcgttggggtcaaggt actctggtgaccgtctcctca [SEQ ID NO: 19] Full V.sub.L QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYRQLPGTAPK LLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAW DDSLNGVVFGGGTKLTVLG [SEQ ID NO: 18] DNA Caggctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgttct ggaagcagctccaacatcggaagtaatactgtaaactggtaccggcagctcccaggaacggcccccaa actcctcatctatagtaataatcagcggccctcaggggtccctgaccgattctctggctccaagtctggcac ctcagcctccctggccatcagtgggctccagtctgaggatgaggctgattattactgtgcagcatgggatg acagcctgaatggtgtggtattcggcggagggaccaagctgaccgtcctaggt [SEQ ID NO: 20] scFv QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYRQLPGTAPK LLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAW DDSLNGVVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQVQ LVESGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEW MGRIIPILGIANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVY YCARTGYESWGSYEVIDRWGQGTLVTVSS [SEQ ID NO: 76]
[0122] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:77 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-153 scFv (also referred to as ET140-3 scFv).
[0123] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:21 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:22, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 6. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%. A homologous to the amino acid sequence set forth in SEQ ID NO:21, as shown in Table 6. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:21, as shown in Table 6. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:22, as shown in Table 6. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:22, as shown in Table 6. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:21 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:22, as shown in Table 6. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:119 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:120 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:121 or conservative modifications thereof, as shown in Table 6. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:122 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:123 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:124 or conservative modifications thereof, as shown in Table 6. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:119 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:120 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:121 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:122 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:123 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:124 or conservative modifications thereof, as shown in Table 6. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:119, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:120, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:121, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:122, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:123, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:124.
TABLE-US-00011 TABLE 6 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GGTFSSYA [SEQ ID IIPILGIA [SEQ ID ARGGYYSHDMWS NO: 119] NO: 120] ED [SEQ ID NO: 121] V.sub.L SSNIGSNS [SEQ ID SNN [SEQ ID NO: 123] ATWDDNLNVHYV NO: 122] [SEQ ID NO: 124] Full V.sub.H QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGL EWMGRIIPILGIANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTA VYYCARGGYYSHDMWSEDWGQGTLVTVSS [SEQ ID NO: 21] DNA Caggtgcagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaag gcttctggaggcaccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttgagt ggatgggaaggatcatccctatccttggtatagcaaactacgcacagaagttccagggcagagtcacgatt accgcggacaaatccacgagcacagcctacatggagctgagcagcctgagatctgaggacacggccgt gtattactgtgcgcgcggtggttactactctcatgacatgtggtctgaagattggggtcaaggtactctggtg accgtctcctca [SEQ ID NO: 23] Full V.sub.L LPVLTQPPSASGTPGQRVTISCSGRSSNIGSNSVNWYRQLPGAAPKL LIYSNNQRPPGVPVRFSGSKSGTSASLAISGLQSEDEATYYCATWD DNLNVHYVFGTGTKVTVLG [SEQ ID NO: 22] DNA Ctgcctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgttctg gacgcagttccaacatcgggagtaattctgttaactggtatcgacaactcccaggagcggcccccaaactc ctcatctatagtaataatcagcggcccccaggggtccctgtgcgattctctggctccaagtctggcacctca gcctccctggccatcagtgggctccagtctgaagatgaggccacttattactgtgcaacatgggatgacaa tctgaatgttcactatgtcttcggaactgggaccaaggtcaccgtcctaggt [SEQ ID NO: 24] scFv LPVLTQPPSASGTPGQRVTISCSGRSSNIGSNSVNWYRQLPGAAPKL LIYSNNQRPPGVPVRFSGSKSGTSASLAISGLQSEDEATYYCATWD DNLNVHYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAQVQ LVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEW MGRIIPILGIANYAQKFQGRVTITADKSTSTAYMELSSLRSEDTAVY YCARGGYYSHDMWSEDWGQGTLVTVSS [SEQ ID NO: 77]
[0124] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:78 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-201 scFv (also referred to as ET140-51 scFv).
[0125] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:25 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:26, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 7. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:25, as shown in Table 7. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:25, as shown in Table 7. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:26, as shown in Table 7. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:26, as shown in Table 7. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:25 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:26, as shown in Table 7. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:125 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:126 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:127 or conservative modifications thereof, as shown in Table 7. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:128 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:129 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:130 or conservative modifications thereof, as shown in Table 7. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:125 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:126 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:127 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:128 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:129 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:130 or conservative modifications thereof, as shown in Table 7. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:125, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:126, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:127, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:128, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:129, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:130.
TABLE-US-00012 TABLE 7 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GGSISNSNW [SEQ IYHSGST [SEQ ID ARRDNWKTPTTKID ID NO: 125] NO: 126] GFDI [SEQ ID NO: 127] V.sub.L SGYSNYK [SEQ ID VGTGGIVG [SEQ ID GADHGSGSNFVYV NO: 128] NO: 129] SEQ ID NO: 130] Full V.sub.H QVQLQESGPGLVKPSGTLSLTCGVSGGSISNSNWWSWVRQPPGKG LEWIGEIYHSGSTKYNPSLRSRVTISVDKSKNQFSLKLSSVTAADT AVYYCARRDNWKTPTTKIDGFDIWGQGTMVTVSS [SEQ ID NO: 25] DNA Caggtgcagctgcaggagtcgggcccaggactggtgaagccttcggggaccctgtccctcacctgcg gtgtctctggtggctccatcagcaatagtaactggtggagttgggtccgccagccccccgggaaggggc tggagtggattggggaaatctatcatagtgggagcaccaagtacaacccgtccctcaggagtcgagtcac catatcagtagacaagtccaagaaccagttctccctaaaattgagctctgtgaccgccgcggacacggcc gtatattactgtgcgagacgagataactggaagacccccactaccaaaattgatggttttgatatctggggc caagggacaatggtcaccgtctcttca [SEQ ID NO: 27] Full V.sub.L QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPR FVMRVGTGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDEGDY HCGADHGSGSNFVYVFGTGTKVTVLG [SEQ ID NO: 26] DNA Cagcctgtgctgactcagccaccttctgcatcagcctccctgggagcctcggtcacactcacctgcaccc tgagcagcggctacagtaattataaagtggactggtaccagcagagaccagggaagggcccccggtttg tgatgcgagtgggcactggtgggattgtgggatccaagggggatggcatccctgatcgcttctcagtcttg ggctcaggcctgaatcggtacctgaccatcaagaacatccaggaagaagatgagggtgactatcactgt ggggcagaccatggcagtgggagcaacttcgtgtatgtcttcggaactgggaccaaggtcaccgtccta ggt [SEQ ID NO: 28] scFv QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPR FVMRVGTGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDEGDY HCGADHGSGSNFVYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSL EMAQVQLQESGPGLVKPSGTLSLTCGVSGGSISNSNWWSWVRQP PGKGLEWIGEIYHSGSTKYNPSLRSRVTISVDKSKNQFSLKLSSVTA ADTAVYYCARRDNWKTPTTKIDGFDIWGQGTMVTVSS [SEQ ID NO: 78]
[0126] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:79 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-167 scFv (also referred to as ET140-17 scFv).
[0127] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:29 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:30, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 8. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:29, as shown in Table 8. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:29, as shown in Table 8. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:30, as shown in Table 8. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:30, as shown in Table 8. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:29 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:30, as shown in Table 8. In certain embodiments, the anti-BCMA comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:131 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:132 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:133 or conservative modifications thereof, as shown in Table 8. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:134 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:135 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:136 or conservative modifications thereof, as shown in Table 8. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:131 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:132 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:133 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:134 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:135 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:136 or conservative modifications thereof, as shown in Table 8. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:131, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:132, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:133, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:134, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:135, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:136.
TABLE-US-00013 TABLE 8 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GYTFTGYY [SEQ ID INPNSGGT [SEQ ID ARSQWGSSWDY NO: 131] NO: 132] [SEQ ID NO: 133] V.sub.L QSISSY [SEQ ID NO: AAS [SEQ ID NO: QQSYSTPPT [SEQ 134] 135] ID NO: 136] Full V.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQ GLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLR SDDTAVYYCARSQWGSSWDYWGQGTLVTVSS [SEQ ID NO: 29] DNA Caggtccagctggtacagtctggggctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaa ggcttctggatacaccttcaccggctactatatgcactgggtgcgacaggcccctggacaagggcttgag tggatgggatggatcaaccctaacagtggtggcacaaactatgcacagaagtttcagggcagggtcacc atgaccagggacacgtccatcagcacagcctacatggagctgagcaggctgagatctgacgacacggc cgtgtattactgtgcgcgctctcagtggggttcttcttgggattactggggtcaaggtactctggtgaccgtc tcctca [SEQ ID NO: 31] Full V.sub.L DIQLTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKL LIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYS TPPTFGQGTKVEIKR [SEQ ID NO: 30] DNA Gacatccagttgacccagtctccatcctccctgtctgcatctgtaggagacagagtcaccatcacttgccg ggcaagtcagagcattagcagctatttaaattggtatcagcagaaaccagggaaagcccctaagctcctg atctatgctgcatccagtttgcaaagtggggtcccatcaaggttcagtggcagtggatctgggacagatttc actctcaccatcagcagtctgcaacctgaagattttgcaacttactactgtcaacagagttacagtacccctc cgacgttcggccaagggaccaaggtggagatcaaacgt [SEQ ID NO: 32] scFv DIQLTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKL LIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYS TPPTFGQGTKVEIKRSRGGGGSGGGGSGGGGSLEMAQVQLVQSG AEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQGLEWMGW INPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAVYY CARSQWGSSWDYWGQGTLVTVSS [SEQ ID NO: 79]
[0128] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:80 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-163 scFv (also referred to as ET140-13 scFv).
[0129] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:33 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:34, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 9. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:33, as shown in Table 9. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:33, as shown in Table 9. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:34, as shown in Table 9. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:34, as shown in Table 9. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:33 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:34, as shown in Table 9. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:137 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:138 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:139 or conservative modifications thereof, as shown in Table 9. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:140 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:141 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:142 or conservative modifications thereof, as shown in Table 9. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:137 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:138 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:139 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:140 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:141 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:142 or conservative modifications thereof, as shown in Table 9. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:137, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:138, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:139, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:140, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:141, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:142.
TABLE-US-00014 TABLE 9 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GYTFTGYY [SEQ ID INPNSGGT [SEQ ID ARSSYHLYGYDS NO: 137] NO: 138] [SEQ ID NO: 139] V.sub.L NDYTNYK [SEQ ID VGPGGIVG [SEQ GADHGTGSNFVYV NO: 140] ID NO: 141] [SEQ ID NO: 142] Full V.sub.H EVQLVESGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQAPGQ GLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLR SDDTAVYYCARSSYHLYGYDSWGQGTLVTVSS [SEQ ID NO: 33] DNA Gaggtgcagctggtggagtccggggctgaggtgaagaagcctggggcctcagtgaaggtctcctgca aggcttctggatacaccttcaccggctactatatgcactgggtgcgacaggcccctggacaagggcttga gtggatgggatggatcaaccctaacagtggtggcacaaactatgcacagaagtttcagggcagggtcac catgaccagggacacgtccatcagcacagcctacatggagctgagcaggctgagatctgacgacacgg ccgtatattactgtgcgcgctcttcttaccatctgtacggttacgattcttggggtcaaggtactctggtgacc gtctcctca [SEQ ID NO: 35] Full V.sub.L QPVLTQPPSASASLGASVTLTCTLSNDYTNYKVDWYQQRPGKGPR FVMRVGPGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDESDY HCGADHGTGSNFVYVFGGGTKLTVLG [SEQ ID NO: 34] DNA Cagcctgtgctgactcagccaccttctgcatcagcctccctgggagcctcggtcactctcacctgcaccct gagcaacgactacactaattataaagtggactggtaccagcagagaccagggaagggcccccggtttgt gatgcgagtgggccctggtgggattgtgggatccaagggggatggcatccctgatcgcttctcagtcttg ggctcaggcctgaatcgatacctgaccatcaagaacatccaggaggaggatgagagtgactaccactgt ggggcggaccatggcaccgggagcaacttcgtgtacgtgttcggcggagggaccaagctgaccgtcct aggt [SEQ ID NO: 36] scFv QPVLTQPPSASASLGASVTLTCTLSNDYTNYKVDWYQQRPGKGPR FVMRVGPGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDESDY HCGADHGTGSNFVYVFGGGTKLTVLGSRGGGGSGGGGSGGGGSL EMAEVQLVESGAEVKKPGASVKVSCKASGYTFTGYYMHWVRQA PGQGLEWMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELS RLRSDDTAVYYCARSSYHLYGYDSWGQGTLVTVSS [SEQ ID NO: 80]
[0130] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:81 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-207 scFv (also referred to as ET140-57 scFv).
[0131] In certain embodiment, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:37 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:38, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:98. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 10. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:37, as shown in Table 10. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:37, as shown in Table 10. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:38, as shown in Table 10. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:38, as shown in Table 10. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:37 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:38, as shown in Table 10. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:143 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:144 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:145 or conservative modifications thereof, as shown in Table 10. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:146 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:147 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:148 or conservative modifications thereof, as shown in Table 10. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:143 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:144 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:145 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:146 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:147 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:148 or conservative modifications thereof, as shown in Table 10. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:143, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:144, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:145, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:146, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:147, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:148.
TABLE-US-00015 TABLE 10 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GGTFSSYA [SEQ ID IIPIFSTA [SEQ ID ARQPWTWYSPYD NO: 143] NO: 144] Q [SEQ ID NO: 145] V.sub.L SGYSNYK [SEQ ID VDTGGIVG [SEQ ID GADHGSGSNFVW NO: 146] NO: 147] V [SEQ ID NO: 148] Full V.sub.H QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQG LEWMGGIIPIFSTANYAQKFQGRVTMTTDTSTSTAYMELRSLRSD DTAVYYCARQPWTWYSPYDQWGQGTLVTVSS [SEQ ID NO: 37] DNA Caggtgcagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaa ggcttctggaggcaccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttga gtggatgggagggatcatccctatctttagtacagcaaactacgcacagaagttccagggcagagtcacc atgaccacagacacatccacgagcacagcctacatggagctgaggagcctgagatctgacgacacggc cgtgtattactgtgcgcgccagccgtggacttggtactctccgtacgatcagtggggtcaaggtactctgg tgaccgtctcctca [SEQ ID NO: 39] Full V.sub.L QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPR FLMRVDTGGIVGSKGDGIPDRFSVSGSGLNRYLTIKNIQEEDESDY HCGADHGSGSNFVWVFGGGTKLTVLG [SEQ ID NO: 38] DNA Cagcctgtgctgactcagccaccttctgcatcagcctccctgggagcctcggtcacactcacctgcaccc tgagcagcggctacagtaattataaagtggactggtatcaacagagaccagggaagggcccccggtttct gatgcgagtagacaccggtgggattgtgggatccaagggggatggcatccctgatcgcttctcagtctcg ggctcaggtctgaatcggtacctgaccatcaagaacattcaggaagaggatgagagtgactaccactgtg gggcagaccatggcagtgggagcaacttcgtgtgggtgttcggcggagggaccaagctgaccgtccta ggt [SEQ ID NO: 40] scFv QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPR FLMRVDTGGIVGSKGDGIPDRFSVSGSGLNRYLTIKNIQEEDESDY HCGADHGSGSNFVWVFGGGTKLTVLGSRGGGGSGGGGSGGGGS LEMAQVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQA PGQGLEWMGGIIPIFSTANYAQKFQGRVTMTTDTSTSTAYMELRS LRSDDTAVYYCARQPWTWYSPYDQWGQGTLVTVSS [SEQ ID NO: 81]
[0132] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:82 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-165 scFv (also referred to as ET140-15 scFv).
[0133] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:41 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:42, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 11. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:41, as shown in Table 11. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:41, as shown in Table 11. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:42, as shown in Table 11. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:42, as shown in Table 11. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:41 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:42, as shown in Table 11. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:149 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 150 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 151 or conservative modifications thereof, as shown in Table 11. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 152 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 153 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 154 or conservative modifications thereof, as shown in Table 11. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 147 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 150 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 151 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 152 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 153 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 154 or conservative modifications thereof, as shown in Table 11. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 149, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 150, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 151, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 152, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 153, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 154.
TABLE-US-00016 TABLE 11 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GFTFSTYA [SEQ ID ITPGGDRT [SEQ ID ARYYGYMIDM [SEQ NO: 149] NO: 150] ID NO: 151] V.sub.L QSLLHSNGYNY [SEQ LGS [SEQ ID NO: MQALQTPLT [SEQ ID NO: 152] 153] ID NO: 154] Full V.sub.H EVQLVETGGGLVQPGGSLRLSCAASGFTFSTYAMTWVRQAPGKGL EWVSAITPGGDRTYYADSVKGRFTISRDNSRNTLYLQMNSLRAEDT AVYYCARYYGYMIDMWGQGTLVTVSS [SEQ ID NO: 41] DNA Gaggtgcagctggtggagactgggggaggcctggtacagcctggggggtccctgagactctcctgtgct gcctctggattcacctttagcacctatgccatgacctgggtccgccaggctccagggaaggggctggagt gggtctcagctattactcctggtggtgatcgcacatactacgcagactccgtgaagggccgtttcactatctc cagagacaattccaggaacacgctgtatctgcaaatgaacagcctgagagccgaggacacggccgtatat tactgtgcgcgctactacggttacatgatcgatatgtggggtcaaggtactctggtgaccgtctcctca [SEQ ID NO: 43] Full V.sub.L DVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPG QSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC MQALQTPLTFGGGTKVEIKR [SEQ ID NO: 42] DNA Gatgttgtgatgactcagtctccactctccctgcccgtcacccctggagagccggcctccatctcctgcag gtctagtcagagcctcctgcatagtaatggatacaactatttggattggtacctgcagaagccagggcagtc tccacagctcctgatctatttgggttctaatcgggcctccggggtccctgacaggttcagtggcagtggatca ggcacagattttacactgaaaatcagcagagtggaggctgaggatgttggggtttattactgcatgcaagct ctacaaactcctctcactttcggcggagggaccaaggtggaaatcaaacgt [SEQ ID NO: 44] scFv DVVMTQSPLSLPVTPGEPASISCRSSQSLLHSNGYNYLDWYLQKPG QSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC MQALQTPLTFGGGTKVEIKRSRGGGGSGGGGSGGGGSLEMAEVQL VETGGGLVQPGGSLRLSCAASGFTFSTYAMTWVRQAPGKGLEWV SAITPGGDRTYYADSVKGRFTISRDNSRNTLYLQMNSLRAEDTAVY YCARYYGYMIDMWGQGTLVTVSS [SEQ ID NO: 82]
[0134] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:83 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-188 scFv (also referred to as ET140-38 scFv).
[0135] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:45 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:46, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 12. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:45, as shown in Table 12. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:45, as shown in Table 12. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:46, as shown in Table 12. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:46, as shown in Table 12. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:45 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:46, as shown in Table 12. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:155 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 156 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 157 or conservative modifications thereof, as shown in Table 12. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 158 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 159 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 160 or conservative modifications thereof, as shown in Table 12. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 155 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 156 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 157 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 158 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 159 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 160 or conservative modifications thereof, as shown in Table 12. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 155, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 156, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 157, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 158, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 159, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 160.
TABLE-US-00017 TABLE 12 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GYTFTGYY [SEQ ID INPNSGGT [SEQ ID ARSQWGGTYDY NO: 155] NO: 156] [SEQ ID NO: 157] V.sub.L SSNIGSNT [SEQ ID SNN [SEQ ID NO: AAWDDSLNGWV NO: 158] 159] [SEQ ID NO: 160] Full V.sub.H QMQLVQSGAEVKKPGASVKVSCKASGYTFTGYYVHWLRQAPGQ GLEWMGWINPNSGGTNNAQEFQGRITMTRDTSINTAYMELSRLRS DDTAVYYCARSQWGGTYDYWGQGTLVTVSS [SEQ ID NO: 45] DNA Cagatgcagctggtgcagtctggggctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaag gcttctggatacaccttcaccggctattatgtacactggttgcgacaggcccctggacaagggcttgagtgg atgggttggatcaaccctaacagtggcggcacaaacaatgcacaggagtttcaaggcaggatcaccatga ccagggacacgtccatcaacacagcctacatggagctgagcaggctgagatctgacgacacggccgtgt attactgtgcgcgctctcagtggggtggtacttacgattactggggtcaaggtactctggtgaccgtctcctc a [SEQ ID NO: 47] Full V.sub.L SYVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQVPGTAPKL LIYSNNQRPSGVPDRFSGSKSGASASLAISWLQSEDEADYYCAAWD DSLNGWVFGGGTKLTVLG [SEQ ID NO: 46] DNA Tcctatgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgttctgg aagcagctccaacatcggaagtaatactgtaaactggtaccagcaggtcccaggaacggcccccaaactc ctcatctatagtaataatcagcggccctcaggggtccctgaccgattctctggctccaagtctggcgcctca gcctccctggccatcagttggctccagtctgaggatgaggctgattattactgtgcagcatgggatgacagc ctgaatggttgggtgttcggcggagggaccaagctgaccgtcctaggt [SEQ ID NO: 48] scFv SYVLTQPPSASGTPGQRVTISCSGSSSNIGSNTVNWYQQVPGTAPKL LIYSNNQRPSGVPDRFSGSKSGASASLAISWLQSEDEADYYCAAWD DSLNGWVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAQMQL VQSGAEVKKPGASVKVSCKASGYTFTGYYVHWLRQAPGQGLEW MGWINPNSGGTNNAQEFQGRITMTRDTSINTAYMELSRLRSDDTA VYYCARSQWGGTYDYWGQGTLVTVSS [SEQ ID NO: 83]
[0136] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:84 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-196 scFv (also referred to as ET140-46 scFv).
[0137] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:49 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:50, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 13. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:49, as shown in Table 13. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:49, as shown in Table 13. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:50, as shown in Table 13. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:50, as shown in Table 13. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:49 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:50, as shown in Table 13. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:161 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 162 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 163 or conservative modifications thereof, as shown in Table 13. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 164 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:165 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:166 or conservative modifications thereof, as shown in Table 13. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 161 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 162 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 163 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 164 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:165 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:166 or conservative modifications thereof, as shown in Table 13. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 161, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 162, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 163, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 164, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:165, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:166.
TABLE-US-00018 TABLE 13 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GYDFTTYW [SEQ IYPGDSDT [SEQ ID ARMWTFSQDG [SEQ ID NO: 161] NO: 162] ID NO: 163] V.sub.L SSNIGSYT [SEQ ID SNN [SEQ ID AAWDDSLNGYV NO: 164] NO: 165] [SEQ ID NO: 166] Full V.sub.H EVQLVQSGAEVKKPGESLKISCKGSGYDFTTYWIGWVRQMPGKG LEWMGIIYPGDSDTRYSPSVRGRVTISADKSINTAYLQWSSLEASD TAMYYCARMWTFSQDGWGQGTLVTVSS [SEQ ID NO: 49] DNA gaggtgcagctggtgcagtctggagcagaggtgaaaaagccgggggagtctctgaagatctcctgtaa gggttctggatatgactttaccacctactggatcgggtgggtgcgccagatgcccgggaagggcctgga gtggatggggatcatctatcctggtgactctgataccagatacagcccgtccgtccgaggccgggtcacc atctcagccgacaagtccatcaacaccgcctatttgcagtggagtagcctggaggcctccgacaccgcc atgtattactgtgcgcgcatgtggactttctctcaggatggttggggtcaaggtactctggtgaccgtctcct ca [SEQ ID NO: 51] Full V.sub.L QAVLTQPPSASGTPGQRVTISCSGSSSNIGSYTVSWYQQLPGTAPK FLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAW DDSLNGYVFGTGTKVTVLG [SEQ ID NO: 50] DNA Caggctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgttct ggaagcagctccaacatcggaagttatactgtaagctggtaccagcaactcccaggaacggcccccaaa ttcctcatctattctaataatcagcggccctcaggggtccctgaccgattctctggctccaagtctggcacct cagcctccctggccatcagtgggctccagtctgaggatgaggctgattattactgtgctgcatgggatgac agcctgaatggttatgtcttcggaactgggaccaaggtcaccgtcctaggt [SEQ ID NO: 52] scFv QAVLTQPPSASGTPGQRVTISCSGSSSNIGSYTVSWYQQLPGTAPK FLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCAAW DDSLNGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAEVQL VQSGAEVKKPGESLKISCKGSGYDFTTYWIGWVRQMPGKGLEW MGIIYPGDSDTRYSPSVRGRVTISADKSINTAYLQWSSLEASDTAM YYCARMWTFSQDGWGQGTLVTVSS [SEQ ID NO: 84]
[0138] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:85 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-204 scFv (also referred to as ET140-54 scFv).
[0139] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 14. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:53, as shown in Table 14. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:53, as shown in Table 14. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:54, as shown in Table 14. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:54, as shown in Table 14. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:53 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:54, as shown in Table 14. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:167 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:168 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:169 or conservative modifications thereof, as shown in Table 14. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 170 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 171 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 172 or conservative modifications thereof, as shown in Table 14. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 167 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 168 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 169 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 170 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 171 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 172 or conservative modifications thereof, as shown in Table 14. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 167, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 168, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 169, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 170, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 171, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 172.
TABLE-US-00019 TABLE 14 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GYTFIDYY [SEQ INPNSGGT [SEQ ID ARSQRDGYMDY ID NO: 167] NO: 168] [SEQ ID NO: 169] V.sub.L ISCTGTSSD [SEQ EDS [SEQ ID NO: SSNTRSSTLV [SEQ ID ID NO: 170] 171] NO: 172] Full V.sub.H EVQLVQSGAEMKKPGASLKLSCKASGYTFIDYYVYWMRQAPGQ GLESMGWINPNSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRS DDTAMYYCARSQRDGYMDYWGQGTLVTVSS [SEQ ID NO: 53] DNA Gaagtgcagctggtgcagtctggggctgagatgaagaagcctggggcctcactgaagctctcctgcaa ggcttctggatacaccttcatcgactactatgtatactggatgcgacaggcccctggacaagggcttgagt ccatgggatggatcaaccctaacagtggtggcacaaactatgcacagaagtttcagggcagggtcacca tgaccagggacacgtccatcagcacagcctacatggagctgagcaggctgagatctgacgacaccgcc atgtattactgtgcgcgctcccagcgtgacggttacatggattactggggtcaaggtactctggtgaccgt ctcctca [SEQ ID NO: 55] Full V.sub.L QSALTQPASVSASPGQSIAISCTGTSSDVGWYQQHPGKAPKLMIYE DSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSNTRSST LVFGGGTKLTVLG [SEQ ID NO: 54] DNA Caatctgccctgactcagcctgcctccgtgtctgcgtctcctggacagtcgatcgccatctcctgcactgg aaccagcagtgacgttggttggtatcaacagcacccaggcaaagcccccaaactcatgatttatgagga cagtaagcggccctcaggggtttctaatcgcttctctggctccaagtctggcaacacggcctccctgacc atctctgggctccaggctgaggacgaggctgattattactgcagctcaaatacaagaagcagcactttggt gttcggcggagggaccaagctgaccgtcctaggt [SEQ ID NO: 56] scFv QSALTQPASVSASPGQSIAISCTGTSSDVGWYQQHPGKAPKLMIYE DSKRPSGVSNRFSGSKSGNTASLTISGLQAEDEADYYCSSNTRSST LVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAEVQLVQSGAE MKKPGASLKLSCKASGYTFIDYYVYWMRQAPGQGLESMGWINP NSGGTNYAQKFQGRVTMTRDTSISTAYMELSRLRSDDTAMYYCA RSQRDGYMDYWGQGTLVTVSS [SEQ ID NO: 85]
[0140] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:86 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-190 scFv (also referred to as ET140-40 scFv).
[0141] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 15. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:57, as shown in Table 15. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:57, as shown in Table 15. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:58, as shown in Table 15. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:58, as shown in Table 15. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:57 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:58, as shown in Table 15. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:173 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 174 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 175 or conservative modifications thereof, as shown in Table 15. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 176 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 177 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 178 or conservative modifications thereof, as shown in Table 15. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 173 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 174 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 175 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 176 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 177 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 178 or conservative modifications thereof, as shown in Table 15. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 173, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 174, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 175, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 176, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 177, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 178.
TABLE-US-00020 TABLE 15 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GYTFTDYY [SEQ ID INPNSGGT [SEQ ARSPYSGVLDK [SEQ NO: 173] ID NO: 174] ID NO: 175] V.sub.L SSNIGAGFD [SEQ ID GNS [SEQ ID NO: QSYDSSLSGYV [SEQ NO: 176] 177] ID NO: 178] Full V.sub.H QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQ RLEWMGWINPNSGGTNYAQKFQDRITVTRDTSSNTGYMELTRLRS DDTAVYYCARSPYSGVLDKWGQGTLVTVSS [SEQ ID NO: 57] DNA Caggtccagctggtacagtctggggctgaggtgaagaagcctggggcctcagtgaaggtctcctgcaag gcttctggatacaccttcaccgactactatatgcactgggtgcgacaggcccctggacaacggcttgagtg gatgggatggatcaaccctaacagtggtggcacaaactatgcacagaagtttcaggacaggatcaccgtg accagggacacctccagcaacacaggctacatggagctgaccaggctgagatctgacgacacggccgt gtattactgtgcgcgctctccgtactctggtgttctggataaatggggtcaaggtactctggtgaccgtctcct ca [SEQ ID NO: 59] Full V.sub.L QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGFDVHWYQQLPGTAP KLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQS YDSSLSGYVFGTGTKVTVLG [SEQ ID NO: 58] DNA Cagtctgtgctgacgcagccgccctcagtgtctggggccccagggcagagggtcaccatctcctgcact gggagcagctccaacatcggggcaggttttgatgtacactggtaccagcagcttccaggaacagccccc aaactcctcatctatggtaacagcaatcggccctcaggggtccctgaccgattctctggctccaagtctggc acctcagcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgac agcagcctgagtggttatgtcttcggaactgggaccaaggtcaccgtcctaggt [SEQ ID NO: 60] scFv QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGFDVHWYQQLPGTAP KLLIYGNSNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQS YDSSLSGYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAQVQ LVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQRLE WMGWINPNSGGTNYAQKFQDRITVTRDTSSNTGYMELTRLRSDD TAVYYCARSPYSGVLDKWGQGTLVTVSS [SEQ ID NO: 86]
[0142] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO: 87 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-187 scFv (also referred to as ET140-37 scFv).
[0143] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 16. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:61, as shown in Table 16. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:61, as shown in Table 16. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:62, as shown in Table 16. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:62, as shown in Table 16. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:61 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:62, as shown in Table 16. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:179 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 180 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 181 or conservative modifications thereof, as shown in Table 16. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 182 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 183 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 184 or conservative modifications thereof, as shown in Table 16. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 179 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 180 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 181 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 182 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 183 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 184 or conservative modifications thereof, as shown in Table 16. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 179, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 180, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 181, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 182, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 183 and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 184.
TABLE-US-00021 TABLE 16 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GGTFSSYA [SEQ ID IIPILGTA [SEQ ID ARSGYGSYRWEDS NO: 179] NO: 180] [SEQ ID NO: 181] V.sub.L SSNIGSNY [SEQ ID SNN [SEQ ID NO: AAWDDSLSASYV NO: 182] 183] [SEQ ID NO: 184] Full V.sub.H QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQG LEWMGRIIPILGTANYAQKFQGRVTITADESTSTAYMELSSLRSED TAVYYCARSGYGSYRWEDSWGQGTLVTVSS [SEQ ID NO: 61] DNA Caggtgcagctggtgcagtctggggctgaggtgaagaagcctgggtcctcggtgaaggtctcctgcaa ggcttctggaggcaccttcagcagctatgctatcagctgggtgcgacaggcccctggacaagggcttga gtggatgggaaggatcatccctatccttggtacagcaaactacgcacagaagttccagggcagagtcac gattaccgcggacgaatccacgagcacagcctacatggagctgagcagcctgagatctgaggacacgg ccgtgtattactgtgcgcgctctggttacggttcttaccgttgggaagattcttggggtcaaggtactctggt gaccgtctcctca [SEQ ID NO: 63] Full V.sub.L QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVFWYQQLPGTAPK LLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAW DDSLSASYVFGTGTKVTVLG [SEQ ID NO: 62] DNA Caggctgtgctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatctcttgttct ggaagcagctccaacatcggaagtaattacgtattctggtaccagcagctcccaggaacggcccccaaa ctcctcatctatagtaataatcagcggccctcaggggtccctgaccgattctctggctccaagtctggcacc tcagcctccctggccatcagtgggctccggtccgaggatgaggctgattattactgtgcagcatgggatg acagcctgagtgcctcttatgttttcggaactgggaccaaggtcaccgtcctaggt [SEQ ID NO: 64] scFv QAVLTQPPSASGTPGQRVTISCSGSSSNIGSNYVFWYQQLPGTAPK LLIYSNNQRPSGVPDRFSGSKSGTSASLAISGLRSEDEADYYCAAW DDSLSASYVFGTGTKVTVLGSRGGGGSGGGGSGGGGSLEMAQVQ LVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEW MGRIIPILGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAV YYCARSGYGSYRWEDSWGQGTLVTVSS [SEQ ID NO: 87]
[0144] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises the amino acid sequence of SEQ ID NO:88 and specifically binds to a BCMA polypeptide (e.g., a BCMA polypeptide having the amino acid sequence SEQ ID NO:71, or fragments thereof), which is designated as ET140-174 scFv (also referred to as ET140-24 scFv).
[0145] In certain embodiments, the extracellular antigen-binding domain is a human scFv, which comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 17. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:65, as shown in Table 17. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:65, as shown in Table 17. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:66, as shown in Table 17. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:66, as shown in Table 17. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:65 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:66, as shown in Table 17. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:185 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 186 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 187 or conservative modifications thereof, as shown in Table 17. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 188 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 189 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 190 or conservative modifications thereof, as shown in Table 17. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 185 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 186 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 187 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 188 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 189 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 190 or conservative modifications thereof, as shown in Table 17. In certain embodiments, the extracellular antigen-binding domain comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 185, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 186, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 187, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO: 188, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO: 189, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO: 190.
TABLE-US-00022 TABLE 17 Antigen A BCMA polypeptide having the amino acid sequence of SEQ ID NO: 71 CDRs 1 2 3 V.sub.H GYSFTSYW [SEQ ID IYPGDSDT [SEQ ID ARYSGSFDN [SEQ NO: 185] NO: 186] ID NO: 187] V.sub.L SSNIGSHS [SEQ ID TNN [SEQ ID NO: AAWDGSLNGLV NO: 188] 189] [SEQ ID NO: 190] Full V.sub.H EVQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKG LEWMGIIYPGDSDTRYSPSFQGHVTISADKSISTAYLQWSSLKASD TAMYYCARYSGSFDNWGQGTLVTVSS [SEQ ID NO: 65] DNA Gaggtgcagctggtgcagtctggagcagaggtgaaaaagcccggggagtctctgaagatctcctgta agggttctggatacagctttaccagctactggatcggctgggtgcgccagatgcccgggaaaggcctg gagtggatggggatcatctatcctggtgactctgataccagatacagcccgtccttccaaggccacgtca ccatctcagctgacaagtccatcagcactgcctacctgcagtggagcagcctgaaggcctcggacacc gccatgtattactgtgcgcgctactctggttctttcgataactggggtcaaggtactctggtgaccgtctcct ca [SEQ ID NO: 67] Full V.sub.L SYELTQPPSASGTPGQRVTMSCSGTSSNIGSHSVNWYQQLPGTAP KLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCA AWDGSLNGLVFGGGTKLTVLG [SEQ ID NO: 66] DNA Tcctatgagctgactcagccaccctcagcgtctgggacccccgggcagagggtcaccatgtcttgttct ggaaccagctccaacatcggaagtcactctgtaaactggtaccagcagctcccaggaacggcccccaa actcctcatctatactaataatcagcggccctcaggggtccctgaccgattctctggctccaagtctggca cctcagcctccctggccatcagtggcctccagtctgaggatgaggctgattattactgtgcagcatggga tggcagcctgaatggtctggtattcggcggagggaccaagctgaccgtcctaggt [SEQ ID NO: 68] scFv SYELTQPPSASGTPGQRVTMSCSGTSSNIGSHSVNWYQQLPGTAP KLLIYTNNQRPSGVPDRFSGSKSGTSASLAISGLQSEDEADYYCA AWDGSLNGLVFGGGTKLTVLGSRGGGGSGGGGSGGGGSLEMAE VQLVQSGAEVKKPGESLKISCKGSGYSFTSYWIGWVRQMPGKGL EWMGIIYPGDSDTRYSPSFQGHVTISADKSISTAYLQWSSLKASDT AMYYCARYSGSFDNWGQGTLVTVSS [SEQ ID NO: 88]
[0146] An extracellular antigen-binding domain (e.g., scFv) comprising V.sub.H and/or V.sub.L regions having high (i.e., 80% or greater) homology to the V.sub.H and V.sub.L regions of the sequences set forth above, can be obtained by mutagenesis (e.g., site-directed or PCR-mediated mutagenesis), followed by testing of the encoded altered scFv for retained function (i.e., the binding affinity) using the binding assays described herein. In certain embodiments, a V.sub.H sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identity contains substitutions (e.g., conservative substitutions to generate conservative modifications of a sequence), insertions or deletions relative to the reference sequence, but an extracellular antigen-binding domain (e.g., scFv) comprising that sequence retains the ability to bind to a BCMA polypeptide. In certain embodiments, a V.sub.L sequence having at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity contains substitutions (e.g., conservative substitutions), insertions or deletions relative to the reference sequence, but an extracellular antigen-binding domain (e.g., scFv) comprising that sequence retains the ability to bind to a BCMA polypeptide. In certain embodiments, a total of about 1 to about 10 amino acids have been substituted, inserted and/or deleted in the disclosed sequences. For example, and not by way of limitation, a V.sub.H sequence or a V.sub.L sequence, can have up to about one, up to about two, up to about three, up to about four, up to about five, up to about six, up to about seven, up to about eight, up to about nine or up to about ten amino acid residues that are modified and/or substituted. Non-limiting examples of conservative modifications are provided below, e.g., within Table 18.
[0147] As used herein, the term conservative sequence modifications refers to amino acid modifications that do not significantly affect or alter the binding characteristics of the presently disclosed CAR (e.g., the extracellular antigen-binding domain) comprising the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into the human scFv of the presently disclosed subject matter by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Amino acids can be classified into groups according to their physicochemical properties such as charge and polarity. Conservative amino acid substitutions are ones in which the amino acid residue is replaced with an amino acid within the same group. For example, amino acids can be classified by charge: positively-charged amino acids include lysine, arginine, histidine, negatively-charged amino acids include aspartic acid, glutamic acid, neutral charge amino acids include alanine, asparagine, cysteine, glutamine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, serine, threonine, tryptophan, tyrosine, and valine. In addition, amino acids can be classified by polarity: polar amino acids include arginine (basic polar), asparagine, aspartic acid (acidic polar), glutamic acid (acidic polar), glutamine, histidine (basic polar), lysine (basic polar), serine, threonine, and tyrosine; non-polar amino acids include alanine, cysteine, glycine, isoleucine, leucine, methionine, phenylalanine, proline, tryptophan, and valine. Thus, one or more amino acid residues within a CDR region can be replaced with other amino acid residues from the same group and the altered antibody can be tested for retained function (i.e., the functions set forth in (c) through (l) above) using the functional assays described herein. In certain embodiments, no more than one, no more than two, no more than three, no more than four, no more than five residues within a specified sequence or a CDR region are altered. Exemplary conservative amino acid substitutions are shown in Table 18.
TABLE-US-00023 TABLE 18 Exemplary conservative amino acid Original Residue Substitutions Ala (A) Val; Leu; Ile Arg (R) Lys; Gln; Asn Asn (N) Gln; His; Asp, Lys; Arg Asp (D) Glu; Asn Cys (C) Ser; Ala Gln (Q) Asn; Glu Glu (E) Asp; Gln Gly (G) Ala His (H) Asn; Gln; Lys; Arg Ile (I) Leu; Val; Met; Ala; Phe Leu (L) Ile; Val; Met; Ala; Phe Lys (K) Arg; Gln; Asn Met (M) Leu; Phe; Ile Phe (F) Trp; Leu; Val; Ile; Ala; Tyr Pro (P) Ala Ser (S) Thr Thr (T) Val; Ser Trp (W) Tyr; Phe Tyr (Y) Trp; Phe; Thr; Ser Val (V) Ile; Leu; Met; Phe; Ala
[0148] In certain non-limiting embodiments, an extracellular antigen-binding domain of the CAR can comprise a linker connecting the heavy chain variable region and light chain variable region of the extracellular antigen-binding domain. As used herein, the term linker refers to a functional group (e.g., chemical or polypeptide) that covalently attaches two or more polypeptides or nucleic acids so that they are connected to one another. As used herein, a peptide linker refers to one or more amino acids used to couple two proteins together (e.g., to couple V.sub.H and V.sub.L domains). Non-limiting examples of peptide linkers are disclosed in Shen et al., Anal. Chem. 80(6):1910-1917 (2008) and WO 2014/087010.
[0149] In one non-limiting example, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the nucleotide sequence encoding the amino acid sequence of SEQ ID NO:69 is set forth in SEQ ID NO:70. In one non-limiting example, the linker is a G45 linker that comprises amino acids having the sequence set forth in SEQ ID NO:210. In certain embodiments, the nucleotide sequence encoding the amino acid sequence of SEQ ID NO:98 is set forth in SEQ ID NO:211.
[0150] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:212 as provided below.
TABLE-US-00024 8 SEQ ID NO: 212] GGGGS.
[0151] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:213 as provided below.
TABLE-US-00025 [SEQ ID NO: 213] SGGSGGS.
[0152] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:214 as provided below.
TABLE-US-00026 [SEQ ID NO: 214] GGGGSGGGS.
[0153] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:215 as provided below.
TABLE-US-00027 [SEQ ID NO: 215] GGGGSGGGGS.
[0154] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:216 as provided below.
TABLE-US-00028 [SEQ ID NO: 216] GGGGSGGGGSGGGGGGGS.
[0155] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:217 as provided below.
TABLE-US-00029 [SEQ ID NO: 217] GGGGSGGGGSGGGGSGGGGS.
[0156] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:218 as provided below.
TABLE-US-00030 [SEQ ID NO: 218] GGGGSGGGGSGGGGSGGGGSGGGGS.
[0157] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:219 as provided below.
TABLE-US-00031 [SEQ ID NO: 219] GGGGSGGGGSGGGGSGGGGSGGGGSGGGGS.
[0158] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:220 as provided below.
TABLE-US-00032 [SEQ ID NO: 220] GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGS.
[0159] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:220 as provided below.
TABLE-US-00033 [SEQ ID NO: 220] EPKSCDKTHTCPPCP.
[0160] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:221 as provided below.
TABLE-US-00034 [SEQ ID NO: 222] GGGGSGGGSEPKSCDKTHTCPPCP.
[0161] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:223 as provided below.
TABLE-US-00035 [SEQ ID NO: 223] ELKTPLGDTTHTCPRCPEPKSCDTPPPCPRCPEPKSCDTPPPCPRCPEPK SCDTPPPCPRCP.
[0162] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:224 as provided below.
TABLE-US-00036 [SEQ ID NO: 224] GSGSGS.
[0163] In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:225 as provided below.
TABLE-US-00037 [SEQ ID NO: 225] AAA.
[0164] In addition, the extracellular antigen-binding domain can comprise a leader or a signal peptide that directs the nascent protein into the endoplasmic reticulum. Signal peptide or leader can be essential if the CAR is to be glycosylated and anchored in the cell membrane. The signal sequence or leader can be a peptide sequence (about 5, about 10, about 15, about 20, about 25, or about 30 amino acids long) present at the N-terminus of newly synthesized proteins that directs their entry to the secretory pathway. In non-limiting examples, the signal peptide is covalently joined to the 5 terminus of the extracellular antigen-binding domain. In certain embodiments, the signal peptide comprises a CD8 polypeptide comprising amino acids having the sequence set forth in SEQ ID NO:191 as provided below.
TABLE-US-00038 [SEQ ID NO: 191] MALPVTALLLPLALLLHAAR
[0165] The nucleotide sequence encoding the amino acid sequence of SEQ ID NO:191 is set forth in SEQ ID NO:192, which is provided below:
TABLE-US-00039 [SEQ ID NO: 192] ATGGCTCTCCCAGTGACTGCCCTACTGCTTCCCCTAGCGCTTCTCCTGCA TGCAGCTCGT
[0166] In another embodiment, the signal peptide comprises amino acids having the sequence set forth in SEQ ID NO:205 as provided below.
TABLE-US-00040 [SEQ ID NO: 205] METDTLLLWVLLLWVPGSTG
[0167] The nucleotide sequence encoding the amino acid sequence of SEQ ID NO:205 is set forth in SEQ ID NO:206, which is provided below:
TABLE-US-00041 [SEQ ID NO: 206] ATGGAAACCGACACCCTGCTGCTGTGGGTGCTGCTGCTGTGGGTGCCAGG ATCCACAGGA
[0168] In certain embodiments, the human scFv comprises a heavy chain variable region, a light chain variable region, a linker peptide between the heavy chain variable region and the light chain variable region, and an His-tag and an HA-tag. In certain embodiments, the amino acid sequence of the His-tag and HA-tag comprises the amino acid sequence of SEQ ID NO:275, which is provided below:
TABLE-US-00042 [SEQ ID NO: 275] TSGQAGQHHHHHHGAYPYDVPDYAS
[0169] The nucleotide sequence encoding SEQ ID NO: 275 is SEQ ID NO: 276, which is provided below:
TABLE-US-00043 [SEQ ID NO: 276] ACTAGTGGCCAGGCCGGCCAGCACCATCACCATCACCATGGCGCATACCC GTACGACGTTCCGGACTACGCTTCT
[0170] In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) binds to a human BCMA polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 71. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) binds to one or more portion of the amino acid sequence set forth in SEQ ID NO: 71. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) binds to one, two, three, four, five, six, or seven epitope region selected from the group consisting of amino acids 8-22, 9-23, 10-24, 11-25, 12-26, 13-27, 14-28 and 8-28 of SEQ ID NO: 71. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:9 and a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:10, optionally with (iii) a linker sequence, for example a linker peptide, between the heavy chain variable region and the light chain variable region. In certain embodiments, the linker comprises amino acids having the sequence set forth in SEQ ID NO:69. In certain embodiments, the extracellular antigen-binding domain that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 is a human scFv with V.sub.H and V.sub.L regions or CDRs selected from Table 6. In certain embodiments, the extracellular antigen-binding domain that binds to amino acids 14-22 of SEQ ID NO: 71 comprises is a human scFv-Fc fusion protein or full length human IgG with V.sub.H and V.sub.L regions or CDRs selected from Table 6. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 comprises a V.sub.H comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:21. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:21. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 comprises a V.sub.L comprising an amino acid sequence that is at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% homologous to the amino acid sequence set forth in SEQ ID NO:22. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 comprises a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:22. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 comprises a V.sub.H comprising amino acids having the sequence set forth in SEQ ID NO:21 and a V.sub.L comprising amino acids having the sequence set forth in SEQ ID NO:22. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:119 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:120 or conservative modifications thereof, and a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:121 or conservative modifications thereof. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 comprises a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:122 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:123 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:124 or conservative modifications thereof. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:119 or conservative modifications thereof, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:120 or conservative modifications thereof, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:121 or conservative modifications thereof, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:122 or conservative modifications thereof, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:123 or conservative modifications thereof, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:124 or conservative modifications thereof. In certain embodiments, the extracellular antigen-binding domain (e.g., a human scFv) that binds to an epitope region comprising amino acids 14-22 of SEQ ID NO: 71 comprises a V.sub.H CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:119, a V.sub.H CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:120, a V.sub.H CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:121, a V.sub.L CDR1 comprising amino acids having the sequence set forth in SEQ ID NO:122, a V.sub.L CDR2 comprising amino acids having the sequence set forth in SEQ ID NO:123, and a V.sub.L CDR3 comprising amino acids having the sequence set forth in SEQ ID NO:124. In certain embodiments, the extracellular antigen-binding domain is ET140-3 (or ET140-153) scFv.
[0171] Transmembrane Domain of a CAR
[0172] In certain non-limiting embodiments, the transmembrane domain of the CAR comprises a hydrophobic alpha helix that spans at least a portion of the membrane. Different transmembrane domains result in different receptor stability. After antigen recognition, receptors cluster and a signal is transmitted to the cell. In accordance with the presently disclosed subject matter, the transmembrane domain of the CAR can comprise a CD8 polypeptide, a CD28 polypeptide, a CD3? polypeptide, a CD4 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a CTLA-4 polypeptide, a PD-1 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof.
[0173] In certain embodiments, the transmembrane domain of a presently disclosed CAR comprises a CD28 polypeptide. The CD28 polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or 100% homologous to the sequence having a NCBI Reference No: P10747 or NP_006130 (SEQ ID No:193), or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions. In certain embodiments, the CD28 polypeptide can have an amino acid sequence that is a consecutive portion of SEQ ID NO: 193 which is at least 20, or at least 30, or at least 40, or at least 50, and up to 220 amino acids in length. Alternatively or additionally, in non-limiting various embodiments, the CD28 polypeptide has an amino acid sequence of amino acids 1 to 220, 1 to 50, 50 to 100, 100 to 150, 150 to 200, or 200 to 220 of SEQ ID NO: 193. In certain embodiments, the CAR of the presently disclosed comprises a transmembrane domain comprising a CD28 polypeptide, and an intracellular domain comprising a co-stimulatory signaling region that comprises a CD28 polypeptide. In certain embodiments, the CD28 polypeptide comprised in the transmembrane domain and the intracellular domain has an amino acid sequence of amino acids 114 to 220 of SEQ ID NO: 193.
[0174] SEQ ID NO: 193 is provided below:
TABLE-US-00044 [SEQ ID NO: 193] 1 MLRLLLALNL FPSIQVTGNK ILVKQSPMLV AYDNAVNLSC KYSYNLFSRE FRASLHKGLD 61 SAVEVCVVYG NYSQQLQVYS KTGFNCDGKL GNESVTFYLQ NLYVNQTDIY FCKIEVMYPP 121 PYLDNEKSNG TIIHVKGKHL CPSPLFPGPS KPFWVLVVVG GVLACYSLLV TVAFIIFWVR 181 SKRSRLLHSD YMNMTPRRPG PTRKHYQPYA PPRDFAAYRS
[0175] In accordance with the presently disclosed subject matter, a CD28 nucleic acid molecule refers to a polynucleotide encoding a CD28 polypeptide. In certain embodiments, the CD28 nucleic acid molecule encoding the CD28 polypeptide comprised in the transmembrane domain and the intracellular domain (e.g., the co-stimulatory signaling region) of the presently disclosed CAR (amino acids 114 to 220 of SEQ ID NO: 193) comprises nucleic acids having the sequence set forth in SEQ ID NO: 194 as provided below.
TABLE-US-00045 [SEQ ID NO: 194] ATTGAAGTTATGTATCCTCCTCCTTACCTAGACAATGAGAAGAGCAATGG AACCATTATCCATGTGAAAGGGAAACACCTTTGTCCAAGTCCCCTATTTC CCGGACCTTCTAAGCCCTTTTGGGTGCTGGTGGTGGTTGGTGGAGTCCTG GCTTGCTATAGCTTGCTAGTAACAGTGGCCTTTATTATTTTCTGGGTGAG GAGTAAGAGGAGCAGGCTCCTGCACAGTGACTACATGAACATGACTCCCC GCCGCCCCGGGCCCACCCGCAAGCATTACCAGCCCTATGCCCCACCACGC GACTTCGCAGCCTATCGCTCC
[0176] In certain embodiments, the transmembrane domain of a presently disclosed CAR comprises a CD8 polypeptide. The CD8 polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or 100% homologous to the sequence having a NCBI Reference No: AAH25715 (SEQ ID No:226), or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions. In non-limiting embodiments, the CD8 polypeptide can have an amino acid sequence that is a consecutive portion of SEQ ID NO: 226 which is at least 20, or at least 30, or at least 40, or at least 50, or at least 70, or at least 100, or at least 150, or at least 200 and up to 235 amino acids in length. Alternatively or additionally, in non-limiting various embodiments, the CD28 polypeptide has an amino acid sequence of amino acids 1 to 235, 1 to 50, 50 to 100, 100 to 150, 150 to 200, 130 to 210, or 200 to 235 of SEQ ID NO: 226. In certain embodiments, the CD8 polypeptide comprised in the transmembrane domain has an amino acid sequence of amino acids 137 to 207 of SEQ ID NO: 226.
[0177] SEQ ID NO: 226 is provided below:
TABLE-US-00046 [SEQ ID NO: 226] 1 MALPVTALLL PLALLLHAAR PSQFRVSPLD RTWNLGETVE LKCQVLLSNP TSGCSWLFQP 61 RGAAASPTFL LYLSQNKPKA AEGLDTQRFS GKRLGDTFVL TLSDFRRENE GCYFCSALSN 121 SIMYFSHFVP VFLPAKPTTT PAPRPPTPAP TIASQPLSLR PEACRPAAGG AVHTRGLDFA 181 CDIYIWAPLA GTCGVLLLSL VITLYCNHRN RRRVCKCPRP VVKSGDKPSL SARYV.
[0178] In accordance with the presently disclosed subject matter, a CD8 nucleic acid molecule refers to a polynucleotide encoding a CD8 polypeptide. In certain embodiments, the CD8 nucleic acid molecule encoding the CD8 polypeptide comprised in the transmembrane domain of the presently disclosed CAR (amino acids 137 to 207 of SEQ ID NO: 226) comprises nucleic acids having the sequence set forth in SEQ ID NO: 227 as provided below.
TABLE-US-00047 [SEQ ID NO: 227] CCCACCACGACGCCAGCGCCGCGACCACCAACCCCGGCGCCCACGATCGC GTCGCAGCCCCTGTCCCTGCGCCCAGAGGCGTGCCGGCCAGCGGCGGGGG GCGCAGTGCACACGAGGGGGCTGGACTTCGCCTGTGATATCTACATCTGG GCGCCCCTGGCCGGGACTTGTGGGGTCCTTCTCCTGTCACTGGTTATCAC CCTTTACTGCAAC
[0179] In certain non-limiting embodiments, a CAR can also comprise a spacer region that links the extracellular antigen-binding domain to the transmembrane domain. The spacer region can be flexible enough to allow the antigen binding domain to orient in different directions to facilitate antigen recognition. The spacer region can be the hinge region from IgG1, or the CH.sub.2CH.sub.3 region of immunoglobulin and portions of CD3.
[0180] Intracellular Domain of a CAR
[0181] In certain non-limiting embodiments, an intracellular domain of the CAR can comprise a CD3? polypeptide, which can activate or stimulate a cell (e.g., a cell of the lymphoid lineage, e.g., a T cell). CD3? comprises three ITAMs, and transmits an activation signal to the cell (e.g., a cell of the lymphoid lineage, e.g., a T cell) after antigen is bound. The CD3? polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% homologous to the sequence set forth in SEQ ID NO: 195, or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions. In non-limiting embodiments, the CD3? polypeptide can have an amino acid sequence that is a consecutive portion of SEQ ID NO: 195 which is at least 20, or at least 30, or at least 40, or at least 50, and up to 163 amino acids in length. Alternatively or additionally, in non-limiting various embodiments, the CD3? polypeptide has an amino acid sequence of amino acids 1 to 163, 1 to 50, 50 to 100, 100 to 150, or 150 to 163 of SEQ ID NO: 195. In certain embodiments, the CD3? polypeptide comprised in the intracellular domain of a presently disclosed CAR has an amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195.
[0182] SEQ ID NO: 195 is provided below:
TABLE-US-00048 [SEQ ID NO: 195] 1 MKWKALFTAA ILQAQLPITE AQSFGLLDPK LCYLLDGILF IYGVILTALF LRVKFSRSAD 61 APAYQQGQNQ LYNELNLGRR EEYDVLDKRR GRDPEMGGKP RRKNPQEGLY NELQKDKMAE 121 AYSEIGMKGE RRRGKGHDGL YQGLSTATKD TYDALHMQAL PPR
[0183] In accordance with the presently disclosed subject matter, a CD3? nucleic acid molecule refers to a polynucleotide encoding a CD3? polypeptide. In certain embodiments, the CD3? nucleic acid molecule encoding the CD3? polypeptide comprised in the intracellular domain of a presently disclosed CARs (amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195) comprises nucleic acids having the sequence set forth in SEQ ID NO:196 as provided below.
TABLE-US-00049 [SEQ ID NO: 196] AGAGTGAAGTTCAGCAGGAGCGCAGACGCCCCCGCGTACCAGCAGGGCCA GAACCAGCTCTATAACGAGCTCAATCTAGGACGAAGAGAGGAGTACGATG TTTTGGACAAGAGACGTGGCCGGGACCCTGAGATGGGGGGAAAGCCGAGA AGGAAGAACCCTCAGGAAGGCCTGTACAATGAACTGCAGAAAGATAAGAT GGCGGAGGCCTACAGTGAGATTGGGATGAAAGGCGAGCGCCGGAGGGGCA AGGGGCACGATGGCCTTTACCAGGGTCTCAGTACAGCCACCAAGGACACC TACGACGCCCTTCACATGCAGGCCCTGCCCCCTCGCTAA
[0184] In certain non-limiting embodiments, an intracellular domain of the CAR further comprises at least one signaling region. The at least one signaling region can include a CD28 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP-10 polypeptide, a PD-1 polypeptide, a CTLA-4 polypeptide, a LAG-3 polypeptide, a 2B4 polypeptide, a BTLA polypeptide, a synthetic peptide (not based on a protein associated with the immune response), or a combination thereof.
[0185] In certain embodiments, the signaling region is a co-stimulatory signaling region. In certain embodiments, the co-stimulatory region comprises at least one co-stimulatory molecule, which can provide optimal lymphocyte activation. As used herein, co-stimulatory molecules refer to cell surface molecules other than antigen receptors or their ligands that are required for an efficient response of lymphocytes to antigen. The at least one co-stimulatory signaling region can include a CD28 polypeptide, a 4-1BB polypeptide, an OX40 polypeptide, an ICOS polypeptide, a DAP-10 polypeptide, or a combination thereof. The co-stimulatory molecule can bind to a co-stimulatory ligand, which is a protein expressed on cell surface that upon binding to its receptor produces a co-stimulatory response, i.e., an intracellular response that effects the stimulation provided when an antigen binds to its CAR molecule. Co-stimulatory ligands, include, but are not limited to CD80, CD86, CD70, OX40L, 4-1BBL, CD48, TNFRSF14, and PD-L1. As one example, a 4-1BB ligand (i.e., 4-1BBL) may bind to 4-1BB (also known as CD137) for providing an intracellular signal that in combination with a CAR signal induces an effector cell function of the CAR.sup.+ T cell. CARs comprising an intracellular domain that comprises a co-stimulatory signaling region comprising 4-1BB, ICOS or DAP-10 are disclosed in U.S. Pat. No. 7,446,190 (e.g., the nucleotide sequence encoding 4-1BB is set forth in SEQ ID NO:15, the nucleotide sequence encoding ICOS is set forth in SEQ ID NO:16, and the nucleotide sequence encoding DAP-10 is set forth in SEQ ID NO:17 in U.S. Pat. No. 7,446,190), which is herein incorporated by reference in its entirety. In certain embodiments, the intracellular domain of the CAR comprises a co-stimulatory signaling region that comprises a CD28 polypeptide. In certain embodiments, the intracellular domain of the CAR comprises a co-stimulatory signaling region that comprises two co-stimulatory molecules:CD28 and 4-1BB or CD28 and OX40.
[0186] 4-1BB can act as a tumor necrosis factor (TNF) ligand and have stimulatory activity. The 4-1BB polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or 100% homologous to the sequence having a NCBI Reference No: P41273 or NP_001552 (SEQ ID NO:197) or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions. In certain embodiments, the 4-1BB polypeptide comprised in the intracellular domain of a presently disclosed CAR has an amino acid sequence of amino acids 214-255 of SEQ ID NO: 197.
[0187] SEQ ID NO: 197 is provided below:
TABLE-US-00050 [SEQ ID NO: 197] 1 MGNSCYNIVA TLLLVLNFER TRSLQDPCSN CPAGTFCDNN RNQICSPCPP NSFSSAGGQR 61 TCDICRQCKG VFRTRKECSS TSNAECDCTP GFHCLGAGCS MCEQDCKQGQ ELTKKGCKDC 121 CFGTFNDQKR GICRPWTNCS LDGKSVLVNG TKERDVVCGP SPADLSPGAS SVTPPAPARE 181 PGHSPQIISF FLALTSTALL FLLFFLTLRF SVVKRGRKKL LYIFKQPFMR PVQTTQEEDG 241 CSCRFPEEEE GGCEL
[0188] In accordance with the presently disclosed subject matter, a 4-1BB nucleic acid molecule refers to a polynucleotide encoding a 4-1BB polypeptide. In certain embodiments, the 4-1BB nucleic acid molecule encoding the 4-1BB polypeptide comprised in the intracellular domain of a presently disclosed CARs (amino acids 214-255 of SEQ ID NO: 197) comprises nucleic acids having the sequence set forth in SEQ ID NO: 228 as provided below.
TABLE-US-00051 [SEQ ID NO: 228] aaacggggcagaaagaagctcctgtatatattcaaacaaccatttatgag accagtacaaactactcaagaggaagatggctgtagctgccgatttccag aagaagaagaaggaggatgtgaactg
[0189] An OX40 polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or 100% homologous to the sequence having a NCBI Reference No: P43489 or NP_003318 (SEQ ID NO: 198), or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions.
[0190] SEQ ID NO: 198 is provided below:
TABLE-US-00052 [SEQ ID NO: 198] 1 MCVGARRLGR GPCAALLLLG LGLSTVTGLH CVGDTYPSND RCCHECRPGN GMVSRCSRSQ 61 NTVCRPCGPG FYNDVVSSKP CKPCTWCNLR SGSERKQLCT ATQDTVCRCR AGTQPLDSYK 121 PGVDCAPCPP GHFSPGDNQA CKPWTNCTLA GKHTLQPASN SSDAICEDRD PPATQPQETQ 181 GPPARPITVQ PTEAWPRTSQ GPSTRPVEVP GGRAVAAILG LGLVLGLLGP LAILLALYLL 241 RRDQRLPPDA HKPPGGGSFR TPIQEEQADA HSTLAKI
[0191] In accordance with the presently disclosed subject matter, an OX40 nucleic acid molecule refers to a polynucleotide encoding an OX40 polypeptide.
[0192] An ICOS polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or 100% homologous to the sequence having a NCBI Reference No: NP_036224 (SEQ ID NO: 199) or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions.
[0193] SEQ ID NO: 199 is provided below:
TABLE-US-00053 [SEQ ID NO: 199] 1 MKSGLWYFFL FCLRIKVLTG EINGSANYEM FIFHNGGVQI LCKYPDIVQQ FKMQLLKGGQ 61 ILCDLTKTKG SGNTVSIKSL KFCHSQLSNN SVSFFLYNLD HSHANYYFCN LSIFDPPPFK 121 VTLTGGYLHI YESQLCCQLK FWLPIGCAAF VVVCILGCIL ICWLTKKKYS SSVHDPNGEY 181 MFMRAVNTAK KSRLTDVTL
[0194] In accordance with the presently disclosed subject matter, an ICOS nucleic acid molecule refers to a polynucleotide encoding an ICOS polypeptide.
[0195] CTLA-4 is an inhibitory receptor expressed by activated T cells, which when engaged by its corresponding ligands (CD80 and CD86; B7-1 and B7-2, respectively), mediates activated T cell inhibition or anergy. In both preclinical and clinical studies, CTLA-4 blockade by systemic antibody infusion, enhanced the endogenous anti-tumor response albeit, in the clinical setting, with significant unforeseen toxicities.
[0196] CTLA-4 contains an extracellular V domain, a transmembrane domain, and a cytoplasmic tail. Alternate splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. The intracellular domain is similar to that of CD28, in that it has no intrinsic catalytic activity and contains one YVKM motif able to bind PI3K, PP2A and SHP-2 and one proline-rich motif able to bind SH3 containing proteins. One role of CTLA-4 in inhibiting T cell responses seem to be directly via SHP-2 and PP2A dephosphorylation of TCR-proximal signaling proteins such as CD3 and LAT. CTLA-4 can also affect signaling indirectly via competing with CD28 for CD80/86 binding. CTLA-4 has also been shown to bind and/or interact with PI3K, CD80, AP2M1, and PPP2R5A.
[0197] In accordance with the presently disclosed subject matter, a CTLA-4 polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% homologous to UniProtKB/Swiss-Prot Ref. No.: P16410.3 (SEQ ID NO: 200) (homology herein may be determined using standard software such as BLAST or FASTA) or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions.
[0198] SEQ ID NO: 200 is provided below:
TABLE-US-00054 [SEQ ID NO: 200] 1 MACLGFQRHK AQLNLATRTW PCTLLFFLLF IPVFCKAMHV AQPAVVLASS RGIASFVCEY 61 ASPGKATEVR VTVLRQADSQ VTEVCAATYM MGNELTFLDD SICTGTSSGN QVNLTIQGLR 121 AMDTGLYICK VELMYPPPYY LGIGNGTQIY VIDPEPCPDS DFLLWILAAV SSGLFFYSFL 181 LTAVSLSKML KKRSPLTTGV YVKMPPTEPE CEKQFQPYFI PIN
[0199] In accordance with the presently disclosed subject matter, a CTLA-4 nucleic acid molecule refers to a polynucleotide encoding a CTLA-4 polypeptide.
[0200] PD-1 is a negative immune regulator of activated T cells upon engagement with its corresponding ligands PD-L1 and PD-L2 expressed on endogenous macrophages and dendritic cells. PD-1 is a type I membrane protein of 268 amino acids. PD-1 has two ligands, PD-L1 and PD-L2, which are members of the B7 family. The protein's structure comprises an extracellular IgV domain followed by a transmembrane region and an intracellular tail. The intracellular tail contains two phosphorylation sites located in an immunoreceptor tyrosine-based inhibitory motif and an immunoreceptor tyrosine-based switch motif, that PD-1 negatively regulates TCR signals. SHP-I and SHP-2 phosphatases bind to the cytoplasmic tail of PD-1 upon ligand binding. Upregulation of PD-L1 is one mechanism tumor cells may evade the host immune system. In pre-clinical and clinical trials, PD-1 blockade by antagonistic antibodies induced anti-tumor responses mediated through the host endogenous immune system.
[0201] In accordance with the presently disclosed subject matter, a PD-1 polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% homologous to NCBI Reference No: NP_005009.2 (SEQ ID NO: 201) or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions.
[0202] SEQ ID NO: 201 is provided below:
TABLE-US-00055 [SEQ ID NO: 201] 1 MQIPQAPWPV VWAVLQLGWR PGWFLDSPDR PWNPPTFSPA LLVVTEGDNA TFTCSFSNTS 61 ESFVLNWYRM SPSNQTDKLA AFPEDRSQPG QDCRFRVTQL PNGRDFHMSV VRARRNDSGT 121 YLCGAISLAP KAQIKESLRA ELRVTERRAE VPTAHPSPSP RPAGQFQTLV VGVVGGLLGS 181 LVLLVWVLAV ICSRAARGTI GARRTGQPLK EDPSAVPVFS VDYGELDFQW REKTPEPPVP 241 CVPEQTEYAT IVFPSGMGTS SPARRGSADG PRSAQPLRPE DGHCSWPL
[0203] In accordance with the presently disclosed subject matter, a PD-1 nucleic acid molecule refers to a polynucleotide encoding a PD-1 polypeptide.
[0204] Lymphocyte-activation protein 3 (LAG-3) is a negative immune regulator of immune cells. LAG-3 belongs to the immunoglobulin (1 g) superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. LAG3 has also been designated CD223 (cluster of differentiation 223).
[0205] In accordance with the presently disclosed subject matter, a LAG-3 polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% homologous to UniProtKB/Swiss-Prot Ref. No.: P18627.5 (SEQ ID NO: 202) or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions.
[0206] SEQ ID NO: 202 is provided below:
TABLE-US-00056 [SEQ ID NO: 202] 1 MWEAQFLGLL FLQPLWVAPV KPLQPGAEVP VVWAQEGAPA QLPCSPTIPL QDLSLLRRAG 61 VTWQHQPDSG PPAAAPGHPL APGPHPAAPS SWGPRPRRYT VLSVGPGGLR SGRLPLQPRV 121 QLDERGRQRG DFSLWLRPAR RADAGEYRAA VHLRDRALSC RLRLRLGQAS MTASPPGSLR 181 ASDWVILNCS FSRPDRPASV HWFRNRGQGR VPVRESPHHH LAESFLFLPQ VSPMDSGPWG 241 CILTYRDGFN VSIMYNLTVL GLEPPTPLTV YAGAGSRVGL PCRLPAGVGT RSFLTAKWTP 301 PGGGPDLLVT GDNGDFTLRL EDVSQAQAGT YTCHIHLQEQ QLNATVTLAI ITVTPKSFGS 361 PGSLGKLLCE VTPVSGQERF VWSSLDTPSQ RSFSGPWLEA QEAQLLSQPW QCQLYQGERL 421 LGAAVYFTEL SSPGAQRSGR APGALPAGHL LLFLILGVLS LLLLVTGAFG FHLWRRQWRP 481 RRFSALEQGI HPPQAQSKIE ELEQEPEPEP EPEPEPEPEP EPEQL
[0207] In accordance with the presently disclosed subject matter, a LAG-3 nucleic acid molecule refers to a polynucleotide encoding a LAG-3 polypeptide.
[0208] Natural Killer Cell Receptor 2B4 (2B4) mediates non-MHC restricted cell killing on NK cells and subsets of T cells. To date, the function of 2B4 is still under investigation, with the 2B4-S isoform believed to be an activating receptor, and the 2B4-L isoform believed to be a negative immune regulator of immune cells. 2B4 becomes engaged upon binding its high-affinity ligand, CD48. 2B4 contains a tyrosine-based switch motif, a molecular switch that allows the protein to associate with various phosphatases. 2B4 has also been designated CD244 (cluster of differentiation 244).
[0209] In accordance with the presently disclosed subject matter, a 2B4 polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% homologous to UniProtKB/Swiss-Prot Ref. No.: Q9BZW8.2 (SEQ ID NO: 203) or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions.
[0210] SEQ ID NO: 203 is provided below:
TABLE-US-00057 [SEQ ID NO: 203] 1 MLGQVVTLIL LLLLKVYQGK GCQGSADHVV SISGVPLQLQ PNSIQTKVDS IAWKKLLPSQ 61 NGFHHILKWE NGSLPSNTSN DRFSFIVKNL SLLIKAAQQQ DSGLYCLEVT SISGKVQTAT 121 FQVFVFESLL PDKVEKPRLQ GQGKILDRGR CQVALSCLVS RDGNVSYAWY RGSKLIQTAG 181 NLTYLDEEVD INGTHTYTCN VSNPVSWESH TLNLTQDCQN AHQEFRFWPF LVIIVILSAL 241 FLGTLACFCV WRRKRKEKQS ETSPKEFLTI YEDVKDLKTR RNHEQEQTFP GGGSTIYSMI 301 QSQSSAPTSQ EPAYTLYSLI QPSRKSGSRK RNHSPSFNST IYEVIGKSQP KAQNPARLSR 361 KELENFDVYS
[0211] In accordance with the presently disclosed subject matter, a 2B4 nucleic acid molecule refers to a polynucleotide encoding a 2B4 polypeptide.
[0212] B- and T-lymphocyte attenuator (BTLA) expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 and CTLA4, BTLA interacts with a B7 homolog, B7H4. However, unlike PD-1 and CTLA-4, BTLA displays T-Cell inhibition via interaction with tumor necrosis family receptors (TNF-R), not just the B7 family of cell surface receptors. BTLA is a ligand for tumor necrosis factor (receptor) superfamily, member 14 (TNFRSF14), also known as herpes virus entry mediator (HVEM). BTLA-HVEM complexes negatively regulate T-cell immune responses. BTLA activation has been shown to inhibit the function of human CD8.sup.+ cancer-specific T cells. BTLA has also been designated as CD272 (cluster of differentiation 272).
[0213] In accordance with the presently disclosed subject matter, a BTLA polypeptide can have an amino acid sequence that is at least about 85%, about 90%, about 95%, about 96%, about 97%, about 98%, about 99% or about 100% homologous to UniProtKB/Swiss-Prot Ref. No.: Q7Z6A9.3 (SEQ ID NO: 204) or fragments thereof, and/or may optionally comprise up to one or up to two or up to three conservative amino acid substitutions.
[0214] SEQ ID NO: 204 is provided below:
TABLE-US-00058 [SEQ ID NO: 204] 1 MKTLPAMLGT GKLFWVFFLI PYLDIWNIHG KESCDVQLYI KRQSEHSILA GDPFELECPV 61 KYCANRPHVT WCKLNGTTCV KLEDRQTSWK EEKNISFFIL HFEPVLPNDN GSYRCSANFQ 121 SNLIESHSTT LYVTDVKSAS ERPSKDEMAS RPWLLYRLLP LGGLPLLITT CFCLFCCLRR 181 HQGKQNELSD TAGREINLVD AHLKSEQTEA STRQNSQVLL SETGIYDNDP DLCFRMQEGS 241 EVYSNPCLEE NKPGIVYASL NHSVIGPNSR LARNVKEAPT EYASICVRS
[0215] In accordance with the presently disclosed subject matter, a BTLA nucleic acid molecule refers to a polynucleotide encoding a BTLA polypeptide.
[0216] In certain embodiments, the CAR comprises an extracellular antigen-binding region that comprises a human scFv that specifically binds to human BCMA, a transmembrane domain comprising a CD28 polypeptide, and an intracellular domain comprising a CD3? polypeptide and a co-stimulatory signaling region that comprises a CD28 polypeptide, as shown in
[0217] In certain embodiments, the CAR comprises an extracellular antigen-binding region that comprises a human scFv that specifically binds to human BCMA, a transmembrane domain comprising a CD8 polypeptide, and an intracellular domain comprising a CD3? polypeptide and a co-stimulatory signaling region that comprises a 4-1BB polypeptide, as shown in
[0218] In certain embodiments, the CAR of the presently disclosed subject matter can further comprise an inducible promoter, for expressing nucleic acid sequences in human cells. Promoters for use in expressing CAR genes can be a constitutive promoter, such as ubiquitin C (UbiC) promoter.
[0219] The presently disclosed subject matter also provides isolated nucleic acid molecule encoding the BCMA-targeted CAR described herein or a functional portion thereof. In certain embodiments, the isolated nucleic acid molecule encodes a presently disclosed BCMA-targeted CAR comprising a human scFv that specifically binds to human BCMA, a transmembrane domain comprising a CD28 polypeptide, and an intracellular domain comprising a CD3? polypeptide and a co-stimulatory signaling region comprising a CD28 polypeptide. In one specific non-limiting example, the isolated nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:207 provided below:
TABLE-US-00059 [SEQ ID NO: 207] caatctgccctgactcagcctgcctccgtgtctgcgtctcctggacagtc gatcgccatctcctgcactggaaccagcagtgacgttggttggtatcaac agcacccaggcaaagcccccaaactcatgatttatgaggacagtaagcgg ccctcaggggtttctaatcgcttctctggctccaagtctggcaacacggc ctccctgaccatctctgggctccaggctgaggacgaggctgattattact gcagctcaaatacaagaagcagcactttggtgttcggcggagggaccaag ctgaccgtcctaggttctagaggtggtggtggtagcggcggcggcggctc tggtggtggtggatccctcgagatggccgaagtgcagctggtgcagtctg gggctgagatgaagaagcctggggcctcactgaagctctcctgcaaggct tctggatacaccttcatcgactactatgtatactggatgcgacaggcccc tggacaagggcttgagtccatgggatggatcaaccctaacagtggtggca caaactatgcacagaagtttcagggcagggtcaccatgaccagggacacg tccatcagcacagcctacatggagctgagcaggctgagatctgacgacac cgccatgtattactgtgcgcgctcccagcgtgacggttacatggattact ggggtcaaggtactctggtgaccgtctcctcagcggccgcaattgaagtt atgtatcctcctccttacctagacaatgagaagagcaatggaaccattat ccatgtgaaagggaaacacctttgtccaagtcccctatttcccggacctt ctaagcccttttgggtgctggtggtggttggtggagtcctggcttgctat agcttgctagtaacagtggcctttattattttctgggtgaggagtaagag gagcaggctcctgcacagtgactacatgaacatgactccccgccgccccg ggcccacccgcaagcattaccagccctatgccccaccacgcgacttcgca gcctatcgctccagagtgaagttcagcaggagcgcagacgcccccgcgta ccagcagggccagaaccagctctataacgagctcaatctaggacgaagag aggagtacgatgttttggacaagagacgtggccgggaccctgagatgggg ggaaagccgagaaggaagaaccctcaggaaggcctgtacaatgaactgca gaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagc gccggaggggcaaggggcacgatggcctttaccagggtctcagtacagcc accaaggacacctacgacgcccttcacatgcaggccctgccccctcgc
[0220] In one specific non-limiting example, the isolated nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:208 provided below:
TABLE-US-00060 [SEQ ID NO: 208] cagtctgtgctgacgcagccgccctcagtgtctggggccccagggcagag ggtcaccatctcctgcactgggagcagctccaacatcggggcaggttttg atgtacactggtaccagcagcttccaggaacagcccccaaactcctcatc tatggtaacagcaatcggccctcaggggtccctgaccgattctctggctc caagtctggcacctcagcctccctggccatcactgggctccaggctgagg atgaggctgattattactgccagtcctatgacagcagcctgagtggttat gtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtggtgg tggtagcggcggcggcggctctggtggtggtggatccctcgagatggccc aggtccagctggtacagtctggggctgaggtgaagaagcctggggcctca gtgaaggtctcctgcaaggcttctggatacaccttcaccgactactatat gcactgggtgcgacaggcccctggacaacggcttgagtggatgggatgga tcaaccctaacagtggtggcacaaactatgcacagaagtttcaggacagg atcaccgtgaccagggacacctccagcaacacaggctacatggagctgac caggctgagatctgacgacacggccgtgtattactgtgcgcgctctccgt actctggtgttctggataaatggggtcaaggtactctggtgaccgtctcc tcagcggccgcaattgaagttatgtatcctcctccttacctagacaatga gaagagcaatggaaccattatccatgtgaaagggaaacacctttgtccaa gtcccctatttcccggaccttctaagcccttttgggtgctggtggtggtt ggtggagtcctggcttgctatagcttgctagtaacagtggcctttattat tttctgggtgaggagtaagaggagcaggctcctgcacagtgactacatga acatgactccccgccgccccgggcccacccgcaagcattaccagccctat gccccaccacgcgacttcgcagcctatcgctccagagtgaagttcagcag gagcgcagacgcccccgcgtaccagcagggccagaaccagctctataacg agctcaatctaggacgaagagaggagtacgatgttttggacaagagacgt ggccgggaccctgagatggggggaaagccgagaaggaagaaccctcagga aggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtg agattgggatgaaaggcgagcgccggaggggcaaggggcacgatggcctt taccagggtctcagtacagccaccaaggacacctacgacgcccttcacat gcaggccctgccccctcgc
[0221] In one specific non-limiting example, the isolated nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:209 provided below:
TABLE-US-00061 [SEQ ID NO: 209] tcctatgagctgactcagccaccctcagcgtctgggacccccgggcagag ggtcaccatgtcttgttctggaaccagctccaacatcggaagtcactctg taaactggtaccagcagctcccaggaacggcccccaaactcctcatctat actaataatcagcggccctcaggggtccctgaccgattctctggctccaa gtctggcacctcagcctccctggccatcagtggcctccagtctgaggatg aggctgattattactgtgcagcatgggatggcagcctgaatggtctggta ttcggcggagggaccaagctgaccgtcctaggttctagaggtggtggtgg tagcggcggcggcggctctggtggtggtggatccctcgagatggccgagg tgcagctggtgcagtctggagcagaggtgaaaaagcccggggagtctctg aagatctcctgtaagggttctggatacagctttaccagctactggatcgg ctgggtgcgccagatgcccgggaaaggcctggagtggatggggatcatct atcctggtgactctgataccagatacagcccgtccttccaaggccacgtc accatctcagctgacaagtccatcagcactgcctacctgcagtggagcag cctgaaggcctcggacaccgccatgtattactgtgcgcgctactctggtt ctttcgataactggggtcaaggtactctggtgaccgtctcctcagcggcc gcaattgaagttatgtatcctcctccttacctagacaatgagaagagcaa tggaaccattatccatgtgaaagggaaacacctttgtccaagtcccctat ttcccggaccttctaagcccttttgggtgctggtggtggttggtggagtc ctggcttgctatagcttgctagtaacagtggcctttattattttctgggt gaggagtaagaggagcaggctcctgcacagtgactacatgaacatgactc cccgccgccccgggcccacccgcaagcattaccagccctatgccccacca cgcgacttcgcagcctatcgctccagagtgaagttcagcaggagcgcaga cgcccccgcgtaccagcagggccagaaccagctctataacgagctcaatc taggacgaagagaggagtacgatgttttggacaagagacgtggccgggac cctgagatggggggaaagccgagaaggaagaaccctcaggaaggcctgta caatgaactgcagaaagataagatggcggaggcctacagtgagattggga tgaaaggcgagcgccggaggggcaaggggcacgatggcctttaccagggt ctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccct gccccctcgc
[0222] In one specific non-limiting example, the isolated nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:229 provided below:
TABLE-US-00062 [SEQ ID NO: 229] CCTTCTCTAGGCGCCCCCATATGGCCATATGAGATCTTATATGGGGCACCCCCGCCCCTTGTAAACTTCCCTGACCCTGA CATGACAAGAGTTACTAACAGCCCCTCTCTCCAAGCTCACTTACAGGCTCTCTACTTAGTCCAGCACGAAGTCTGGAGAC CTCTGGCGGCAGCCTACCAAGAACAACTGGACCGACCGGTGCCGCCACCATGGAAACCGACACCCTGCTGCTGTGGGTGC TGCTGCTGTGGGTGCCAGGATCCACAGGACTGCCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGG GTCACCATCTCTTGTTCTGGACGCAGTTCCAACATCGGGAGTAATTCTGTTAACTGGTATCGACAACTCCCAGGAGCGGC CCCCAAACTCCTCATCTATAGTAATAATCAGCGGCCCCCAGGGGTCCCTGTGCGATTCTCTGGCTCCAAGTCTGGCACCT CAGCCTCCCTGGCCATCAGTGGGCTCCAGTCTGAAGATGAGGCCACTTATTACTGTGCAACATGGGATGACAATCTGAAT GTTCACTATGTCTTCGGAACTGGGACCAAGGTCACCGTCCTAGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTC TGGTGGTGGTGGATCCCTCGAGATGGCCCAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGG TGAAGGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGG CTTGAGTGGATGGGAAGGATCATCCCTATCCTTGGTATAGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTAC CGCGGACAAATCCACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGC GCGGTGGTTACTACTCTCATGACATGTGGTCTGAAGATTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCAGCggccgca cccaccacgacgccagcgccgcgaccaccaaccccggcgcccacgatcgcgtcgcagcccctgtccctgcgcccagaggc gtgccggccagcggcggggggcgcagtgcacacgagggggctggacttcgcctgtgatatctacatctgggcgcccctgg ccgggacttgtggggtccttctcctgtcactggttatcaccctttactgcaacaaacggggcagaaagaagctcctgtat atattcaaacaaccatttatgagaccagtacaaactactcaagaggaagatggctgtagctgccgatttccagaagaaga agaaggaggatgtgaactgagagtgaagttgagcaggagcgcagagccccccgcgtaccagcagggccagaaccagctct ataacgagctcaatctaggacgaagagaggagtacgatgttttggacaagagacgtggccgggaccctgagatgggggga aagccgagaaggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagat tgggatgaaaggcgagcgccggaggggcaaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacct acgacgcccttcacatgcaggccctgccccctcgctaacagccactcgaggatccggattagtccaatttgttaaagaca ggatatcagtggtccaggctctagttttgactcaacaatatcaccagctgaagcctatagagtacgagccatagataaaa taaaagattttatttagtctccagaaaaaggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaac gccattttgcaaggcatggaaaaatacataactgagaatagagaagttcagatcaaggtcaggaacagatggaacagctg aatatgggccaaacaggatatctgtggtaagcagttcctgccccggctcagggccaagaacagatggaacagctgaatat gggccaaacaggatatctgtggtaagcagttcctgccccggctcagggccaagaacagatggtccccagatgcggtccag ccctcagcagtttctagagaaccatcagatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaac taaccaatcagttcgcttctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcccacaacccctcact cggggcgccagtcctccgattgactgagtcgcccgggtacccgtgtatccaataaaccctcttgcagttgcatccgactt gtggtctcgctgttccttgggagggtctcctctgagtgattgactacccgtcagcgggggtctttcacacatgcagcatg tatcaaaattaatttggttttttttcttaagtatttacattaaatggccatagtacttaaagttacattggcttccttga aataaacatggagtattcagaatgtgtcataaatatttctaattttaagatagtatctccattggctttctactttttct tttatttttttttgtcctctgtcttccatttgttgttgttgttgtttgtttgtttgtttgttggttggttggttaatttt tttttaaagatcctacactatagttcaagctagactattagctactctgtaacccagggtgaccttgaagtcatgggtag cctgctgttttagccttcccacatctaagattacaggtatgagctatcatttttggtatattgattgattgattgattga tgtgtgtgtgtgtgattgtgtttgtgtgtgtgactgtgaaaatgtgtgtatgggtgtgtgtgaatgtgtgtatgtatgtg tgtgtgtgagtgtgtgtgtgtgtgtgtgcatgtgtgtgtgtgtgactgtgtctatgtgtatgactgtgtgtgtgtgtgtg tgtgtgtgtgtgtgtgtgtgtgtgtgtgtgttgtgaaaaaatattctatggtagtgagagccaacgctccggctcaggtg tcaggttggtttttgagacagagtctttcacttagcttggAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAA ACCCTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACC GATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGG TATTTCACACCGCATATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGCCCCGACACCCGCCAA CACCCGCTGACGCGCCCTGACGGGCTTGTCTGCTCCCGGCATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGC ATGTGTCAGAGGTTTTCACCGTCATCACCGAAACGCGCGATGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTA ATGTCATGATAATAATGGTTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTT TTCTAAATACATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAG TATGAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAA CGCTGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAG ATCCTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATC CCGTATTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCA CAGAAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCC AACTTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCT TGATCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGTAGCAATGGCAACAA CGTTGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAA GTTGCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTC TCGCGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAA CTATGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTAC TCATATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCAT GACCAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATC CTTTTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAG CTACCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTT AGGCCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTG GCGATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGT TCGTGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCATTGAGAAAGCGCCAC GCTTCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAG GGGGAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCA GGGGGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACAT GTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCC GAACGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGG CCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTA GCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAAT TTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTTTGCTCTTAGGAGTTTCCTAATACATCCCAAACTCAAATA TATAAAGCATTTGACTTGTTCTATGCCCTAGGGGGCGGGGGGAAGCTAAGCCAGCTTTTTTTAACATTTAAAATGTTAAT TCCATTTTAAATGCACAGATGTTTTTATTTCATAAGGGTTTCAATGTGCATGAATGCTGCAATATTCCTGTTACCAAAGC TAGTATAAATAAAAATAGATAAACGTGGAAATTACTTAGAGTTTCTGTCATTAACGTTTCCTTCCTCAGTTGACAACATA AATGCGCTGCTGAGCAAGCCAGTTTGCATCTGTCAGGATCAATTTCCCATTATGCCAGTCATATTAATTACTAGTCAATT AGTTGATTTTTATTTTTGACATATACATGTGAATGAAAGACCCCACCTGTAGGTTTGGCAAGCTAGCTTAAGTAACGCCA TTTTGCAAGGCATGGAAAAATACATAACTGAGAATAGAAAAGTTCAGATCAAGGTCAGGAACAGATGGAACAGCTGAATA TGGGCCAAACAGGATATCTGTGGTAAGCAGTTCCTGCCCCGGCTCAGGGCCAAGAACAGATGGAACAGCTGAATATGGGC CAAACAGGATATCTGTGGTAAGCAGTTCCTGCCCCGGCTCAGGGCCAAGAACAGATGGTCCCCAGATGCGGTCCAGCCCT CAGCAGTTTCTAGAGAACCATCAGATGTTTCCAGGGTGCCCCAAGGACCTGAAATGACCCTGTGCCTTATTTGAACTAAC CAATCAGTTCGCTTCTCGCTTCTGTTCGCGCGCTTATGCTCCCCGAGCTCAATAAAAGAGCCCACAACCCCTCACTCGGG GCGCCAGTCCTCCGATTGACTGAGTCGCCCGGGTACCCGTGTATCCAATAAACCCTCTTGCAGTTGCATCCGACTTGTGG TCTCGCTGTTCCTTGGGAGGGTCTCCTCTGAGTGATTGACTACCCGTCAGCGGGGGTCTTTCATTTGGGGGCTCGTCCGG GATCGGGAGACCCCTGCCCAGGGACCACCGACCCACCACCGGGAGGTAAGCTGGCCAGCAACTTATCTGTGTCTGTCCGA TTGTCTAGTGTCTATGACTGATTTTATGCGCCTGCGTCGGTACTAGTTAGCTAACTAGCTCTGTATCTGGCGGACCCGTG GTGGAACTGACGAGTTCGGAACACCCGGCCGCAACCCTGGGAGACGTCCCAGGGACTTCGGGGGCCGTTTTTGTGGCCCG ACCTGAGTCCTAAAATCCCGATCGTTTAGGACTCTTTGGTGCACCCCCCTTAGAGGAGGGATATGTGGTTCTGGTAGGAG ACGAGAACCTAAAACAGTTCCCGCCTCCGTCTGAATTTTTGCTTTCGGTTTGGGACCGAAGCCGCGCCGCGCGTCTTGTC TGCTGCAGCATCGTTCTGTGTTGTCTCTGTCTGACTGTGTTTCTGTATTTGTCTGAAAATATGGGCCCGGGCTAGACTGT TACCACTCCCTTAAGTTTGACCTTAGGTCACTGGAAAGATGTCGAGCGGATCGCTCACAACCAGTCGGTAGATGTCAAGA AGAGACGTTGGGTTACCTTCTGCTCTGCAGAATGGCCAACCTTTAACGTCGGATGGCCGCGAGACGGCACCTTTAACCGA GACCTCATCACCCAGGTTAAGATCAAGGTCTTTTCACCTGGCCCGCATGGACACCCAGACCAGGTCCCCTACATCGTGAC CTGGGAAGCCTTGGCTTTTGACCCCCCTCCCTGGGTCAAGCCCTTTGTACACCCTAAGCCTCCGCCTCCTCTTCCTCCAT CCGCCCCGTCTCTCCCCCTTGAACCTCCTCGTTCGACCCCGCCTCGATCCTCCCTTTATCCAGCCCTCACT
[0223] In one specific non-limiting example, the isolated nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:230 provided below:
TABLE-US-00063 [SEQ ID NO: 230] GGCCCTCTAGGCGCCCCCATATGGCCATATGAGATCTTATATGGGGCACCCCCGCCCCTTGTAAACTTCCCTGACCCTGA CATGACAAGAGTTACTAACAGCCCCTCTCTCCAAGCTCACTTACAGGCTCTCTACTTAGTCCAGCACGAAGTCTGGAGAC CTCTGGCGGCAGCCTACCAAGAACAACTGGACCGACCGGTGCCGCCACCATGGAAACCGACACCCTGCTGCTGTGGGTGC TGCTGCTGTGGGTGCCAGGATCCACAGGAtcctatgagctgactcagccaccctcagcgtctgggacccccgggcagagg gtcaccatgtcttgttctggaaccagctccaacatcggaagtcactctgtaaactggtaccagcagctcccaggaacggc ccccaaactcctcatctatactaataatcagcggccctcaggggtccctgaccgattctctggctccaagtctggcacct cagcctccctggccatcagtggcctccagtctgaggatgaggctgattattactgtgcagcatgggatggcagcctgaat ggtctggtattcggcggagggaccaagctgaccgtcctaggttctagaggtggtggtggtagcggcggcggcggctctgg tggtggtggatccctcgagatggccgaggtgcagctggtgcagtctggagcagaggtgaaaaagcccggggagtctctga agatctcctgtaagggttctggatacagctttaccagctactggatcggctgggtgcgccagatgcccgggaaaggcctg gagtggatggggatcatctatcctggtgactctgataccagatacagcccgtccttccaaggccacgtcaccatctcagc tgacaagtccatcagcactgcctacctgcagtggagcagcctgaaggcctcggacaccgccatgtattactgtgcgcgct actctggttctttcgataactggggtcaaggtactctggtgaccgtctcctcagcggccgcacccaccacgacgccagcg ccgcgaccaccaaccccggcgcccacgatcgcgtcgcagcccctgtccctgcgcccagaggcgtgccggccagcggcggg gggcgcagtgcacacgagggggctggacttcgcctgtgatatctacatctgggcgcccctggccgggacttgtggggtcc ttctcctgtcactggttatcaccctttactgcaacaaacggggcagaaagaagctcctgtatatattcaaacaaccattt atgagaccagtacaaactactcaagaggaagatggctgtagctgccgatttccagaagaagaagaaggaggatgtgaact gagagtgaagttcaggaggagcgcagagccccccgcgtaccaggagggccagaaccagctctataacgagctcaatctag gacgaagagaggagtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaagccgagaaggaagaac cctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcg ccggaggggcaaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgc aggccctgccccctcgctaacagccactcgaggatccggattagtccaatttgttaaagacaggatatcagtggtccagg ctctagttttgactcaacaatatcaccagctgaagcctatagagtacgagccatagataaaataaaagattttatttagt ctccagaaaaaggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgccattttgcaaggcatg gaaaaatacataactgagaatagagaagttcagatcaaggtcaggaacagatggaacagctgaatatgggccaaacagga tatctgtggtaagcagttcctgccccggctcagggccaagaacagatggaacagctgaatatgggccaaacaggatatct gtggtaaggagttcctgccccggctcagggccaagaacagatggtccccagatgcggtccagccctcaggagtttctaga gaaccatcagatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaaccaatcagttcgctt ctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcccacaacccctcactcggggcgccagtcctccg attgactgagtcgcccgggtacccgtgtatccaataaaccctcttgcagttgcatccgacttgtggtctcgctgttcctt gggagggtctcctctgagtgattgactacccgtcagcgggggtctttcacacatgcagcatgtatcaaaattaatttggt tttttttcttaagtatttacattaaatggccatagtacttaaagttacattggcttccttgaaataaacatggagtattc agaatgtgtcataaatatttctaattttaagatagtatctccattggctttctactttttcttttatttttttttgtcct ctgtcttccatttgttgttgttgttgtttgtttgtttgtttgttggttggttggttaatttttttttaaagatcctacac tatagttcaagctagactattagctactctgtaacccagggtgaccttgaagtcatgggtagcctgctgttttagccttc ccacatctaagattacaggtatgagctatcatttttggtatattgattgattgattgattgatgtgtgtgtgtgtgattg tgtttgtgtgtgtgactgtgaaaatgtgtgtatgggtgtgtgtgaatgtgtgtatgtatgtgtgtgtgtgagtgtgtgtg tgtgtgtgtgcatgtgtgtgtgtgtgactgtgtctatgtgtatgactgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtg tgtgtgtgtgtgttgtgaaaaaatattctatggtagtgagagccaacgctccggctcaggtgtcaggttggtttttgaga cagagtctttcacttagcttggAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAAC TTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAG TTGCGCAGCCTGAATGGCGAATGGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATATG GTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGCCCCGACACCCGCCAACACCCGCTGACGCGCCCT GACGGGCTTGTCTGCTCCCGGCATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATGTGTCAGAGGTTTTCA CCGTCATCACCGAAACGCGCGATGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGG TTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAAT ATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTT CCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAG ATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGC CCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTATTGACGCCGGGCA AGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGG ATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACG ATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGA GCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGTAGCAATGGCAACAACGTTGCGCAAACTATTAA CTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTG CGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGC ACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATA GACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATT GATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACG TGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAA TCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCG AAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAA CTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTA CCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGC TTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCATTGAGAAAGCGCCACGCTTCCCGAAGGGAGAAA GGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATC TTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGG AAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATC CCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCG AGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGC TGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACC CCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCT ATGACCATGATTACGCCAAGCTTTGCTCTTAGGAGTTTCCTAATACATCCCAAACTCAAATATATAAAGCATTTGACTTG TTCTATGCCCTAGGGGGCGGGGGGAAGCTAAGCCAGCTTTTTTTAACATTTAAAATGTTAATTCCATTTTAAATGCACAG ATGTTTTTATTTCATAAGGGTTTCAATGTGCATGAATGCTGCAATATTCCTGTTACCAAAGCTAGTATAAATAAAAATAG ATAAACGTGGAAATTACTTAGAGTTTCTGTCATTAACGTTTCCTTCCTCAGTTGACAACATAAATGCGCTGCTGAGCAAG CCAGTTTGCATCTGTCAGGATCAATTTCCCATTATGCCAGTCATATTAATTACTAGTCAATTAGTTGATTTTTATTTTTG ACATATACATGTGAATGAAAGACCCCACCTGTAGGTTTGGCAAGCTAGCTTAAGTAACGCCATTTTGCAAGGCATGGAAA AATACATAACTGAGAATAGAAAAGTTCAGATCAAGGTCAGGAACAGATGGAACAGCTGAATATGGGCCAAACAGGATATC TGTGGTAAGCAGTTCCTGCCCCGGCTCAGGGCCAAGAACAGATGGAACAGCTGAATATGGGCCAAACAGGATATCTGTGG TAAGCAGTTCCTGCCCCGGCTCAGGGCCAAGAACAGATGGTCCCCAGATGCGGTCCAGCCCTCAGCAGTTTCTAGAGAAC CATCAGATGTTTCCAGGGTGCCCCAAGGACCTGAAATGACCCTGTGCCTTATTTGAACTAACCAATCAGTTCGCTTCTCG CTTCTGTTCGCGCGCTTATGCTCCCCGAGCTCAATAAAAGAGCCCACAACCCCTCACTCGGGGCGCCAGTCCTCCGATTG ACTGAGTCGCCCGGGTACCCGTGTATCCAATAAACCCTCTTGCAGTTGCATCCGACTTGTGGTCTCGCTGTTCCTTGGGA GGGTCTCCTCTGAGTGATTGACTACCCGTCAGCGGGGGTCTTTCATTTGGGGGCTCGTCCGGGATCGGGAGACCCCTGCC CAGGGACCACCGACCCACCACCGGGAGGTAAGCTGGCCAGCAACTTATCTGTGTCTGTCCGATTGTCTAGTGTCTATGAC TGATTTTATGCGCCTGCGTCGGTACTAGTTAGCTAACTAGCTCTGTATCTGGCGGACCCGTGGTGGAACTGACGAGTTCG GAACACCCGGCCGCAACCCTGGGAGACGTCCCAGGGACTTCGGGGGCCGTTTTTGTGGCCCGACCTGAGTCCTAAAATCC CGATCGTTTAGGACTCTTTGGTGCACCCCCCTTAGAGGAGGGATATGTGGTTCTGGTAGGAGACGAGAACCTAAAACAGT TCCCGCCTCCGTCTGAATTTTTGCTTTCGGTTTGGGACCGAAGCCGCGCCGCGCGTCTTGTCTGCTGCAGCATCGTTCTG TGTTGTCTCTGTCTGACTGTGTTTCTGTATTTGTCTGAAAATATGGGCCCGGGCTAGACTGTTACCACTCCCTTAAGTTT GACCTTAGGTCACTGGAAAGATGTCGAGCGGATCGCTCACAACCAGTCGGTAGATGTCAAGAAGAGACGTTGGGTTACCT TCTGCTCTGCAGAATGGCCAACCTTTAACGTCGGATGGCCGCGAGACGGCACCTTTAACCGAGACCTCATCACCCAGGTT AAGATCAAGGTCTTTTCACCTGGCCCGCATGGACACCCAGACCAGGTCCCCTACATCGTGACCTGGGAAGCCTTGGCTTT TGACCCCCCTCCCTGGGTCAAGCCCTTTGTACACCCTAAGCCTCCGCCTCCTCTTCCTCCATCCGCCCCGTCTCTCCCCC TTGAACCTCCTCGTTCGACCCCGCCTCGATCCTCCCTTTATCCAGCCCTCACT
[0224] In one specific non-limiting example, the isolated nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:231 provided below:
TABLE-US-00064 [SEQ ID NO: 231] CCTTCTCTAGGCGCCCCCATATGGCCATATGAGATCTTATATGGGGCACCCCCGCCCCTTGTAAACTTCCCTGACCCTGA CATGACAAGAGTTACTAACAGCCCCTCTCTCCAAGCTCACTTACAGGCTCTCTACTTAGTCCAGCACGAAGTCTGGAGAC CTCTGGCGGCAGCCTACCAAGAACAACTGGACCGACCGGTGCCGCCACCATGGAAACCGACACCCTGCTGCTGTGGGTGC TGCTGCTGTGGGTGCCAGGATCCACAGGACAGGCTGTGCTGACTCAGCCACCCTCAGCGTCTGGGACCCCCGGGCAGAGG GTCACCATCTCTTGTTCTGGAAGCAGCTCCAACATCGGAAGTAATTACGTATTCTGGTACCAGCAGCTCCCAGGAACGGC CCCCAAACTCCTCATCTATAGTAATAATCAGCGGCCCTCAGGGGTCCCTGACCGATTCTCTGGCTCCAAGTCTGGCACCT CAGCCTCCCTGGCCATCAGTGGGCTCCGGTCCGAGGATGAGGCTGATTATTACTGTGCAGCATGGGATGACAGCCTGAGT GCCTCTTATGTTTTCGGAACTGGGACCAAGGTCACCGTCCTAGGTTCTAGAGGTGGTGGTGGTAGCGGCGGCGGCGGCTC TGGTGGTGGTGGATCCCTCGAGATGGCCCAGGTGCAGCTGGTGCAGTCTGGGGCTGAGGTGAAGAAGCCTGGGTCCTCGG TGAAGGTCTCCTGCAAGGCTTCTGGAGGCACCTTCAGCAGCTATGCTATCAGCTGGGTGCGACAGGCCCCTGGACAAGGG CTTGAGTGGATGGGAAGGATCATCCCTATCCTTGGTACAGCAAACTACGCACAGAAGTTCCAGGGCAGAGTCACGATTAC CGCGGACGAATCCACGAGCACAGCCTACATGGAGCTGAGCAGCCTGAGATCTGAGGACACGGCCGTGTATTACTGTGCGC GCTCTGGTTACGGTTCTTACCGTTGGGAAGATTCTTGGGGTCAAGGTACTCTGGTGACCGTCTCCTCAGCggccgcaccc accacgacgccagcgccgcgaccaccaaccccggcgcccacgatcgcgtcgcagcccctgtccctgcgcccagaggcgtg ccggccagcggcggggggcgcagtgcacacgagggggctggacttcgcctgtgatatctacatctgggcgcccctggccg ggacttgtggggtccttctcctgtcactggttatcaccctttactgcaacaaacggggcagaaagaagctcctgtatata ttcaaacaaccatttatgagaccagtacaaactactcaagaggaagatggctgtagctgccgatttccagaagaagaaga aggaggatgtgaactgagagtgaagttcaggaggagcgcagagccccccgcgtaccaggagggccagaaccagctctata acgagctcaatctaggacgaagagaggagtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaag ccgagaaggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgg gatgaaaggcgagcgccggaggggcaaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacg acgcccttcacatgcaggccctgccccctcgctaacagccactcgaggatccggattagtccaatttgttaaagacagga tatcagtggtccaggctctagttttgactcaacaatatcaccagctgaagcctatagagtacgagccatagataaaataa aagattttatttagtctccagaaaaaggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgcc attttgcaaggcatggaaaaatacataactgagaatagagaagttcagatcaaggtcaggaacagatggaacagctgaat atgggccaaacaggatatctgtggtaagcagttcctgccccggctcagggccaagaacagatggaacagctgaatatggg ccaaacaggatatctgtggtaagcagttcctgccccggctcagggccaagaacagatggtccccagatgcggtccagccc tcagcagtttctagagaaccatcagatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaa ccaatcagttcgcttctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcccacaacccctcactcgg ggcgccagtcctccgattgactgagtcgcccgggtacccgtgtatccaataaaccctcttgcagttgcatccgacttgtg gtctcgctgttccttgggagggtctcctctgagtgattgactacccgtcagcgggggtctttcacacatgcagcatgtat caaaattaatttggttttttttcttaagtatttacattaaatggccatagtacttaaagttacattggcttccttgaaat aaacatggagtattcagaatgtgtcataaatatttctaattttaagatagtatctccattggctttctactttttctttt atttttttttgtcctctgtcttccatttgttgttgttgttgtttgtttgtttgtttgttggttggttggttaattttttt ttaaagatcctacactatagttcaagctagactattagctactctgtaacccagggtgaccttgaagtcatgggtagcct gctgttttagccttcccacatctaagattacaggtatgagctatcatttttggtatattgattgattgattgattgatgt gtgtgtgtgtgattgtgtttgtgtgtgtgactgtgaaaatgtgtgtatgggtgtgtgtgaatgtgtgtatgtatgtgtgt gtgtgagtgtgtgtgtgtgtgtgtgcatgtgtgtgtgtgtgactgtgtctatgtgtatgactgtgtgtgtgtgtgtgtgt gtgtgtgtgtgtgtgtgtgtgtgtgtgttgtgaaaaaatattctatggtagtgagagccaacgctccggctcaggtgtca ggttggtttttgagacagagtctttcacttagcttggAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACC CTGGCGTTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGAT CGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTAT TTCACACCGCATATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGCCCCGACACCCGCCAACAC CCGCTGACGCGCCCTGACGGGCTTGTCTGCTCCCGGCATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATG TGTCAGAGGTTTTCACCGTCATCACCGAAACGCGCGATGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATG TCATGATAATAATGGTTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTC TAAATACATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTAT GAGTATTCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGC TGGTGAAAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATC CTTGAGAGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCG TATTGACGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAG AAAAGCATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAAC TTACTTCTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGA TCGTTGGGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGTAGCAATGGCAACAACGT TGCGCAAACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTT GCAGGACCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCG CGGTATCATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTA TGGATGAACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCA TATATACTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGAC CAAAATCCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTT TTTTTCTGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTA CCAACTCTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGG CCACCACTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCG ATAAGTCGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCG TGCACACAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCATTGAGAAAGCGCCACGCT TCCCGAAGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGG GAAACGCCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGG GGGCGGAGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTT CTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAA CGACCGAGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCG ATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCT CACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTC ACACAGGAAACAGCTATGACCATGATTACGCCAAGCTTTGCTCTTAGGAGTTTCCTAATACATCCCAAACTCAAATATAT AAAGCATTTGACTTGTTCTATGCCCTAGGGGGCGGGGGGAAGCTAAGCCAGCTTTTTTTAACATTTAAAATGTTAATTCC ATTTTAAATGCACAGATGTTTTTATTTCATAAGGGTTTCAATGTGCATGAATGCTGCAATATTCCTGTTACCAAAGCTAG TATAAATAAAAATAGATAAACGTGGAAATTACTTAGAGTTTCTGTCATTAACGTTTCCTTCCTCAGTTGACAACATAAAT GCGCTGCTGAGCAAGCCAGTTTGCATCTGTCAGGATCAATTTCCCATTATGCCAGTCATATTAATTACTAGTCAATTAGT TGATTTTTATTTTTGACATATACATGTGAATGAAAGACCCCACCTGTAGGTTTGGCAAGCTAGCTTAAGTAACGCCATTT TGCAAGGCATGGAAAAATACATAACTGAGAATAGAAAAGTTCAGATCAAGGTCAGGAACAGATGGAACAGCTGAATATGG GCCAAACAGGATATCTGTGGTAAGCAGTTCCTGCCCCGGCTCAGGGCCAAGAACAGATGGAACAGCTGAATATGGGCCAA ACAGGATATCTGTGGTAAGCAGTTCCTGCCCCGGCTCAGGGCCAAGAACAGATGGTCCCCAGATGCGGTCCAGCCCTCAG CAGTTTCTAGAGAACCATCAGATGTTTCCAGGGTGCCCCAAGGACCTGAAATGACCCTGTGCCTTATTTGAACTAACCAA TCAGTTCGCTTCTCGCTTCTGTTCGCGCGCTTATGCTCCCCGAGCTCAATAAAAGAGCCCACAACCCCTCACTCGGGGCG CCAGTCCTCCGATTGACTGAGTCGCCCGGGTACCCGTGTATCCAATAAACCCTCTTGCAGTTGCATCCGACTTGTGGTCT CGCTGTTCCTTGGGAGGGTCTCCTCTGAGTGATTGACTACCCGTCAGCGGGGGTCTTTCATTTGGGGGCTCGTCCGGGAT CGGGAGACCCCTGCCCAGGGACCACCGACCCACCACCGGGAGGTAAGCTGGCCAGCAACTTATCTGTGTCTGTCCGATTG TCTAGTGTCTATGACTGATTTTATGCGCCTGCGTCGGTACTAGTTAGCTAACTAGCTCTGTATCTGGCGGACCCGTGGTG GAACTGACGAGTTCGGAACACCCGGCCGCAACCCTGGGAGACGTCCCAGGGACTTCGGGGGCCGTTTTTGTGGCCCGACC TGAGTCCTAAAATCCCGATCGTTTAGGACTCTTTGGTGCACCCCCCTTAGAGGAGGGATATGTGGTTCTGGTAGGAGACG AGAACCTAAAACAGTTCCCGCCTCCGTCTGAATTTTTGCTTTCGGTTTGGGACCGAAGCCGCGCCGCGCGTCTTGTCTGC TGCAGCATCGTTCTGTGTTGTCTCTGTCTGACTGTGTTTCTGTATTTGTCTGAAAATATGGGCCCGGGCTAGACTGTTAC CACTCCCTTAAGTTTGACCTTAGGTCACTGGAAAGATGTCGAGCGGATCGCTCACAACCAGTCGGTAGATGTCAAGAAGA GACGTTGGGTTACCTTCTGCTCTGCAGAATGGCCAACCTTTAACGTCGGATGGCCGCGAGACGGCACCTTTAACCGAGAC CTCATCACCCAGGTTAAGATCAAGGTCTTTTCACCTGGCCCGCATGGACACCCAGACCAGGTCCCCTACATCGTGACCTG GGAAGCCTTGGCTTTTGACCCCCCTCCCTGGGTCAAGCCCTTTGTACACCCTAAGCCTCCGCCTCCTCTTCCTCCATCCG CCCCGTCTCTCCCCCTTGAACCTCCTCGTTCGACCCCGCCTCGATCCTCCCTTTATCCAGCCCTCACT
[0225] In one specific non-limiting example, the isolated nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:232 provided below:
TABLE-US-00065 [SEQ ID NO: 232] CCTTCTCTAGGCGCCCCCATATGGCCATATGAGATCTTATATGGGGCACCCCCGCCCCTTGTAAACTTCCCTGACCCTGA CATGACAAGAGTTACTAACAGCCCCTCTCTCCAAGCTCACTTACAGGCTCTCTACTTAGTCCAGCACGAAGTCTGGAGAC CTCTGGCGGCAGCCTACCAAGAACAACTGGACCGACCGGTGCCGCCACCATGGAAACCGACACCCTGCTGCTGTGGGTGC TGCTGCTGTGGGTGCCAGGATCCACAGGAcagtctgtgctgacgcagccgccctcagtgtctggggccccagggcagagg gtcaccatctcctgcactgggaggagctccaacatcggggcaggttttgatgtacactggtaccaggagcttccaggaac agcccccaaactcctcatctatggtaacagcaatcggccctcaggggtccctgaccgattctctggctccaagtctggca cctcagcctccctggccatcactgggctccaggctgaggatgaggctgattattactgccagtcctatgacagcagcctg agtggttatgtcttcggaactgggaccaaggtcaccgtcctaggttctagaggtggtggtggtagcggcggcggcggctc tggtggtggtggatccctcgagatggcccaggtccagctggtacagtctggggctgaggtgaagaagcctggggcctcag tgaaggtctcctgcaaggcttctggatacaccttcaccgactactatatgcactgggtgcgacaggcccctggacaacgg cttgagtggatgggatggatcaaccctaacagtggtggcacaaactatgcacagaagtttcaggacaggatcaccgtgac cagggacacctccagcaacacaggctacatggagctgaccaggctgagatctgacgacacggccgtgtattactgtgcgc gctctccgtactctggtgttctggataaatggggtcaaggtactctggtgaccgtctcctcagcggccgcacccaccacg acgccagcgccgcgaccaccaaccccggcgcccacgatcgcgtcgcagcccctgtccctgcgcccagaggcgtgccggcc agcggcggggggcgcagtgcacacgagggggctggacttcgcctgtgatatctacatctgggcgcccctggccgggactt gtggggtccttctcctgtcactggttatcaccctttactgcaacaaacggggcagaaagaagctcctgtatatattcaaa caaccatttatgagaccagtacaaactactcaagaggaagatggctgtagctgccgatttccagaagaagaagaaggagg atgtgaactgagagtgaagttcaggaggagcgcagagccccccgcgtaccaggagggccagaaccagctctataacgagc tcaatctaggacgaagagaggagtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaagccgaga aggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaa aggcgagcgccggaggggcaaggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgccc ttcacatgcaggccctgccccctcgctaacagccactcgaggatccggattagtccaatttgttaaagacaggatatcag tggtccaggctctagttttgactcaacaatatcaccagctgaagcctatagagtacgagccatagataaaataaaagatt ttatttagtctccagaaaaaggggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgccattttg caaggcatggaaaaatacataactgagaatagagaagttcagatcaaggtcaggaacagatggaacagctgaatatgggc caaacaggatatctgtggtaagcagttcctgccccggctcagggccaagaacagatggaacagctgaatatgggccaaac aggatatctgtggtaagcagttcctgccccggctcagggccaagaacagatggtccccagatgcggtccagccctcagca gtttctagagaaccatcagatgtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaaccaatc agttcgcttctcgcttctgttcgcgcgcttctgctccccgagctcaataaaagagcccacaacccctcactcggggcgcc agtcctccgattgactgagtcgcccgggtacccgtgtatccaataaaccctcttgcagttgcatccgacttgtggtctcg ctgttccttgggagggtctcctctgagtgattgactacccgtcagcgggggtctttcacacatgcagcatgtatcaaaat taatttggttttttttcttaagtatttacattaaatggccatagtacttaaagttacattggcttccttgaaataaacat ggagtattcagaatgtgtcataaatatttctaattttaagatagtatctccattggctttctactttttcttttattttt ttttgtcctctgtcttccatttgttgttgttgttgtttgtttgtttgtttgttggttggttggttaatttttttttaaag atcctacactatagttcaagctagactattagctactctgtaacccagggtgaccttgaagtcatgggtagcctgctgtt ttagccttcccacatctaagattacaggtatgagctatcatttttggtatattgattgattgattgattgatgtgtgtgt gtgtgattgtgtttgtgtgtgtgactgtgaaaatgtgtgtatgggtgtgtgtgaatgtgtgtatgtatgtgtgtgtgtga gtgtgtgtgtgtgtgtgtgcatgtgtgtgtgtgtgactgtgtctatgtgtatgactgtgtgtgtgtgtgtgtgtgtgtgt gtgtgtgtgtgtgtgtgtgtgttgtgaaaaaatattctatggtagtgagagccaacgctccggctcaggtgtcaggttgg tttttgagacagagtctttcacttagcttggAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCG TTACCCAACTTAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCT TCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACA CCGCATATGGTGCACTCTCAGTACAATCTGCTCTGATGCCGCATAGTTAAGCCAGCCCCGACACCCGCCAACACCCGCTG ACGCGCCCTGACGGGCTTGTCTGCTCCCGGCATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATGTGTCAG AGGTTTTCACCGTCATCACCGAAACGCGCGATGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGA TAATAATGGTTTCTTAGACGTCAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATA CATTCAAATATGTATCCGCTCATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTAT TCAACATTTCCGTGTCGCCCTTATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGA AAGTAAAAGATGCTGAAGATCAGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAG AGTTTTCGCCCCGAAGAACGTTTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTATTGA CGCCGGGCAAGAGCAACTCGGTCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGC ATCTTACGGATGGCATGACAGTAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTT CTGACAACGATCGGAGGACCGAAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTG GGAACCGGAGCTGAATGAAGCCATACCAAACGACGAGCGTGACACCACGATGCCTGTAGCAATGGCAACAACGTTGCGCA AACTATTAACTGGCGAACTACTTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGA CCACTTCTGCGCTCGGCCCTTCCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTAT CATTGCAGCACTGGGGCCAGATGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATG AACGAAATAGACAGATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATA CTTTAGATTGATTTAAAACTTCATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAAT CCCTTAACGTGAGTTTTCGTTCCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTC TGCGCGTAATCTGCTGCTTGCAAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACT CTTTTTCCGAAGGTAACTGGCTTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCA CTTCAAGAACTCTGTAGCACCGCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGT CGTGTCTTACCGGGTTGGACTCAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACA CAGCCCAGCTTGGAGCGAACGACCTACACCGAACTGAGATACCTACAGCGTGAGCATTGAGAAAGCGCCACGCTTCCCGA AGGGAGAAAGGCGGACAGGTATCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACG CCTGGTATCTTTATAGTCCTGTCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGG AGCCTATGGAAAAACGCCAGCAACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCC TGCGTTATCCCCTGATTCTGTGGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCG AGCGCAGCGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCAT TAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCA TTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAG GAAACAGCTATGACCATGATTACGCCAAGCTTTGCTCTTAGGAGTTTCCTAATACATCCCAAACTCAAATATATAAAGCA TTTGACTTGTTCTATGCCCTAGGGGGCGGGGGGAAGCTAAGCCAGCTTTTTTTAACATTTAAAATGTTAATTCCATTTTA AATGCACAGATGTTTTTATTTCATAAGGGTTTCAATGTGCATGAATGCTGCAATATTCCTGTTACCAAAGCTAGTATAAA TAAAAATAGATAAACGTGGAAATTACTTAGAGTTTCTGTCATTAACGTTTCCTTCCTCAGTTGACAACATAAATGCGCTG CTGAGCAAGCCAGTTTGCATCTGTCAGGATCAATTTCCCATTATGCCAGTCATATTAATTACTAGTCAATTAGTTGATTT TTATTTTTGACATATACATGTGAATGAAAGACCCCACCTGTAGGTTTGGCAAGCTAGCTTAAGTAACGCCATTTTGCAAG GCATGGAAAAATACATAACTGAGAATAGAAAAGTTCAGATCAAGGTCAGGAACAGATGGAACAGCTGAATATGGGCCAAA CAGGATATCTGTGGTAAGCAGTTCCTGCCCCGGCTCAGGGCCAAGAACAGATGGAACAGCTGAATATGGGCCAAACAGGA TATCTGTGGTAAGCAGTTCCTGCCCCGGCTCAGGGCCAAGAACAGATGGTCCCCAGATGCGGTCCAGCCCTCAGCAGTTT CTAGAGAACCATCAGATGTTTCCAGGGTGCCCCAAGGACCTGAAATGACCCTGTGCCTTATTTGAACTAACCAATCAGTT CGCTTCTCGCTTCTGTTCGCGCGCTTATGCTCCCCGAGCTCAATAAAAGAGCCCACAACCCCTCACTCGGGGCGCCAGTC CTCCGATTGACTGAGTCGCCCGGGTACCCGTGTATCCAATAAACCCTCTTGCAGTTGCATCCGACTTGTGGTCTCGCTGT TCCTTGGGAGGGTCTCCTCTGAGTGATTGACTACCCGTCAGCGGGGGTCTTTCATTTGGGGGCTCGTCCGGGATCGGGAG ACCCCTGCCCAGGGACCACCGACCCACCACCGGGAGGTAAGCTGGCCAGCAACTTATCTGTGTCTGTCCGATTGTCTAGT GTCTATGACTGATTTTATGCGCCTGCGTCGGTACTAGTTAGCTAACTAGCTCTGTATCTGGCGGACCCGTGGTGGAACTG ACGAGTTCGGAACACCCGGCCGCAACCCTGGGAGACGTCCCAGGGACTTCGGGGGCCGTTTTTGTGGCCCGACCTGAGTC CTAAAATCCCGATCGTTTAGGACTCTTTGGTGCACCCCCCTTAGAGGAGGGATATGTGGTTCTGGTAGGAGACGAGAACC TAAAACAGTTCCCGCCTCCGTCTGAATTTTTGCTTTCGGTTTGGGACCGAAGCCGCGCCGCGCGTCTTGTCTGCTGCAGC ATCGTTCTGTGTTGTCTCTGTCTGACTGTGTTTCTGTATTTGTCTGAAAATATGGGCCCGGGCTAGACTGTTACCACTCC CTTAAGTTTGACCTTAGGTCACTGGAAAGATGTCGAGCGGATCGCTCACAACCAGTCGGTAGATGTCAAGAAGAGACGTT GGGTTACCTTCTGCTCTGCAGAATGGCCAACCTTTAACGTCGGATGGCCGCGAGACGGCACCTTTAACCGAGACCTCATC ACCCAGGTTAAGATCAAGGTCTTTTCACCTGGCCCGCATGGACACCCAGACCAGGTCCCCTACATCGTGACCTGGGAAGC CTTGGCTTTTGACCCCCCTCCCTGGGTCAAGCCCTTTGTACACCCTAAGCCTCCGCCTCCTCTTCCTCCATCCGCCCCGT CTCTCCCCCTTGAACCTCCTCGTTCGACCCCGCCTCGATCCTCCCTTTATCCAGCCCTCACT
[0226] In one specific non-limiting example, the isolated nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:233 provided below:
TABLE-US-00066 [SEQ ID NO: 233] CCTTCTCTAGGCGCCCCCATATGGCCATATGAGATCTTATATGGGGCACCCCCGCCCCTTGTAAACTTCCCTGACCCTGA CATGACAAGAGTTACTAACAGCCCCTCTCTCCAAGCTCACTTACAGGCTCTCTACTTAGTCCAGCACGAAGTCTGGAGAC CTCTGGCGGCAGCCTACCAAGAACAACTGGACCGACCGGTGCCGCCACCATGGAAACCGACACCCTGCTGCTGTGGGTGC TGCTGCTGTGGGTGCCAGGATCCACAGGAcaatctgccctgactcagcctgcctccgtgtctgcgtctcctggacagtcg atcgccatctcctgcactggaaccagcagtgacgttggttggtatcaacagcacccaggcaaagcccccaaactcatgat ttatgaggacagtaagcggccctcaggggtttctaatcgcttctctggctccaagtctggcaacacggcctccctgacca tctctgggctccaggctgaggacgaggctgattattactgcagctcaaatacaagaagcagcactttggtgttcggcgga gggaccaagctgaccgtcctaggttctagaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctcga gatggccgaagtgcagctggtgcagtctggggctgagatgaagaagcctggggcctcactgaagctctcctgcaaggctt ctggatacaccttcatcgactactatgtatactggatgcgacaggcccctggacaagggcttgagtccatgggatggatc aaccctaacagtggtggcacaaactatgcacagaagtttcagggcagggtcaccatgaccagggacacgtccatcagcac agcctacatggagctgagcaggctgagatctgacgacaccgccatgtattactgtgcgcgctcccagcgtgacggttaca tggattactggggtcaaggtactctggtgaccgtctcctcagcggccgcacccaccacgacgccagcgccgcgaccacca accccggcgcccacgatcgcgtcgcagcccctgtccctgcgcccagaggcgtgccggccagcggcggggggcgcagtgca cacgagggggctggacttcgcctgtgatatctacatctgggcgcccctggccgggacttgtggggtccttctcctgtcac tggttatcaccctttactgcaacaaacggggcagaaagaagctcctgtatatattcaaacaaccatttatgagaccagta caaactactcaagaggaagatggctgtagctgccgatttccagaagaagaagaaggaggatgtgaactgagagtgaagtt caggaggagcgcagagccccccgcgtaccaggagggccagaaccagctctataacgagctcaatctaggacgaagagagg agtacgatgttttggacaagagacgtggccgggaccctgagatggggggaaagccgagaaggaagaaccctcaggaaggc ctgtacaatgaactgcagaaagataagatggcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaa ggggcacgatggcctttaccagggtctcagtacagccaccaaggacacctacgacgcccttcacatgcaggccctgcccc ctcgctaacagccactcgaggatccggattagtccaatttgttaaagacaggatatcagtggtccaggctctagttttga ctcaacaatatcaccagctgaagcctatagagtacgagccatagataaaataaaagattttatttagtctccagaaaaag gggggaatgaaagaccccacctgtaggtttggcaagctagcttaagtaacgccattttgcaaggcatggaaaaatacata actgagaatagagaagttcagatcaaggtcaggaacagatggaacagctgaatatgggccaaacaggatatctgtggtaa gcagttcctgccccggctcagggccaagaacagatggaacagctgaatatgggccaaacaggatatctgtggtaagcagt tcctgccccggctcagggccaagaacagatggtccccagatgcggtccagccctcagcagtttctagagaaccatcagat gtttccagggtgccccaaggacctgaaatgaccctgtgccttatttgaactaaccaatcagttcgcttctcgcttctgtt cgcgcgcttctgctccccgagctcaataaaagagcccacaacccctcactcggggcgccagtcctccgattgactgagtc gcccgggtacccgtgtatccaataaaccctcttgcagttgcatccgacttgtggtctcgctgttccttgggagggtctcc tctgagtgattgactacccgtcagcgggggtctttcacacatgcagcatgtatcaaaattaatttggttttttttcttaa gtatttacattaaatggccatagtacttaaagttacattggcttccttgaaataaacatggagtattcagaatgtgtcat aaatatttctaattttaagatagtatctccattggctttctactttttcttttatttttttttgtcctctgtcttccatt tgttgttgttgttgtttgtttgtttgtttgttggttggttggttaatttttttttaaagatcctacactatagttcaagc tagactattagctactctgtaacccagggtgaccttgaagtcatgggtagcctgctgttttagccttcccacatctaaga ttacaggtatgagctatcatttttggtatattgattgattgattgattgatgtgtgtgtgtgtgattgtgtttgtgtgtg tgactgtgaaaatgtgtgtatgggtgtgtgtgaatgtgtgtatgtatgtgtgtgtgtgagtgtgtgtgtgtgtgtgtgca tgtgtgtgtgtgtgactgtgtctatgtgtatgactgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtgtg ttgtgaaaaaatattctatggtagtgagagccaacgctccggctcaggtgtcaggttggtttttgagacagagtctttca cttagcttggAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGCCTTG CAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTG AATGGCGAATGGCGCCTGATGCGGTATTTTCTCCTTACGCATCTGTGCGGTATTTCACACCGCATATGGTGCACTCTCAG TACAATCTGCTCTGATGCCGCATAGTTAAGCCAGCCCCGACACCCGCCAACACCCGCTGACGCGCCCTGACGGGCTTGTC TGCTCCCGGCATCCGCTTACAGACAAGCTGTGACCGTCTCCGGGAGCTGCATGTGTCAGAGGTTTTCACCGTCATCACCG AAACGCGCGATGACGAAAGGGCCTCGTGATACGCCTATTTTTATAGGTTAATGTCATGATAATAATGGTTTCTTAGACGT CAGGTGGCACTTTTCGGGGAAATGTGCGCGGAACCCCTATTTGTTTATTTTTCTAAATACATTCAAATATGTATCCGCTC ATGAGACAATAACCCTGATAAATGCTTCAATAATATTGAAAAAGGAAGAGTATGAGTATTCAACATTTCCGTGTCGCCCT TATTCCCTTTTTTGCGGCATTTTGCCTTCCTGTTTTTGCTCACCCAGAAACGCTGGTGAAAGTAAAAGATGCTGAAGATC AGTTGGGTGCACGAGTGGGTTACATCGAACTGGATCTCAACAGCGGTAAGATCCTTGAGAGTTTTCGCCCCGAAGAACGT TTTCCAATGATGAGCACTTTTAAAGTTCTGCTATGTGGCGCGGTATTATCCCGTATTGACGCCGGGCAAGAGCAACTCGG TCGCCGCATACACTATTCTCAGAATGACTTGGTTGAGTACTCACCAGTCACAGAAAAGCATCTTACGGATGGCATGACAG TAAGAGAATTATGCAGTGCTGCCATAACCATGAGTGATAACACTGCGGCCAACTTACTTCTGACAACGATCGGAGGACCG AAGGAGCTAACCGCTTTTTTGCACAACATGGGGGATCATGTAACTCGCCTTGATCGTTGGGAACCGGAGCTGAATGAAGC CATACCAAACGACGAGCGTGACACCACGATGCCTGTAGCAATGGCAACAACGTTGCGCAAACTATTAACTGGCGAACTAC TTACTCTAGCTTCCCGGCAACAATTAATAGACTGGATGGAGGCGGATAAAGTTGCAGGACCACTTCTGCGCTCGGCCCTT CCGGCTGGCTGGTTTATTGCTGATAAATCTGGAGCCGGTGAGCGTGGGTCTCGCGGTATCATTGCAGCACTGGGGCCAGA TGGTAAGCCCTCCCGTATCGTAGTTATCTACACGACGGGGAGTCAGGCAACTATGGATGAACGAAATAGACAGATCGCTG AGATAGGTGCCTCACTGATTAAGCATTGGTAACTGTCAGACCAAGTTTACTCATATATACTTTAGATTGATTTAAAACTT CATTTTTAATTTAAAAGGATCTAGGTGAAGATCCTTTTTGATAATCTCATGACCAAAATCCCTTAACGTGAGTTTTCGTT CCACTGAGCGTCAGACCCCGTAGAAAAGATCAAAGGATCTTCTTGAGATCCTTTTTTTCTGCGCGTAATCTGCTGCTTGC AAACAAAAAAACCACCGCTACCAGCGGTGGTTTGTTTGCCGGATCAAGAGCTACCAACTCTTTTTCCGAAGGTAACTGGC TTCAGCAGAGCGCAGATACCAAATACTGTCCTTCTAGTGTAGCCGTAGTTAGGCCACCACTTCAAGAACTCTGTAGCACC GCCTACATACCTCGCTCTGCTAATCCTGTTACCAGTGGCTGCTGCCAGTGGCGATAAGTCGTGTCTTACCGGGTTGGACT CAAGACGATAGTTACCGGATAAGGCGCAGCGGTCGGGCTGAACGGGGGGTTCGTGCACACAGCCCAGCTTGGAGCGAACG ACCTACACCGAACTGAGATACCTACAGCGTGAGCATTGAGAAAGCGCCACGCTTCCCGAAGGGAGAAAGGCGGACAGGTA TCCGGTAAGCGGCAGGGTCGGAACAGGAGAGCGCACGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTATAGTCCTG TCGGGTTTCGCCACCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGC AACGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGT GGATAACCGTATTACCGCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCGAGTCAGTGAGCG AGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCGCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGG TTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGTGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACA CTTTATGCTTCCGGCTCGTATGTTGTGTGGAATTGTGAGCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATT ACGCCAAGCTTTGCTCTTAGGAGTTTCCTAATACATCCCAAACTCAAATATATAAAGCATTTGACTTGTTCTATGCCCTA GGGGGCGGGGGGAAGCTAAGCCAGCTTTTTTTAACATTTAAAATGTTAATTCCATTTTAAATGCACAGATGTTTTTATTT CATAAGGGTTTCAATGTGCATGAATGCTGCAATATTCCTGTTACCAAAGCTAGTATAAATAAAAATAGATAAACGTGGAA ATTACTTAGAGTTTCTGTCATTAACGTTTCCTTCCTCAGTTGACAACATAAATGCGCTGCTGAGCAAGCCAGTTTGCATC TGTCAGGATCAATTTCCCATTATGCCAGTCATATTAATTACTAGTCAATTAGTTGATTTTTATTTTTGACATATACATGT GAATGAAAGACCCCACCTGTAGGTTTGGCAAGCTAGCTTAAGTAACGCCATTTTGCAAGGCATGGAAAAATACATAACTG AGAATAGAAAAGTTCAGATCAAGGTCAGGAACAGATGGAACAGCTGAATATGGGCCAAACAGGATATCTGTGGTAAGCAG TTCCTGCCCCGGCTCAGGGCCAAGAACAGATGGAACAGCTGAATATGGGCCAAACAGGATATCTGTGGTAAGCAGTTCCT GCCCCGGCTCAGGGCCAAGAACAGATGGTCCCCAGATGCGGTCCAGCCCTCAGCAGTTTCTAGAGAACCATCAGATGTTT CCAGGGTGCCCCAAGGACCTGAAATGACCCTGTGCCTTATTTGAACTAACCAATCAGTTCGCTTCTCGCTTCTGTTCGCG CGCTTATGCTCCCCGAGCTCAATAAAAGAGCCCACAACCCCTCACTCGGGGCGCCAGTCCTCCGATTGACTGAGTCGCCC GGGTACCCGTGTATCCAATAAACCCTCTTGCAGTTGCATCCGACTTGTGGTCTCGCTGTTCCTTGGGAGGGTCTCCTCTG AGTGATTGACTACCCGTCAGCGGGGGTCTTTCATTTGGGGGCTCGTCCGGGATCGGGAGACCCCTGCCCAGGGACCACCG ACCCACCACCGGGAGGTAAGCTGGCCAGCAACTTATCTGTGTCTGTCCGATTGTCTAGTGTCTATGACTGATTTTATGCG CCTGCGTCGGTACTAGTTAGCTAACTAGCTCTGTATCTGGCGGACCCGTGGTGGAACTGACGAGTTCGGAACACCCGGCC GCAACCCTGGGAGACGTCCCAGGGACTTCGGGGGCCGTTTTTGTGGCCCGACCTGAGTCCTAAAATCCCGATCGTTTAGG ACTCTTTGGTGCACCCCCCTTAGAGGAGGGATATGTGGTTCTGGTAGGAGACGAGAACCTAAAACAGTTCCCGCCTCCGT CTGAATTTTTGCTTTCGGTTTGGGACCGAAGCCGCGCCGCGCGTCTTGTCTGCTGCAGCATCGTTCTGTGTTGTCTCTGT CTGACTGTGTTTCTGTATTTGTCTGAAAATATGGGCCCGGGCTAGACTGTTACCACTCCCTTAAGTTTGACCTTAGGTCA CTGGAAAGATGTCGAGCGGATCGCTCACAACCAGTCGGTAGATGTCAAGAAGAGACGTTGGGTTACCTTCTGCTCTGCAG AATGGCCAACCTTTAACGTCGGATGGCCGCGAGACGGCACCTTTAACCGAGACCTCATCACCCAGGTTAAGATCAAGGTC TTTTCACCTGGCCCGCATGGACACCCAGACCAGGTCCCCTACATCGTGACCTGGGAAGCCTTGGCTTTTGACCCCCCTCC CTGGGTCAAGCCCTTTGTACACCCTAAGCCTCCGCCTCCTCTTCCTCCATCCGCCCCGTCTCTCCCCCTTGAACCTCCTC GTTCGACCCCGCCTCGATCCTCCCTTTATCCAGCCCTCACT
[0227] In one specific non-limiting example, the isolated nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:234 provided below:
TABLE-US-00067 [SEQ ID NO: 234] atggaaaccgacaccctgctgctgtgggtgctgctgctgtgggtgccagg atccacaggactgcctgtgctgactcagccaccctcagcgtctgggaccc ccgggcagagggtcaccatctcttgttctggacgcagttccaacatcggg agtaattctgttaactggtatcgacaactcccaggagcggcccccaaact cctcatctatagtaataatcagcggcccccaggggtccctgtgcgattct ctggctccaagtctggcacctcagcctccctggccatcagtgggctccag tctgaagatgaggccacttattactgtgcaacatgggatgacaatctgaa tgttcactatgtcttcggaactgggaccaaggtcaccgtcctaggttcta gaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctc gagatggcccaggtgcagctggtgcagtctggggctgaggtgaagaagcc tgggtcctcggtgaaggtctcctgcaaggcttctggaggcaccttcagca gctatgctatcagctgggtgcgacaggcccctggacaagggcttgagtgg atgggaaggatcatccctatccttggtatagcaaactacgcacagaagtt ccagggcagagtcacgattaccgcggacaaatccacgagcacagcctaca tggagctgagcagcctgagatctgaggacacggccgtgtattactgtgcg cgcggtggttactactctcatgacatgtggtctgaagattggggtcaagg tactctggtgaccgtctcctcagcggccgcaattgaagttatgtatcctc ctccttacctagacaatgagaagagcaatggaaccattatccatgtgaaa gggaaacacctttgtccaagtcccctatttcccggaccttctaagccctt ttgggtgctggtggtggttggtggagtcctggcttgctatagcttgctag taacagtggcctttattattttctgggtgaggagtaagaggagcaggctc ctgcacagtgactacatgaacatgactccccgccgccccgggcccacccg caagcattaccagccctatgccccaccacgcgacttcgcagcctatcgct ccagagtgaagttcagcaggagcgcagacgcccccgcgtaccagcagggc cagaaccagctctataacgagctcaatctaggacgaagagaggagtacga tgttttggacaagagacgtggccgggaccctgagatggggggaaagccga gaaggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataag atggcggaggcctacagtgagattgggatgaaaggcgagcgccggagggg caaggggcacgatggcctttaccagggtctcagtacagccaccaaggaca cctacgacgcccttcacatgcaggccctgccccctcgctaa
[0228] In one specific non-limiting example, the isolated nucleic acid molecule comprises nucleic acids having the sequence set forth in SEQ ID NO:235 provided below:
TABLE-US-00068 [SEQ ID NO: 235] atggaaaccgacaccctgctgctgtgggtgctgctgctgtgggtgccagg atccacaggacaggctgtgctgactcagccaccctcagcgtctgggaccc ccgggcagagggtcaccatctcttgttctggaagcagctccaacatcgga agtaattacgtattctggtaccagcagctcccaggaacggcccccaaact cctcatctatagtaataatcagcggccctcaggggtccctgaccgattct ctggctccaagtctggcacctcagcctccctggccatcagtgggctccgg tccgaggatgaggctgattattactgtgcagcatgggatgacagcctgag tgcctcttatgttttcggaactgggaccaaggtcaccgtcctaggttcta gaggtggtggtggtagcggcggcggcggctctggtggtggtggatccctc gagatggcccaggtgcagctggtgcagtctggggctgaggtgaagaagcc tgggtcctcggtgaaggtctcctgcaaggcttctggaggcaccttcagca gctatgctatcagctgggtgcgacaggcccctggacaagggcttgagtgg atgggaaggatcatccctatccttggtacagcaaactacgcacagaagtt ccagggcagagtcacgattaccgcggacgaatccacgagcacagcctaca tggagctgagcagcctgagatctgaggacacggccgtgtattactgtgcg cgctctggttacggttcttaccgttgggaagattcttggggtcaaggtac tctggtgaccgtctcctcagcggccgcaattgaagttatgtatcctcctc cttacctagacaatgagaagagcaatggaaccattatccatgtgaaaggg aaacacctttgtccaagtcccctatttcccggaccttctaagcccttttg ggtgctggtggtggttggtggagtcctggcttgctatagcttgctagtaa cagtggcctttattattttctgggtgaggagtaagaggagcaggctcctg cacagtgactacatgaacatgactccccgccgccccgggcccacccgcaa gcattaccagccctatgccccaccacgcgacttcgcagcctatcgctcca gagtgaagttcagcaggagcgcagacgcccccgcgtaccagcagggccag aaccagctctataacgagctcaatctaggacgaagagaggagtacgatgt tttggacaagagacgtggccgggaccctgagatggggggaaagccgagaa ggaagaaccctcaggaaggcctgtacaatgaactgcagaaagataagatg gcggaggcctacagtgagattgggatgaaaggcgagcgccggaggggcaa ggggcacgatggcctttaccagggtctcagtacagccaccaaggacacct acgacgcccttcacatgcaggccctgccccctcgctaa
[0229] The isolated nucleic acid molecule having the nucleotide sequence of SEQ ID NO:207 encodes a BCMA-targeted CAR (designated as BCMA-targeted 28z CAR54) comprising a human scFv that comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53, a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54, and a linker having an amino acid sequence of SEQ ID NO:69 positioned between the heavy chain variable region and the light chain variable region, a transmembrane domain comprising a CD28 polypeptide, and an intracellular domain comprising a CD3? polypeptide comprising amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195, and a co-stimulatory signaling region comprising a CD28 polypeptide, wherein the CD28 region comprising the transmembrance domain and the co-stimulatory signaling region comprises amino acids 114 to 220 of SEQ ID NO:193.
[0230] The isolated nucleic acid molecule having the nucleotide sequence of SEQ ID NO:208 encodes a BCMA-targeted CAR (designated as BCMA-targeted 28z CAR40) comprising a human scFv that comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57, a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58, and a linker having an amino acid sequence of SEQ ID NO:69 positioned between the heavy chain variable region and the light chain variable region, a transmembrane domain comprising a CD28 polypeptide, and an intracellular domain comprising a CD3? polypeptide comprising amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195, and a co-stimulatory signaling region comprising a CD28 polypeptide, wherein the CD28 region comprising the transmembrance domain and the co-stimulatory signaling region comprises amino acids 114 to 220 of SEQ ID NO:193.
[0231] The isolated nucleic acid molecule having the nucleotide sequence of SEQ ID NO:209 encodes a BCMA-targeted CAR (designated as BCMA-targeted 28z CAR24) comprising a human scFv that comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65, a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66, and a linker having an amino acid sequence of SEQ ID NO:69 positioned between the heavy chain variable region and the light chain variable region, a transmembrane domain comprising a CD28 polypeptide, and an intracellular domain comprising a CD3? polypeptide comprising amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195, and a co-stimulatory signaling region comprising a CD28 polypeptide, wherein the CD28 region comprising the transmembrance domain and the co-stimulatory signaling region comprises amino acids 114 to 220 of SEQ ID NO:193.
[0232] The isolated nucleic acid molecule having the nucleotide sequence of SEQ ID NO:234 encodes a BCMA-targeted CAR (designated as BCMA-targeted 28z CAR3) comprising a human scFv that comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:21, a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:22, and a linker having an amino acid sequence of SEQ ID NO:69 positioned between the heavy chain variable region and the light chain variable region, a transmembrane domain comprising a CD28 polypeptide, and an intracellular domain comprising a CD3? polypeptide comprising amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195, and a co-stimulatory signaling region comprising a CD28 polypeptide, wherein the CD28 region comprising the transmembrance domain and the co-stimulatory signaling region comprises amino acids 114 to 220 of SEQ ID NO:193.
[0233] The isolated nucleic acid molecule having the nucleotide sequence of SEQ ID NO:235 encodes a BCMA-targeted CAR (designated as BCMA-targeted 28z CAR37) comprising a human scFv that comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61, a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62, and a linker having an amino acid sequence of SEQ ID NO:69 positioned between the heavy chain variable region and the light chain variable region, a transmembrane domain comprising a CD28 polypeptide, and an intracellular domain comprising a CD3? polypeptide comprising amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195, and a co-stimulatory signaling region comprising a CD28 polypeptide, wherein the CD28 region comprising the transmembrance domain and the co-stimulatory signaling region comprises amino acids 114 to 220 of SEQ ID NO:193.
[0234] The isolated nucleic acid molecule having the nucleotide sequence of SEQ ID NO:229 encodes a BCMA-targeted CAR (designated as BCMA-targeted BBz CAR3) comprising a human scFv that comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:21, a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:22, and a linker having an amino acid sequence of SEQ ID NO:69 positioned between the heavy chain variable region and the light chain variable region, a transmembrane domain comprising a CD8 polypeptide having amino acids 137 to 207 of SEQ ID NO: 226, and an intracellular domain comprising a CD3? polypeptide comprising amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195, and a co-stimulatory signaling region comprising a 4-1BB polypeptide having the amino acids 214-255 of SEQ ID NO: 197. Nucleotide sequences 270-1031 of SEQ ID NO: 229 encodes the human scFv. Nucleotide sequences 1041-1253 of SEQ ID NO: 229 encodes the CD8 polypeptide comprised in the transmembrane domain. Nucleotide sequences 1254-1379 of SEQ ID NO: 229 encodes the 4-1BB polypeptide comprised in the intracellular domain. Nucleotide sequences 1380-1718 of SEQ ID NO: 229 encodes the CD3zeta polypeptide comprised in the intracellular domain. Other portions of SEQ ID NO: 229 are shown in Table 19.
TABLE-US-00069 TABLE 19 nucleotide Sequence positions Portions of SEQ ID NO: 229 number of nucleotides Kappa sp 210 . . . 269 60 LTR 1998 . . . 2467 470 M13 fwd 3166 . . . 3182 17 AmpR promoter 3657 . . . 3761 105 AmpR 3762 . . . 4622 861 ori 4793 . . . 5381 589 CAP binding site 5669 . . . 5690 22 lac promoter 5705 . . . 5735 31 lac operator 5743 . . . 5759 17 M13 rev 5767 . . . 5783 17 LTR 6192 . . . 6785 594 MMLV Psi 6848 . . . 7205 358 gag (truncated) 7270 . . . 15 417
[0235] The isolated nucleic acid molecule having the nucleotide sequence of SEQ ID NO:230 encodes a BCMA-targeted CAR (designated as BCMA-targeted BBz CAR24) comprising a human scFv that comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:65, a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:66, and a linker having an amino acid sequence of SEQ ID NO:69 positioned between the heavy chain variable region and the light chain variable region, a transmembrane domain comprising a CD8 polypeptide having amino acids 137 to 207 of SEQ ID NO: 226, and an intracellular domain comprising a CD3? polypeptide comprising amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195, and a co-stimulatory signaling region comprising a 4-1BB polypeptide having the amino acids 214-255 of SEQ ID NO: 197. Nucleotide sequences 270-1015 of SEQ ID NO: 230 encodes the human scFv. Nucleotide sequences 1023-1235 of SEQ ID NO: 230 encodes the CD8 polypeptide comprised in the transmembrane domain. Nucleotide sequences 1236-1361 of SEQ ID NO: 230 encodes the 4-1BB polypeptide comprised in the intracellular domain. Nucleotide sequences 1362-1700 of SEQ ID NO: 230 encodes the CD3zeta polypeptide comprised in the intracellular domain. Other portions of SEQ ID NO: 230 are shown in Table 20.
TABLE-US-00070 TABLE 20 nucleotide Sequence positions Portions of SEQ ID NO: 230 number of nucleotides Kappa sp 210 . . . 269 60 LTR 1980 . . . 2449 470 M13 fwd 3148 . . . 3164 17 AmpR promoter 3639 . . . 3743 105 AmpR 3744 . . . 4604 861 ori 4775 . . . 5363 589 CAP binding site 5651 . . . 5672 22 lac promoter 5687 . . . 5717 31 lac operator 5725 . . . 5741 17 M13 rev 5749 . . . 5765 17 LTR 6174 . . . 6767 594 MMLV Psi 6830 . . . 7187 358 gag (truncated) 7252 . . . 15 417
[0236] The isolated nucleic acid molecule having the nucleotide sequence of SEQ ID NO:231 encodes a BCMA-targeted CAR (designated as BCMA-targeted BBz CAR37) comprising a human scFv that comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:61, a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:62, and a linker having an amino acid sequence of SEQ ID NO:69 positioned between the heavy chain variable region and the light chain variable region, a transmembrane domain comprising a CD8 polypeptide having amino acids 137 to 207 of SEQ ID NO: 226, and an intracellular domain comprising a CD3? polypeptide comprising amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195, and a co-stimulatory signaling region comprising a 4-1BB polypeptide having the amino acids 214-255 of SEQ ID NO: 197. Nucleotide sequences 270-1028 of SEQ ID NO: 231 encodes the human scFv. Nucleotide sequences 1038-1250 of SEQ ID NO: 231 encodes the CD8 polypeptide comprised in the transmembrane domain. Nucleotide sequences 1251-1376 of SEQ ID NO: 231 encodes the 4-1BB polypeptide comprised in the intracellular domain. Nucleotide sequences 1377-1715 of SEQ ID NO: 231 encodes the CD3zeta polypeptide comprised in the intracellular domain. Other portions of SEQ ID NO: 231 are shown in Table 21.
TABLE-US-00071 TABLE 21 nucleotide Sequence positions Portions of SEQ ID NO: 231 number of nucleotides Kappa sp 210 . . . 269 60 LTR 1995 . . . 2464 470 M13 fwd 3163 . . . 3179 17 AmpR promoter 3654 . . . 3758 105 AmpR 3759 . . . 4619 861 ori 4790 . . . 5378 589 CAP binding site 5666 . . . 5687 22 lac promoter 5702 . . . 5732 31 lac operator 5740 . . . 5756 17 M13 rev 5764 . . . 5780 17 LTR 6189 . . . 6782 594 MMLV Psi 6845 . . . 7202 358 gag (truncated) 7267 . . . 15 417
[0237] The isolated nucleic acid molecule having the nucleotide sequence of SEQ ID NO:232 encodes a BCMA-targeted CAR (designated as BCMA-targeted BBz CAR40) comprising a human scFv that comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:57, a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:58, and a linker having an amino acid sequence of SEQ ID NO:69 positioned between the heavy chain variable region and the light chain variable region, a transmembrane domain comprising a CD8 polypeptide having amino acids 137 to 207 of SEQ ID NO: 226, and an intracellular domain comprising a CD3? polypeptide comprising amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195, and a co-stimulatory signaling region comprising a 4-1BB polypeptide having the amino acids 214-255 of SEQ ID NO: 197. Nucleotide sequences 270-1024 of SEQ ID NO: 232 encodes the human scFv. Nucleotide sequences 1032-1244 of SEQ ID NO: 232 encodes the CD8 polypeptide comprised in the transmembrane domain. Nucleotide sequences 1245-1370 of SEQ ID NO: 232 encodes the 4-1BB polypeptide comprised in the intracellular domain. Nucleotide sequences 1371-1709 of SEQ ID NO: 232 encodes the CD3zeta polypeptide comprised in the intracellular domain. Other portions of SEQ ID NO: 232 are shown in Table 22.
TABLE-US-00072 TABLE 22 nucleotide Sequence positions Portions of SEQ ID NO: 232 number of nucleotides Kappa sp 210 . . . 269 60 LTR 1989 . . . 2458 470 M13 fwd 3157 . . . 3173 17 AmpR promoter 3648 . . . 3752 105 AmpR 3753 . . . 4613 861 ori 4784 . . . 5372 589 CAP binding site 5660 . . . 5681 22 lac promoter 5696 . . . 5726 31 lac operator 5734 . . . 5750 17 M13 rev 5758 . . . 5774 17 LTR 6183 . . . 6776 594 MMLV Psi 6839 . . . 7196 358 gag (truncated) 7261 . . . 15 417
[0238] The isolated nucleic acid molecule having the nucleotide sequence of SEQ ID NO:233 encodes a BCMA-targeted CAR (designated as BCMA-targeted BBz CAR54) comprising a human scFv that comprises a heavy chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:53, a light chain variable region comprising amino acids having the sequence set forth in SEQ ID NO:54, and a linker having an amino acid sequence of SEQ ID NO:69 positioned between the heavy chain variable region and the light chain variable region, a transmembrane domain comprising a CD8 polypeptide having amino acids 137 to 207 of SEQ ID NO: 226, and an intracellular domain comprising a CD3? polypeptide comprising amino acid sequence of amino acids 52 to 163 of SEQ ID NO: 195, and a co-stimulatory signaling region comprising a 4-1BB polypeptide having the amino acids 214-255 of SEQ ID NO: 197. Nucleotide sequences 270-1003 of SEQ ID NO: 233 encodes the human scFv. Nucleotide sequences 1011-1223 of SEQ ID NO: 233 encodes the CD8 polypeptide comprised in the transmembrane domain. Nucleotide sequences 1224-1349 of SEQ ID NO: 233 encodes the 4-1BB polypeptide comprised in the intracellular domain. Nucleotide sequences 1350-1688 of SEQ ID NO: 233 encodes the CD3zeta polypeptide comprised in the intracellular domain. Other portions of SEQ ID NO: 233 are shown in Table 23.
TABLE-US-00073 TABLE 23 nucleotide Sequence positions Portions of SEQ ID NO: 233 number of nucleotides Kappa sp 210 . . . 269 60 LTR 1968 . . . 2437 470 M13 fwd 3136 . . . 3152 17 AmpR promoter 3627 . . . 3731 105 AmpR 3732 . . . 4592 861 ori 4763 . . . 5351 589 CAP binding site 5639 . . . 5660 22 lac promoter 5675 . . . 5705 31 lac operator 5713 . . . 5729 17 M13 rev 5737 . . . 5753 17 LTR 6162 . . . 6755 594 MMLV Psi 6818 . . . 7175 358 gag (truncated) 7240 . . . 15 417
[0239] In certain embodiments, the isolated nucleic acid molecule encodes a functional portion of a presently disclosed BCMA-targeted CAR. As used herein, the term functional portion refers to any portion, part or fragment of a presently disclosed BCMA-targeted CAR, which portion, part or fragment retains the biological activity of the BCMA-targeted CAR (the parent CAR). For example, functional portions encompass the portions, parts or fragments of a presently disclosed BCMA-targeted CAR that retains the ability to recognize a target cell, to treat a disease, e.g., multiple myeloma, to a similar, same, or even a higher extent as the parent CAR. In certain embodiments, an isolated nucleic acid molecule encoding a functional portion of a presently disclosed BCMA-targeted CAR can encode a protein comprising, e.g., about 10%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, and 95%, or more of the parent CAR.
[0240] One Phase I clinical trial (NCT02215967) operated by National Cancer Institute (NCI) used anti-BCMA CAR-transduced T cells for treating multiple myeloma..sup.33,34 The anti-BCMA CAR applied in the NCI's clinical trial comprises a murine scFv binding to human BCMA. Using a mouse antibody or a mouse scFv for treating humans can lead to anti-mouse antibody (HAMA) response, which may be life-threatening. Unlike NCI clinical trial, in certain embodiments, the presently disclosed BCMA-targeted CAR comprises a human scFv, and thus, affords a much decreased risk of immunogenicity, compared with CARs comprising murine antibodies (see Maus et al., Cancer Immunol Res (2003); 1(1):26-31), which reports that the potential immunogenicity of CARs derived from murine antibodies may be a safety issue for mRNA CARs).
III. Immunoresponsive Cells
[0241] The presently disclosed subject matter provides immunoresponsive cells expressing a CAR that comprises an extracellular antigen-binding domain, a transmembrane domain and an intracellular domain, where the extracellular antigen-binding domain specifically binds to BCMA (e.g., human BCMA) as described above. The immunoresponsive cells can be transduced with a presently disclosed CAR such that the cells express the CAR. The presently disclosed subject matter also provides methods of using such cells for the treatment of a tumor, e.g., multiple myeloma (MM). The immunoresponsive cells of the presently disclosed subject matter can be cells of the lymphoid lineage. The lymphoid lineage, comprising B, T and natural killer (NK) cells, provides for the production of antibodies, regulation of the cellular immune system, detection of foreign agents in the blood, detection of cells foreign to the host, and the like. Non-limiting examples of immunoresponsive cells of the lymphoid lineage include T cells, Natural Killer (NK) cells, cytotoxic T lymphocytes (CTLs), regulatory T cells, embryonic stem cells, and pluripotent stem cells (e.g., those from which lymphoid cells may be differentiated). T cells can be lymphocytes that mature in the thymus and are chiefly responsible for cell-mediated immunity. T cells are involved in the adaptive immune system. The T cells of the presently disclosed subject matter can be any type of T cells, including, but not limited to, T helper cells, cytotoxic T cells, memory T cells (including central memory T cells, stem-cell-like memory T cells (or stem-like memory T cells), and two types of effector memory T cells: e.g., TEM cells and T.sub.EMRA cells), Regulatory T cells (also known as suppressor T cells), Natural killer T cells, Mucosal associated invariant T cells, and ?? T cells. In certain embodiments, the CAR-expressing T cells express Foxp3 to achieve and maintain a T regulatory phenotype. Natural killer (NK) cells can be lymphocytes that are part of cell-mediated immunity and act during the innate immune response. NK cells do not require prior activation in order to perform their cytotoxic effect on target cells. Cytotoxic T cells (CTL or killer T cells) are a subset of T lymphocytes capable of inducing the death of infected somatic or tumor cells.
[0242] The immunoresponsive cells of the presently disclosed subject matter can express an extracellular antigen-binding domain (e.g., a human scFV, a Fab that is optionally crosslinked, or a F(ab).sub.2) that specifically binds to BCMA (e.g., human BCMA), for the treatment of multiple myeloma. Such immunoresponsive cells can be administered to a subject (e.g., a human subject) in need thereof for the treatment of multiple myeloma. In certain embodiments, the immunoresponsive cell is a T cell. The T cell can be a CD4.sup.+ T cell or a CDS.sup.+ T cell. In certain embodiments, the T cell is a CD4.sup.+ T cell. In another embodiment, the T cell is a CDS.sup.+ T cell.
[0243] A presently disclosed immunoresponsive cell can be further transduced with at least one co-stimulatory ligand, such that the immunoresponsive cell co-expresses or is induced to co-express the BCMA-targeted CAR and the at least one co-stimulatory ligand. The interaction between the BCMA-targeted CAR and at least one co-stimulatory ligand provides a non-antigen-specific signal important for full activation of an immunoresponsive cell (e.g., T cell). Co-stimulatory ligands include, but are not limited to, members of the tumor necrosis factor (TNF) superfamily, and immunoglobulin (Ig) superfamily ligands. TNF is a cytokine involved in systemic inflammation and stimulates the acute phase reaction. Its primary role is in the regulation of immune cells. Members of TNF superfamily share a number of common features. The majority of TNF superfamily members are synthesized as type II transmembrane proteins (extracellular C-terminus) containing a short cytoplasmic segment and a relatively long extracellular region. TNF superfamily members include, without limitation, nerve growth factor (NGF), CD40L (CD40L)/CD154, CD137L/4-1BBL, TNF-?, CD134L/OX40L/CD252, CD27L/CD70, Fas ligand (FasL), CD30L/CD153, tumor necrosis factor beta (TNF?)/lymphotoxin-alpha (LT?), lymphotoxin-beta (LT?), CD257/B cell-activating factor (BAFF)/Blys/THANK/Tall-1, glucocorticoid-induced TNF Receptor ligand (GITRL), and TNF-related apoptosis-inducing ligand (TRAIL), LIGHT (TNFSF14). The immunoglobulin (Ig) superfamily is a large group of cell surface and soluble proteins that are involved in the recognition, binding, or adhesion processes of cells. These proteins share structural features with immunoglobulinsthey possess an immunoglobulin domain (fold). Immunoglobulin superfamily ligands include, but are not limited to, CD80 and CD86, both ligands for CD28, PD-L1/(B7-H1) that ligands for PD-1. In certain embodiments, the at least one co-stimulatory ligand is selected from the group consisting of 4-1BBL, CD80, CD86, CD70, OX40L, CD48, TNFRSF14, PD-L1, and combinations thereof. In certain embodiments, the immunoresponsive cell is transduced with one co-stimulatory ligand that is 4-1BBL. In certain embodiments, the immunoresponsive cell is transduced with two co-stimulatory ligands that are 4-1BBL and CD80. CARs transduced with at least one co-stimulatory ligand are described in U.S. Pat. No. 8,389,282, which is incorporated by reference in its entirety.
[0244] Furthermore, a presently disclosed immunoresponsive cell can be further transduced with at least one cytokine, such that the immunoresponsive cell secretes the at least one cytokine as well as expresses the BCMA-targeted CAR. In certain embodiments, the at least one cytokine is selected from the group consisting of IL-2, IL-3, IL-6, IL-7, IL-11, IL-12, IL-15, IL-17, and IL-21. In certain embodiments, the cytokine is IL-12.
[0245] The BCMA-specific or BCMA-targeted human lymphocytes that can be used in peripheral donor lymphocytes, e.g., those disclosed in Sadelain, M., et al. 2003 Nat Rev Cancer 3:35-45 (disclosing peripheral donor lymphocytes genetically modified to express CARs), in Morgan, R. A., et al. 2006 Science 314:126-129 (disclosing peripheral donor lymphocytes genetically modified to express a full-length tumor antigen-recognizing T cell receptor complex comprising the ? and ? heterodimer), in Panelli, M. C., et al. 2000 J Immunol 164:495-504; Panelli, M. C., et al. 2000 J Immunol 164:4382-4392 (disclosing lymphocyte cultures derived from tumor infiltrating lymphocytes (TILs) in tumor biopsies), and in Dupont, J., et al. 2005 Cancer Res 65:5417-5427; Papanicolaou, G. A., et al. 2003 Blood 102:2498-2505 (disclosing selectively in vitro-expanded antigen-specific peripheral blood leukocytes employing artificial antigen-presenting cells (AAPCs) or pulsed dendritic cells). The immunoresponsive cells (e.g., T cells) can be autologous, non-autologous (e.g., allogeneic), or derived in vitro from engineered progenitor or stem cells.
[0246] In certain embodiments, a presently disclosed immunoresponsive cell (e.g., T cell) expresses from about 1 to about 4, from about 2 to about 4, from about 3 to about 4, from about 1 to about 2, from about 1 to about 3, or from about 2 to about 3 vector copy numbers/cell of a presently disclosed BCMA-targeted CAR.
[0247] The unpurified source of CTLs may be any known in the art, such as the bone marrow, fetal, neonate or adult or other hematopoietic cell source, e.g., fetal liver, peripheral blood or umbilical cord blood. Various techniques can be employed to separate the cells. For instance, negative selection methods can remove non-CTLs initially. Monoclonal antibodies are particularly useful for identifying markers associated with particular cell lineages and/or stages of differentiation for both positive and negative selections.
[0248] A large proportion of terminally differentiated cells can be initially removed by a relatively crude separation. For example, magnetic bead separations can be used initially to remove large numbers of irrelevant cells. Preferably, at least about 80%, usually at least 70% of the total hematopoietic cells will be removed prior to cell isolation.
[0249] Procedures for separation include, but are not limited to, density gradient centrifugation; resetting; coupling to particles that modify cell density; magnetic separation with antibody-coated magnetic beads; affinity chromatography; cytotoxic agents joined to or used in conjunction with a mAb, including, but not limited to, complement and cytotoxins; and panning with antibody attached to a solid matrix, e.g. plate, chip, elutriation or any other convenient technique.
[0250] Techniques for separation and analysis include, but are not limited to, flow cytometry, which can have varying degrees of sophistication, e.g., a plurality of color channels, low angle and obtuse light scattering detecting channels, impedance channels.
[0251] The cells can be selected against dead cells, by employing dyes associated with dead cells such as propidium iodide (PI). Preferably, the cells are collected in a medium comprising 2% fetal calf serum (FCS) or 0.2% bovine serum albumin (BSA) or any other suitable, preferably sterile, isotonic medium.
IV. Vectors
[0252] Genetic modification of immunoresponsive cells (e.g., T cells, CTL cells, NK cells) can be accomplished by transducing a substantially homogeneous cell composition with a recombinant DNA or RNA construct. The vector can be a retroviral vector (e.g., gamma retroviral), which is employed for the introduction of the DNA or RNA construct into the host cell genome. For example, a polynucleotide encoding the BCMA-targeted CAR can be cloned into a retroviral vector and expression can be driven from its endogenous promoter, from the retroviral long terminal repeat, or from an alternative internal promoter.
[0253] Non-viral vectors or RNA may be used as well. Random chromosomal integration, or targeted integration (e.g., using a nuclease, transcription activator-like effector nucleases (TALENs), Zinc-finger nucleases (ZFNs), and/or clustered regularly interspaced short palindromic repeats (CRISPRs), or transgene expression (e.g., using a natural or chemically modified RNA) can be used.
[0254] For initial genetic modification of the cells to provide BCMA-targeted CAR expressing cells, a retroviral vector is generally employed for transduction, however any other suitable viral vector or non-viral delivery system can be used. For subsequent genetic modification of the cells to provide cells comprising an antigen presenting complex comprising at least two co-stimulatory ligands, retroviral gene transfer (transduction) likewise proves effective. Combinations of retroviral vector and an appropriate packaging line are also suitable, where the capsid proteins will be functional for infecting human cells. Various amphotropic virus-producing cell lines are known, including, but not limited to, PA12 (Miller, et al. (1985) Mol. Cell. Biol. 5:431-437); PA317 (Miller, et al. (1986) Mol. Cell. Biol. 6:2895-2902); and CRIP (Danos, et al. (1988) Proc. Natl. Acad. Sci. USA 85:6460-6464). Non-amphotropic particles are suitable too, e.g., particles pseudotyped with VSVG, RD114 or GALV envelope and any other known in the art.
[0255] Possible methods of transduction also include direct co-culture of the cells with producer cells, e.g., by the method of Bregni, et al. (1992) Blood 80:1418-1422, or culturing with viral supernatant alone or concentrated vector stocks with or without appropriate growth factors and polycations, e.g., by the method of Xu, et al. (1994) Exp. Hemat. 22:223-230; and Hughes, et al. (1992) J. Clin. Invest. 89:1817.
[0256] Transducing viral vectors can be used to express a co-stimulatory ligand (e.g., 4-1BBL and IL-12) in an immunoresponsive cell. Preferably, the chosen vector exhibits high efficiency of infection and stable integration and expression (see, e.g., Cayouette et al., Human Gene Therapy 8:423-430, 1997; Kido et al., Current Eye Research 15:833-844, 1996; Bloomer et al., Journal of Virology 71:6641-6649, 1997; Naldini et al., Science 272:263 267, 1996; and Miyoshi et al., Proc. Natl. Acad. Sci. U.S.A. 94:10319, 1997). Other viral vectors that can be used include, for example, adenoviral, lentiviral, and adeno-associated viral vectors, vaccinia virus, a bovine papilloma virus, or a herpes virus, such as Epstein-Barr Virus (also see, for example, the vectors of Miller, Human Gene Therapy 15-14, 1990; Friedman, Science 244:1275-1281, 1989; Eglitis et al., BioTechniques 6:608-614, 1988; Tolstoshev et al., Current Opinion in Biotechnology 1:55-61, 1990; Sharp, The Lancet 337:1277-1278, 1991; Cornetta et al., Nucleic Acid Research and Molecular Biology 36:311-322, 1987; Anderson, Science 226:401-409, 1984; Moen, Blood Cells 17:407-416, 1991; Miller et al., Biotechnology 7:980-990, 1989; Le Gal La Salle et al., Science 259:988-990, 1993; and Johnson, Chest 107:77S-83S, 1995). Retroviral vectors are particularly well developed and have been used in clinical settings (Rosenberg et al., N. Engl. J. Med 323:370, 1990; Anderson et al., U.S. Pat. No. 5,399,346).
[0257] In certain non-limiting embodiments, the vector expressing a presently disclosed BCMA-targeted CAR is a retroviral vector, e.g., a 293galv9 retroviral vector.
[0258] Non-viral approaches can also be employed for the expression of a protein in cell. For example, a nucleic acid molecule can be introduced into a cell by administering the nucleic acid in the presence of lipofection (Feigner et al., Proc. Nat'l. Acad. Sci. U.S.A. 84:7413, 1987; Ono et al., Neuroscience Letters 17:259, 1990; Brigham et al., Am. J. Med. Sci. 298:278, 1989; Staubinger et al., Methods in Enzymology 101:512, 1983), asialoorosomucoid-polylysine conjugation (Wu et al., Journal of Biological Chemistry 263:14621, 1988; Wu et al., Journal of Biological Chemistry 264:16985, 1989), or by micro-injection under surgical conditions (Wolff et al., Science 247:1465, 1990). Other non-viral means for gene transfer include transfection in vitro using calcium phosphate, DEAE dextran, electroporation, and protoplast fusion. Liposomes can also be potentially beneficial for delivery of DNA into a cell. Transplantation of normal genes into the affected tissues of a subject can also be accomplished by transferring a normal nucleic acid into a cultivatable cell type ex vivo (e.g., an autologous or heterologous primary cell or progeny thereof), after which the cell (or its descendants) are injected into a targeted tissue or are injected systemically. Recombinant receptors can also be derived or obtained using transposases or targeted nucleases (e.g. Zinc finger nucleases, meganucleases, or TALE nucleases). Transient expression may be obtained by RNA electroporation.
[0259] cDNA expression for use in polynucleotide therapy methods can be directed from any suitable promoter (e.g., the human cytomegalovirus (CMV), simian virus 40 (SV40), or metallothionein promoters), and regulated by any appropriate mammalian regulatory element or intron (e.g. the elongation factor 1? enhancer/promoter/intron structure). For example, if desired, enhancers known to preferentially direct gene expression in specific cell types can be used to direct the expression of a nucleic acid. The enhancers used can include, without limitation, those that are characterized as tissue- or cell-specific enhancers. Alternatively, if a genomic clone is used as a therapeutic construct, regulation can be mediated by the cognate regulatory sequences or, if desired, by regulatory sequences derived from a heterologous source, including any of the promoters or regulatory elements described above.
[0260] The resulting cells can be grown under conditions similar to those for unmodified cells, whereby the modified cells can be expanded and used for a variety of purposes.
V. Polypeptides and Analogs and Polynucleotides
[0261] Also included in the presently disclosed subject matter are extracellular antigen-binding domains that specifically binds to a BCMA (e.g., human BCMA) (e.g., an scFv (e.g., a human scFv), a Fab, or a (Fab).sub.2), CD3?, CD8, CD28, etc. polypeptides or fragments thereof, and polynucleotides encoding thereof that are modified in ways that enhance their anti-tumor activity when expressed in an immunoresponsive cell. The presently disclosed subject matter provides methods for optimizing an amino acid sequence or a nucleic acid sequence by producing an alteration in the sequence. Such alterations may comprise certain mutations, deletions, insertions, or post-translational modifications. The presently disclosed subject matter further comprises analogs of any naturally-occurring polypeptide of the presently disclosed subject matter. Analogs can differ from a naturally-occurring polypeptide of the presently disclosed subject matter by amino acid sequence differences, by post-translational modifications, or by both. Analogs of the presently disclosed subject matter can generally exhibit at least about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99% or more identity with all or part of a naturally-occurring amino, acid sequence of the presently disclosed subject matter. The length of sequence comparison is at least 5, 10, 15, 20, 25, 50, 75, 100 or more amino acid residues. Again, in an exemplary approach to determining the degree of identity, a BLAST program may be used, with a probability score between e.sup.?3 and e.sup.?100 indicating a closely related sequence. Modifications comprise in vivo and in vitro chemical derivatization of polypeptides, e.g., acetylation, carboxylation, phosphorylation, or glycosylation; such modifications may occur during polypeptide synthesis or processing or following treatment with isolated modifying enzymes. Analogs can also differ from the naturally-occurring polypeptides of the presently disclosed subject matter by alterations in primary sequence. These include genetic variants, both natural and induced (for example, resulting from random mutagenesis by irradiation or exposure to ethanemethylsulfate or by site-specific mutagenesis as described in Sambrook, Fritsch and Maniatis, Molecular Cloning: A Laboratory Manual (2d ed.), CSH Press, 1989, or Ausubel et al., supra). Also included are cyclized peptides, molecules, and analogs which contain residues other than L-amina acids, e.g., D-amino acids or non-naturally occurring or synthetic amino acids, e.g., beta (?) or gamma (?) amino acids.
[0262] In addition to full-length polypeptides, the presently disclosed subject matter also provides fragments of any one of the polypeptides or peptide domains of the presently disclosed subject matter. A fragment can be at least 5, 10, 13, or 15 amino acids. In certain embodiments, a fragment is at least 20 contiguous amino acids, at least 30 contiguous amino acids, or at least 50 contiguous amino acids. In certain embodiments, a fragment is at least 60 to 80, 100, 200, 300 or more contiguous amino acids. Fragments of the presently disclosed subject matter can be generated by methods known to those of ordinary skill in the art or may result from normal protein processing (e.g., removal of amino acids from the nascent polypeptide that are not required for biological activity or removal of amino acids by alternative mRNA splicing or alternative protein processing events).
[0263] Non-protein analogs have a chemical structure designed to mimic the functional activity of a protein of the invention. Such analogs are administered according to methods of the presently disclosed subject matter. Such analogs may exceed the physiological activity of the original polypeptide. Methods of analog design are well known in the art, and synthesis of analogs can be carried out according to such methods by modifying the chemical structures such that the resultant analogs increase the anti-neoplastic activity of the original polypeptide when expressed in an immunoresponsive cell. These chemical modifications include, but are not limited to, substituting alternative R groups and varying the degree of saturation at specific carbon atoms of a reference polypeptide. The protein analogs can be relatively resistant to in vivo degradation, resulting in a more prolonged therapeutic effect upon administration. Assays for measuring functional activity include, but are not limited to, those described in the Examples below.
[0264] In accordance with the presently disclosed subject matter, the polynucleotides encoding an extracellular antigen-binding domain that specifically binds to BCMA (e.g., human BCMA) (e.g., an scFv (e.g., a human scFv), a Fab, or a (Fab).sub.2), CD3?, CD8, CD28) can be modified by codon optimization. Codon optimization can alter both naturally occurring and recombinant gene sequences to achieve the highest possible levels of productivity in any given expression system. Factors that are involved in different stages of protein expression include codon adaptability, mRNA structure, and various cis-elements in transcription and translation. Any suitable codon optimization methods or technologies that are known to ones skilled in the art can be used to modify the polynucleotids of the presently disclosed subject matter, including, but not limited to, OptimumGene?, Encor optimization, and Blue Heron.
VI. Administration
[0265] BCMA-targeted CARs and immunoresponsive cells expressing thereof of the presently disclosed subject matter can be provided systemically or directly to a subject for treating or preventing a neoplasia. In certain embodiments, the BCMA-targeted CARs and immunoresponsive cells expressing thereof are directly injected into an organ of interest (e.g., an organ affected by a neoplasia). Alternatively or additionally, the BCMA-targeted CARs and immunoresponsive cells expressing thereof are provided indirectly to the organ of interest, for example, by administration into the circulatory system (e.g., the tumor vasculature). Expansion and differentiation agents can be provided prior to, during or after administration of cells and compositions to increase production of T cells in vitro or in vivo.
[0266] BCMA-targeted CARs and immunoresponsive cells expressing thereof of the presently disclosed subject matter can be administered in any physiologically acceptable vehicle, normally intravascularly, although they may also be introduced into bone or other convenient site where the cells may find an appropriate site for regeneration and differentiation (e.g., thymus). Usually, at least 1?10.sup.5 cells can be administered, eventually reaching 1?10.sup.10 or more. A cell population comprising immunoresponsive cells expressing a BCMA-targeted CAR can comprise a purified population of cells. Those skilled in the art can readily determine the percentage of immunoresponsive cells in a cell population using various well-known methods, such as fluorescence activated cell sorting (FACS). The ranges of purity in cell populations comprising genetically modified immunoresponsive cells expressing a BCMA-specific CAR can be from about 50% to about 55%, from about 55% to about 60%, from about 65% to about 70%, from about 70% to about 75%, from about 75% to about 80%, from about 80% to about 85%; from about 85% to about 90%, from about 90% to about 95%, or from about 95 to about 100%. Dosages can be readily adjusted by those skilled in the art (e.g., a decrease in purity may require an increase in dosage). The immunoresponsive cells can be introduced by injection, catheter, or the like. If desired, factors can also be included, including, but not limited to, interleukins, e.g. IL-2, IL-3, IL 6, IL-11, IL-7, IL-12, IL-15, IL-21, as well as the other interleukins, the colony stimulating factors, such as G-, M- and GM-CSF, interferons, e.g., ?-interferon.
[0267] Compositions of the presently disclosed subject matter comprise pharmaceutical compositions comprising immunoresponsive cells expressing a BCMA-targeted CAR and a pharmaceutically acceptable carrier. Administration can be autologous or non-autologous. For example, immunoresponsive cells expressing a BCMA-targeted CAR and compositions comprising thereof can be obtained from one subject, and administered to the same subject or a different, compatible subject. Peripheral blood derived T cells of the presently disclosed subject matter or their progeny (e.g., in vivo, ex vivo or in vitro derived) can be administered via localized injection, including catheter administration, systemic injection, localized injection, intravenous injection, or parenteral administration. When administering a pharmaceutical composition of the presently disclosed subject matter (e.g., a pharmaceutical composition comprising immunoresponsive cells expressing a BCMA-targeted CAR), it can be formulated in a unit dosage injectable form (solution, suspension, emulsion).
VII. Formulations
[0268] Immunoresponsive cells expressing a generally BCMA-targeted CAR and compositions comprising thereof of the presently disclosed subject matter can be conveniently provided as sterile liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may be buffered to a selected pH. Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues. Liquid or viscous compositions can comprise carriers, which can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyol (for example, glycerol, propylene glycol, liquid polyethylene glycol, and the like) and suitable mixtures thereof.
[0269] Sterile injectable solutions can be prepared by incorporating the compositions comprising immunoresponsive cells expressing a generally BCMA-targeted CAR of the presently disclosed subject matter in the required amount of the appropriate solvent with various amounts of the other ingredients, as desired. Such compositions may be in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like. The compositions can also be lyophilized. The compositions can contain auxiliary substances such as wetting, dispersing, or emulsifying agents (e.g., methylcellulose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired. Standard texts, such as REMINGTON'S PHARMACEUTICAL SCIENCE, 17th edition, 1985, incorporated herein by reference, may be consulted to prepare suitable preparations, without undue experimentation.
[0270] Various additives which enhance the stability and sterility of the compositions, including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added. Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, and the like. Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, alum inurn monostearate and gelatin. According to the present invention, however, any vehicle, diluent, or additive used would have to be compatible with the immunoresponsive cells expressing a generally BCMA-targeted CAR of the presently disclosed subject matter.
[0271] The compositions can be isotonic, i.e., they can have the same osmotic pressure as blood and lacrimal fluid. The desired isotonicity of the compositions of the presently disclosed subject matter may be accomplished using sodium chloride, or other pharmaceutically acceptable agents such as dextrose, boric acid, sodium tartrate, propylene glycol or other inorganic or organic solutes. Sodium chloride is preferred particularly for buffers containing sodium ions.
[0272] Viscosity of the compositions, if desired, can be maintained at the selected level using a pharmaceutically acceptable thickening agent. Methylcellulose can be used because it is readily and economically available and is easy to work with. Other suitable thickening agents include, for example, xanthan gum, carboxymethyl cellulose, hydroxypropyl cellulose, carbomer, and the like. The concentration of the thickener can depend upon the agent selected. The important point is to use an amount that will achieve the selected viscosity. Obviously, the choice of suitable carriers and other additives will depend on the exact route of administration and the nature of the particular dosage form, e.g., liquid dosage form (e.g., whether the composition is to be formulated into a solution, a suspension, gel or another liquid form, such as a time release form or liquid-filled form).
[0273] Those skilled in the art will recognize that the components of the compositions should be selected to be chemically inert and will not affect the viability or efficacy of the immunoresponsive cells as describe in the presently disclosed subject matter. This will present no problem to those skilled in chemical and pharmaceutical principles, or problems can be readily avoided by reference to standard texts or by simple experiments (not involving undue experimentation), from this disclosure and the documents cited herein.
[0274] One consideration concerning the therapeutic use of the immunoresponsive cells of the presently disclosed subject matter is the quantity of cells necessary to achieve an optimal effect. The quantity of cells to be administered will vary for the subject being treated. In certain embodiments, from about 10.sup.4 to about 10.sup.10, from about 10.sup.5 to about 10.sup.9, or from about 10.sup.6 to about 10.sup.8 immunoresponsive cells of the presently disclosed subject matter are administered to a subject. More effective cells may be administered in even smaller numbers. In certain embodiments, at least about 1?10.sup.8, about 2?10.sup.8, about 3?10.sup.8, about 4?10.sup.8, and about 5?10.sup.8 immunoresponsive cells of the presently disclosed subject matter are administered to a human subject. The precise determination of what would be considered an effective dose may be based on factors individual to each subject, including their size, age, sex, weight, and condition of the particular subject. Dosages can be readily ascertained by those skilled in the art from this disclosure and the knowledge in the art.
[0275] The skilled artisan can readily determine the amount of cells and optional additives, vehicles, and/or carrier in compositions and to be administered in methods of the presently disclosed subject matter. Typically, any additives (in addition to the active cell(s) and/or agent(s)) are present in an amount of from about 0.001% to about 50% by weight) solution in phosphate buffered saline, and the active ingredient is present in the order of micrograms to milligrams, such as from about 0.0001 wt % to about 5 wt %, from about 0.0001 wt % to about 1 wt %, from about 0.0001 wt % to about 0.05 wt %, from about 0.001 wt % to about 20 wt %, from about 0.01 wt % to about 10 wt %, or from about 0.05 wt % to about 5 wt %. For any composition to be administered to an animal or human, and for any particular method of administration, toxicity should be determined, such as by determining the lethal dose (LD) and LD50 in a suitable animal model e.g., rodent such as mouse; and, the dosage of the composition(s), concentration of components therein and timing of administering the composition(s), which elicit a suitable response. Such determinations do not require undue experimentation from the knowledge of the skilled artisan, this disclosure and the documents cited herein. And, the time for sequential administrations can be ascertained without undue experimentation.
VIII. Methods of Treatment
[0276] Tumor Microenvironment.
[0277] Tumors have a microenvironment that is hostile to the host immune response involving a series of mechanisms by malignant cells to protect themselves from immune recognition and elimination. This hostile tumor microenvironment comprises a variety of immune suppressive factors including infiltrating regulatory CD4.sup.+ T cells (Tregs), myeloid derived suppressor cells (MDSCs), tumor associated macrophages (TAMs), immune suppressive cytokines including IL-10 and TGF-?, and expression of ligands targeted to immune suppressive receptors expressed by activated T cells (CTLA-4 and PD-1). These mechanisms of immune suppression play a role in the maintenance of tolerance and suppressing inappropriate immune responses, however within the tumor microenvironment these mechanisms prevent an effective anti-tumor immune response. Collectively these immune suppressive factors can induce either marked anergy or apoptosis of adoptively transferred CAR modified T cells upon encounter with targeted tumor cells.
[0278] Challenges in Tumor Immunology.
[0279] Effective tumor immunity requires recognition of tumor antigens and unopposed tumor elimination by immune effector cells. Tumor antigens must contain peptide epitopes that are presented by the tumor and can be recognized by specific cytotoxic T lymphocytes (CTLs). The primed CTLs must expand to a sufficient number and migrate to tumor sites, wherein they mature into effectors to perform their functions, which are enhanced by helper T cells and dampened by Tregs and inhibitory macrophages.
[0280] Targeted T Cell Therapy with Engineered T Lymphocytes.
[0281] T cell engineering is a groundbreaking strategy to potentially resolve many previously observed shortcomings of earlier immunotherapeutic approaches. Within the past year, researchers have reported dramatic complete remissions in relapsed.sup.16,17, chemorefractory leukemia and metastatic melanoma.sup.18-20, obtained with autologous peripheral blood T cells targeted to a defined antigen (CD19 and NY-ESO-1, respectively).
[0282] Rationale for a Genetic Approach:
[0283] Cell engineering can be used to redirect T cells toward tumor antigens and to enhance T cell function. One impetus for genetic T cell modification is the potential to enhance T cell survival and expansion and to offset T cell death, anergy, and immune suppression. The genetic targeting of T cells can also be refined to prevent undesired destruction of normal tissues.
[0284] Chimeric Antigen Receptors (CARs):
[0285] Tumor-specific T cells can be generated by the transfer of genes that encode CARs.sup.21-26. Second-generation CARs comprise a tumor antigen-binding domain fused to an intracellular signaling domain capable of activating T cells and a co-stimulatory domain designed to augment T cell potency and persistence.sup.27. CAR design can therefore reconcile antigen recognition with signal transduction, two functions that are physiologically borne by two separate complexes, the TCR heterodimer and the CD3 complex. The CAR's extracellular antigen-binding domain is usually derived from a murine monoclonal antibody (mAb) or from receptors or their ligands. Antigen recognition is therefore not MHC-restricted.sup.28,29 and is therefore applicable to any patient expressing the target antigen, using the same CAR. Antigen binding by the CARs triggers phosphorylation of immunoreceptor tyrosine-based activation motifs (ITAMs) in the intracellular domain, initiating a signaling cascade required for cytolysis induction, cytokine secretion, and proliferation. Because MHC restriction of antigen recognition is bypassed, the function of CAR-targeted T cells is not affected by HLA downregulation or defects in the antigen-processing machinery.
[0286] T Cell Requirements for Expansion and Survival:
[0287] Proliferation of tumor-specific T cells is needed ex vivo and is arguably desirable in vivo. T cell proliferation must be accompanied by T cell survival to permit absolute T cell expansion and persistence. To proliferate in response to antigen, T cells must receive two signals. One is provided by TCR recognition of antigenic peptide/MHC complexes displayed on the surface of antigen-presenting cells (APCs).sup.25. The other is provided by a T cell co-stimulatory receptor, such as the CD28 or 4-1BB receptors. Whereas the cytolytic activity of T cells does not require concomitant co-stimulation, there is a critical need for the provision of co-stimulatory signals to sustain the antitumor functions of adoptively transferred T cells, as previously demonstrated.sup.23,27,30-32.
[0288] Immune Monitoring:
[0289] Lymphocytes are multifunctional drugs that exhibit dynamically evolving effects after infusion. Upon antigen encounter, tumor-specific T cells activate and/or release a variety of proteins that can trigger tumor killing, T cell proliferation, and recruitment or immunomodulation of other immune cells. Thus, measuring which proteins are secreted from which cells, in what quantity, and at what time point yields profound insights into why a particular patient is or is not responding and provides critical feedback for designing more-effective trials. These assay systems will permit direct and meaningful comparisons of clinical approaches and thus help design rational, next-generation therapeutic strategies.
[0290] For treatment, the amount administered is an amount effective in producing the desired effect. An effective amount can be provided in one or a series of administrations. An effective amount can be provided in a bolus or by continuous perfusion.
[0291] An effective amount (or, therapeutically effective amount) is an amount sufficient to affect a beneficial or desired clinical result upon treatment. An effective amount can be administered to a subject in one or more doses. In terms of treatment, an effective amount is an amount that is sufficient to palliate, ameliorate, stabilize, reverse or slow the progression of the disease, or otherwise reduce the pathological consequences of the disease. The effective amount is generally determined by the physician on a case-by-case basis and is within the skill of one in the art. Several factors are typically taken into account when determining an appropriate dosage to achieve an effective amount. These factors include age, sex and weight of the subject, the condition being treated, the severity of the condition and the form and effective concentration of the immunoresponsive cells administered.
[0292] For adoptive immunotherapy using antigen-specific T cells, cell doses in the range of about 10.sup.6 to about 10.sup.10 (e.g., about 10.sup.9) are typically infused. Upon administration of the immunoresponsive cells into the subject and subsequent differentiation, the immunoresponsive cells are induced that are specifically directed against one specific antigen (e.g., BCMA). Induction of T cells can include inactivation of antigen-specific T cells such as by deletion or anergy. Inactivation is particularly useful to establish or reestablish tolerance such as in autoimmune disorders. The immunoresponsive cells of the presently disclosed subject matter can be administered by any methods known in the art, including, but not limited to, pleural administration, intravenous administration, subcutaneous administration, intranodal administration, intratumoral administration, intrathecal administration, intrapleural administration, intraperitoneal administration, and direct administration to the thymus. In certain embodiments, the immunoresponsive cells and the compositions comprising thereof are intravenously administered to the subject in need.
[0293] The presently disclosed subject matter provides various methods of using the immunoresponsive cells (e.g., T cells) expressing a BCMA-targeted CAR. For example, the presently disclosed subject matter provides methods of reducing tumor burden in a subject. In one non-limiting example, the method of reducing tumor burden comprises administering an effective amount of the presently disclosed immunoresponsive cell to the subject, thereby inducing tumor cell death in the subject. The presently disclosed immunoresponsive cell can reduce the number of tumor cells, reduce tumor size, and/or eradicate the tumor in the subject. Non-limiting examples of suitable tumor include multiple myeloma, Non-Hodgkin Lymphoma, Hodgkin Lymphoma, Chronic Lymphocytic Leukemia (CLL), glioblastoma, and Waldenstrom's Macroglobulinemia. In certain embodiments, the tumor is multiple myeloma.
[0294] The presently disclosed subject matter also provides methods of increasing or lengthening survival of a subject having a neoplasia. In one non-limiting example, the method of increasing or lengthening survival of a subject having neoplasia comprises administering an effective amount of the presently disclosed immunoresponsive cell to the subject, thereby increasing or lengthening survival of the subject. The method can reduce or eradicate tumor burden in the subject. The presently disclosed subject matter further provides methods for treating or preventing a neoplasia in a subject, comprising administering the presently disclosed immunoresponsive cell to the subject.
[0295] As used herein, the term neoplasia refers to a disease characterized by the pathological proliferation of a cell or tissue and its subsequent migration to or invasion of other tissues or organs. Neoplasia growth is typically uncontrolled and progressive, and occurs under conditions that would not elicit, or would cause cessation of, multiplication of normal cells. Neoplasias can affect a variety of cell types, tissues, or organs, including but not limited to an organ selected from the group consisting of bladder, colon, bone, brain, breast, cartilage, glia, esophagus, fallopian tube, gallbladder, heart, intestines, kidney, liver, lung, lymph node, nervous tissue, ovaries, pleura, pancreas, prostate, skeletal muscle, skin, spinal cord, spleen, stomach, testes, thymus, thyroid, trachea, urogenital tract, ureter, urethra, uterus, and vagina, or a tissue or cell type thereof. Neoplasias include cancers, such as sarcomas, carcinomas, or plasmacytomas (malignant tumor of the plasma cells).
[0296] Cancers whose growth may be inhibited using the immunoresponsive cells of the presently disclosed subject matter comprise cancers typically responsive to immunotherapy. Non-limiting examples of cancers for treatment include multiple myeloma, Non-Hodgkin Lymphoma, Hodgkin Lymphoma, Chronic Lymphocytic Leukemia (CLL), glioblastoma, and Waldenstrom's Macroglobulinemia. In certain embodiments, the cancer is multiple myeloma.
[0297] Additionally, the presently disclosed subject matter provides methods of increasing immune-activating cytokine production in response to a cancer cell in a subject. In one non-limiting example, the method comprises administering the presently disclosed immunoresponsive cell to the subject. The immune-activating cytokine can be granulocyte macrophage colony stimulating factor (GM-CSF), IFN-?, IFN-?, IFN-?, TNF-?, IL-2, IL-3, IL-6, IL-11, IL-7, IL-12, IL-15, IL-21, interferon regulatory factor 7 (IRF7), and combinations thereof. In certain embodiments, the immunoresponsive cells including a BCMA-specific CAR of the presently disclosed subject matter increase the production of GM-CSF, IFN-?, and/or TNF-?.
[0298] Suitable human subjects for therapy typically comprise two treatment groups that can be distinguished by clinical criteria. Subjects with advanced disease or high tumor burden are those who bear a clinically measurable tumor (e.g., multiple myeloma). A clinically measurable tumor is one that can be detected on the basis of tumor mass (e.g., by palpation, CAT scan, sonogram, mammogram or X-ray; positive biochemical or histopathologic markers on their own are insufficient to identify this population). A pharmaceutical composition embodied in the presently disclosed subject matter is administered to these subjects to elicit an anti-tumor response, with the objective of palliating their condition. Ideally, reduction in tumor mass occurs as a result, but any clinical improvement constitutes a benefit. Clinical improvement comprises decreased risk or rate of progression or reduction in pathological consequences of the tumor (e.g., multiple myeloma).
[0299] A second group of suitable subjects is known in the art as the adjuvant group. These are individuals who have had a history of neoplasia (e.g., multiple myeloma), but have been responsive to another mode of therapy. The prior therapy can have included, but is not restricted to, surgical resection, radiotherapy, and traditional chemotherapy. As a result, these individuals have no clinically measurable tumor. However, they are suspected of being at risk for progression of the disease, either near the original tumor site, or by metastases. This group can be further subdivided into high-risk and low-risk individuals. The subdivision is made on the basis of features observed before or after the initial treatment. These features are known in the clinical arts, and are suitably defined for each different neoplasia. Features typical of high-risk subgroups are those in which the tumor (e.g., multiple myeloma) has invaded neighboring tissues, or who show involvement of lymph nodes. Another group has a genetic predisposition to neoplasia (e.g., multiple myeloma) but has not yet evidenced clinical signs of neoplasia (e.g., multiple myeloma). For instance, women testing positive for a genetic mutation associated with breast cancer, but still of childbearing age, can wish to receive one or more of the antigen-binding fragments described herein in treatment prophylactically to prevent the occurrence of neoplasia until it is suitable to perform preventive surgery.
[0300] The subjects can have an advanced form of disease (e.g., multiple myeloma), in which case the treatment objective can include mitigation or reversal of disease progression, and/or amelioration of side effects. The subjects can have a history of the condition, for which they have already been treated, in which case the therapeutic objective will typically include a decrease or delay in the risk of recurrence.
[0301] Further modification can be introduced to the BCMA-targeted CAR-expressing immunoresponsive cells (e.g., T cells) to avert or minimize the risks of immunological complications (known as malignant T-cell transformation), e.g., graft versus-host disease (GvHD), or when healthy tissues express the same target antigens as the tumor cells, leading to outcomes similar to GvHD. A potential solution to this problem is engineering a suicide gene into the CAR-expressing T cells. Suitable suicide genes include, but are not limited to, Herpes simplex virus thymidine kinase (hsv-tk), inducible Caspase 9 Suicide gene (iCasp-9), and a truncated human epidermal growth factor receptor (EGFRt) polypeptide. In certain embodiments, the suicide gene is an EGFRt polypeptide. The EGFRt polypeptide can enable T cell elimination by administering anti-EGFR monoclonal antibody (e.g., cetuximab). EGFRt can be covalently joined to the 3 terminus of the intracellular domain of the BCMA-targeted CAR. The suicide gene can be included within the vector comprising nucleic acids encoding the presently disclosed BCMA-targeted CARs. In this way, administration of a prodrug designed to activate the suicide gene (e.g., a prodrug (e.g., AP1903 that can activates iCasp-9) during malignant T-cell transformation (e.g., GVHD) triggers apoptosis in the suicide gene-activated CAR-expressing T cells.
IX. Kits
[0302] The presently disclosed subject matter provides kits for the treatment or prevention of a neoplasia (e.g., multiple myeloma). In certain embodiments, the kit comprises a therapeutic or prophylactic composition containing an effective amount of an immunoresponsive cell comprising a BCMA-targeted CAR in unit dosage form. In particular embodiments, the cells further expresses at least one co-stimulatory ligand. In certain embodiments, the kit comprises a sterile container which contains a therapeutic or prophylactic vaccine; such containers can be boxes, ampules, bottles, vials, tubes, bags, pouches, blister-packs, or other suitable container forms known in the art. Such containers can be made of plastic, glass, laminated paper, metal foil, or other materials suitable for holding medicaments.
[0303] If desired, the immunoresponsive cell is provided together with instructions for administering the cell to a subject having or at risk of developing a neoplasia (e.g., multiple myeloma). The instructions will generally include information about the use of the composition for the treatment or prevention of a neoplasia (e.g., multiple myeloma). In other embodiments, the instructions include at least one of the following: description of the therapeutic agent; dosage schedule and administration for treatment or prevention of a neoplasia (e.g., multiple myeloma) or symptoms thereof; precautions; warnings; indications; counter-indications; overdosage information; adverse reactions; animal pharmacology; clinical studies; and/or references. The instructions may be printed directly on the container (when present), or as a label applied to the container, or as a separate sheet, pamphlet, card, or folder supplied in or with the container.
EXAMPLES
[0304] The practice of the present invention employs, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry and immunology, which are well within the purview of the skilled artisan. Such techniques are explained fully in the literature, such as, Molecular Cloning: A Laboratory Manual, second edition (Sambrook, 1989); Oligonucleotide Synthesis (Gait, 1984); Animal Cell Culture (Freshney, 1987); Methods in Enzymology Handbook of Experimental Immunology (Weir, 1996); Gene Transfer Vectors for Mammalian Cells (Miller and Calos, 1987); Current Protocols in Molecular Biology (Ausubel, 1987); PCR: The Polymerase Chain Reaction, (Mullis, 1994); Current Protocols in Immunology (Coligan, 1991). These techniques are applicable to the production of the polynucleotides and polypeptides of the invention, and, as such, may be considered in making and practicing the invention. Particularly useful techniques for particular embodiments will be discussed in the sections that follow.
[0305] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to make and use the assay, screening, and therapeutic methods of the invention, and are not intended to limit the scope of what the inventors regard as their invention.
Example 1BCMA Expression in Various Tissues
[0306] The Expression of human BCMA was evaluated in various malignant and normal tissues by investigating gene expression profiles in databases such as the cancer cell line encyclopedia and BioGPS. As shown in
Example 2Construct of BCMA-Specific 28z CARs
[0307] Multiple unique fully human scFv's to BCMA were generated, and CARs based on these scFv's were generated. Multiple scFv's were identified by screening a fully human scFv phage library (>6?10.sup.10 scFv's) with BCMA-Fc fusion protein and then 3T3 cells expressing human BCMA. After sequencing, 57 unique and BCMA-Fc positive clones were found out of 79 sequenced positive clones; the unique clone rate was 72%. FACS analysis of phage antibody clones against BCMA-3T3 and parental 3T3 cell lines resulted in confirming 25 unique positive clones.
[0308] ET140-153 scFv (or ET140-3 scFv), ET140-174 scFv (or ET140-24 scFv), ET140-187 scFv (or ET140-37 scFv), ET140-190 scFv (or ET140-40 scFv), and ET140-204 scFv (or ET140-54 scFv) were used to generate BCMA-targeted 28z CARs 3, 24, 37, 40, and 54, respectively. These BCMA-targeted 28z CARs have similar structure, e.g., each has a transmembrane domain comprising a CD28 polypeptide, and an intracellular domain comprising a CD3? polypeptide and a co-stimulatory signaling region that comprises a CD28 polypeptide, as shown in
[0309] Human T cells (unselected (CD4 and CD8) human T cells from a healthy donor) were transduced with retrovirus in order to express each of these BCMA-targeted CARs such that the T cells expressed these BCMA-targeted 28z CARs. The cell surface expression of BCMA-targeted CARs on human T cells was determined via binding A647 conjugated BCMA-Fc fusion protein. The cell surface expression of BCMA-targeted 28z CAR24 was assessed, and cell surface detection was valided by flow cytometry, as shown in
[0310] The cross-reacting activity of seventeen human scFv's between human BCMA and mouse BCMA was assessed. As shown in
Example 3Activity of BCMA-Specific CARs
[0311] The anti-tumor activity of the presently disclosed BCMA-specific 28z CARs was evaluated. The in vitro data showed that the BCMA-specific CARs specifically killed BCMA presenting cells, including MINI cell lines. For example, as shown in
Example 4Screening Data for Anti-BCMA Antibodies
[0312] ELISA Screening:
[0313]
[0314] FACS Screening:
[0315]
Example 5Construct of BCMA-Specific BBz CARs
[0316] Multiple unique fully human scFv's to BCMA were generated as described in Example 2. ET140-153 scFv (or ET140-3 scFv), ET140-174 scFv (or ET140-24 scFv), ET140-187 scFv (or ET140-37 scFv), ET140-190 scFv (or ET140-40 scFv), and ET140-204 scFv (or ET140-54 scFv) were used to generate BCMA-targeted BBz CARs 3, 24, 37, 40, and 54, respectively. Each of these BCMA-targeted BBz CARs has a transmembrane domain comprising a CD8 polypeptide, and an intracellular domain comprising a CD3? polypeptide and a co-stimulatory signaling region that comprises a 4-1BB polypeptide, as shown in
Example 6Activity of BCMA-Targeted CAR T Cells
[0317] As shown in
Example 7Induction of Cytokine Secretion by BCMA-Targeted CAR T Cells
[0318] Co-culture of BCMA targeted 28z CAR24 T cells specifically with MM cell line induced cytokine secretion profile consistent with T cell activation.
Example 8Anti-Tumor Activity of BCMA-Targeted CAR T Cells
[0319] BCMA targeted 28z CAR54 T cells mediated an anti-myeloma immune response. 1?10.sup.7 U266 human myeloma cell line cells were injected IV into NSG mice on day 0. On day 4 1?10.sup.6 BCMA targeted or CD19 targeted second generation CAR T cells were injected IV. Imaging on day 11 (day 7 s/p CAR T cell injection) shows that, unlike irrelevant (CD19) targeted CAR T cells; BCMA targeted 28z CAR54 T cells can mediate an anti-tumor response. See
Example 9Activity of BCMA-Targeted CAR T Cells
[0320] The ability of BCMA targeted CAR T cells to specifically lyse human myeloma cell line (HMCL) was tested. CD19 targeted CAR T cells or BCMA targeted 28z CAR24 T cells were incubated with GFP expressing tumor cell lines SET2 (Acute myeloid leukemia (AML), CD19.sup.?BCMA.sup.?); BCWM1 (Lymphoplasmacytic Lymphoma (LPL), CD19.sup.?BCMA.sup.?); L363 (Multiple Myeloma (MM), CD19.sup.?BCMA.sup.+). At time 0, the percent of GFP.sup.+ tumor line is shown in
Example 10Epitope Mapping of Anti-BCMAAntibodies
[0321] BCMA peptides were ordered based on the ECD sequence with N-terminal Biotin+SGSG linker+15 amino acids with 1 amino acid space. The peptide library is shown in Table 24.
TABLE-US-00074 TABLE 24 ET140-p1 SGSGLQMAGQCSQNEYFDS [SEQ ID NO: 236] ET140-p2 SGSGQMAGQCSQNEYFDSL [SEQ ID NO: 237] ET140-p3 SGSGMAGQCSQNEYFDSLL [SEQ ID NO: 238] ET140-p4 SGSGAGQCSQNEYFDSLLH [SEQ ID NO: 239] ET140-p5 SGSGGQCSQNEYFDSLLHA [SEQ ID NO: 240] ET140-p6 SGSGQCSQNEYFDSLLHAC [SEQ ID NO: 241] ET140-p7 SGSGCSQNEYFDSLLHACI [SEQ ID NO: 242] ET140-p8 SGSGSQNEYFDSLLHACIP [SEQ ID NO: 243] ET140-p9 SGSGQNEYFDSLLHACIPC [SEQ ID NO: 244] ET140-p10 SGSGNEYFDSLLHACIPCQ [SEQ ID NO: 245] ET140-p11 SGSGEYFDSLLHACIPCQL [SEQ ID NO: 246] ET140-p12 SGSGYFDSLLHACIPCQLR [SEQ ID NO: 247] ET140-p13 SGSGFDSLLHACIPCQLRC [SEQ ID NO: 248] ET140-p14 SGSGDSLLHACIPCQLRCS [SEQ ID NO: 249] ET140-p15 SGSGSLLHACIPCQLRCSS [SEQ ID NO: 250] ET140-p16 SGSGLLHACIPCQLRCSSN [SEQ ID NO: 251] ET140-p17 SGSGLHACIPCQLRCSSNT [SEQ ID NO: 252] ET140-p18 SGSGHACIPCQLRCSSNTP [SEQ ID NO: 253] ET140-p19 SGSGACIPCQLRCSSNTPP [SEQ ID NO: 254] ET140-p20 SGSGCIPCQLRCSSNTPPL [SEQ ID NO: 255] ET140-p21 SGSGIPCQLRCSSNTPPLT [SEQ ID NO: 256] ET140-p22 SGSGPCQLRCSSNTPPLTC [SEQ ID NO: 257] ET140-p23 SGSGCQLRCSSNTPPLTCQ [SEQ ID NO: 258] ET140-p24 SGSGQLRCSSNTPPLTCQR [SEQ ID NO: 259] ET140-p25 SGSGLRCSSNTPPLTCQRY [SEQ ID NO: 260] ET140-p26 SGSGRCSSNTPPLTCQRYC [SEQ ID NO: 261] ET140-p27 SGSGCSSNTPPLTCQRYCN [SEQ ID NO: 262] ET140-p28 SGSGSSNTPPLTCQRYCNA [SEQ ID NO: 263] ET140-p29 SGSGSNTPPLTCQRYCNAS [SEQ ID NO: 264] ET140-p30 SGSGNTPPLTCQRYCNASV [SEQ ID NO: 265] ET140-p31 SGSGTPPLTCQRYCNASVT [SEQ ID NO: 266] ET140-p32 SGSGPPLTCQRYCNASVTN [SEQ ID NO: 267] ET140-p33 SGSGPLTCQRYCNASVTNS [SEQ ID NO: 268] ET140-p34 SGSGLTCQRYCNASVTNSV [SEQ ID NO: 269] ET140-p35 SGSGTCQRYCNASVTNSVK [SEQ ID NO: 270] ET140-p36 SGSGCQRYCNASVTNSVKG [SEQ ID NO: 271] ET140-p37 SGSGQRYCNASVTNSVKGT [SEQ ID NO: 272] ET140-p38 SGSGRYCNASVTNSVKGTN [SEQ ID NO: 273] ET140-p39 SGSGYCNASVTNSVKGTNA [SEQ ID NO: 274]
[0322] The peptides were coated onto Streptavidin plates at 2 ug/mL in PBST (PBS+0.05% Tween-20). After washing and blocking with 3% BSA. After washing, 1 ug/mL ET140-3, ET140-24, ET140-54 or ET901 mIgG1 was added to the wells, respectively. mIgG1 used in all Examples represents that the variable region is fully human and the Fc part is mouse IgG1. Then HRP anti-mouse IgG detection antibody was added to each well. Finally, the color was developed using TMB substrate. A450 was recorded for data analysis. The results are shown in
[0323] Summary:
[0324] 3 ET140 antibodies (mIgG1) were tested together with isotype control ET901 mIgG1 for their binding epitope towards BCMA-ECD. A peptide library consisting of 39 peptides (N-terminal biotin+SGSG linker+15 amino acids, with 1 amino acid offset) was used for epitope mapping ELISA. This allows to search for the linear binding epitope of BCMA-ECD. ET901 mIgG1 was used as background reference for each peptide. Only ET140-3 can be identified for its epitope region: a region comprising amino acids 14-22 of SEQ ID NO:71, e.g., amino acids 8-28 of SEQ ID NO: 71.
[0325] ET140-24 and ET140-54 did not show any significant binding towards peptide library. This indicated that these two antibodies may recognize conformational epitope rather than linear epitope of BCMA.
Example 11Anti-BCMA Antibodies Recombinant Antigen by Surface Plasmon Resonance
[0326] Kinetics of interaction between ET140-153 mIgG1 (or ET140-3 mIgG1), ET140-174 mIgG1 (or ET140-24 mIgG1), ET140-204 mIgG1 (or ET140-54 mIgG1) and BCMA recombinant antigen was measured using a BIAcore ?100 instrument. In brief, 50 ?g/mL of modified streptavidin was immobilized onto a Sensor Chip CAP by flowing the Biotin CAPture Reagent through the flow cells at 2 ?L/min for 5 minutes. 10 ug/mL biotinylated BCMA-Fc protein was loaded onto the flow cell at a rate of 30 ?L/min for 3 minutes. Following the standard protocol for kinetics, a series of injection of ESK1 was performed between 0.6 and 15 ?g/mL, each step consisting of a 3 minute injection at 30 ?L/min and 3 minute disassociation. Afterwards, the surface was regenerated for 2 minutes with a solution consisting of 75% v/v of 8M guanidine-HCl and 25% v/v 1M NaOH. Kinetic constants were derived by the global fitting (1:1 Langmuir binding model) using BIAcore ?100 Evaluation Software (Version 2.0.1). The binding affinity data are shown in Table 25.
TABLE-US-00075 TABLE 25 Protein KD ET140-24 mIgG1 KD: 4.8 nM (BiaCore) ET140-54 mIgG1 KD: 8.1 nM (BiaCore) ET140-3 mIgG1 KD: 1.2 nM (BiaCore)
[0327] Although the foregoing presently disclosed subject matter has been described in some detail by way of illustration and example for purposes of clarity of understanding, the descriptions and examples should not be construed as limiting the scope of the presently disclosed subject matter. The disclosures of all patent and scientific literature cited herein are expressly incorporated in their entirety by reference.
REFERENCES
[0328] 1. Frigyesi, I., et al. Robust isolation of malignant plasma cells in multiple myeloma. Blood 123, 1336-1340 (2014). [0329] 2. Tai, Y. T., et al. Novel afucosylated anti-B cell maturation antigen-monomethyl auristatin F antibody-drug conjugate (GSK2857916) induces potent and selective anti-multiple myeloma activity. Blood (2014). [0330] 3. Carpenter, R. O., et al. B-cell maturation antigen is a promising target for adoptive T-cell therapy of multiple myeloma. Clinical cancer research: an official journal of the American Association for Cancer Research 19, 2048-2060 (2013). [0331] 4. Brentjens, R. J., et al. Safety and persistence of adoptively transferred autologous CD19-targeted T cells in patients with relapsed or chemotherapy refractory B-cell leukemias. Blood 118, 4817-4828 (2011). [0332] 5. Brentjens, R. J., et al. Eradication of systemic B-cell tumors by genetically targeted human T lymphocytes co-stimulated by CD80 and interleukin-15. Nature medicine 9, 279-286 (2003). [0333] 6. Brentjens, R. J., et al. CD19-Targeted T Cells Rapidly Induce Molecular Remissions in Adults with Chemotherapy-Refractory Acute Lymphoblastic Leukemia. Science translational medicine 5, 177ra138 (2013). [0334] 7. Davila, M. L., et al. Efficacy and Toxicity Management of 19-28z CAR T Cell Therapy in B Cell Acute Lymphoblastic Leukemia. Science translational medicine 6, 224ra225 (2014). [0335] 8. Siegel, R., Naishadham, D. & Jemal, A. Cancer statistics, 2013. CA: a cancer journal for clinicians 63, 11-30 (2013). [0336] 9. Boyd, K. D., et al. The clinical impact and molecular biology of del(17p) in multiple myeloma treated with conventional or thalidomide-based therapy. Genes, chromosomes & cancer 50, 765-774 (2011). [0337] 10. Shaughnessy, J. D., Jr., et al. A validated gene expression model of high-risk multiple myeloma is defined by deregulated expression of genes mapping to chromosome 1. Blood 109, 2276-2284 (2007). [0338] 11. Gahrton, G., et al. Allogeneic bone marrow transplantation in multiple myeloma. European Group for Bone Marrow Transplantation. The New England journal of medicine 325, 1267-1273 (1991). [0339] 12. Pegram, H. J., et al. Tumor-targeted T cells modified to secrete IL-12 eradicate systemic tumors without need for prior conditioning. Blood 119, 4133-4141 (2012). [0340] 13. Sabrina Bertilaccio, M. T., et al. Low-Dose Lenalidomide Improves CAR-Based Immunotherapy In CLL By Reverting T-Cell Defects In Vivo. Blood 122, 4171 (2013). [0341] 14. Bataille, R., et al. The phenotype of normal, reactive and malignant plasma cells. Identification of many and multiple myelomas and of new targets for myeloma therapy. Haematologica 91, 1234-1240 (2006). [0342] 15. Morgan, R. A., et al. Case report of a serious adverse event following the administration of T cells transduced with a chimeric antigen receptor recognizing ERBB2. Molecular therapy: the journal of the American Society of Gene Therapy 18, 843-851 (2010). [0343] 16. Brentjens, R. J., et al. Safety and persistence of adoptively transferred autologous CD19-targeted T cells in patients with relapsed or chemotherapy refractory B-cell leukemias. Blood 118, 4817-4828 (2011). [0344] 17. Brentjens, R. J., et al. CD19-targeted T cells rapidly induce molecular remissions in adults with chemotherapy-refractory acute lymphoblastic leukemia. Science translational medicine 5, 177ra138 (2013). [0345] 18. Hunder, N. N., et al. Treatment of metastatic melanoma with autologous CD4+ T cells against NY-ESO-1. N. Engl. J. Med. 358, 2698-2703 (2008). [0346] 19. Rosenberg, S. A., Restifo, N. P., Yang, J. C., Morgan, R. A. & Dudley, M. E. Adoptive cell transfer: a clinical path to effective cancer immunotherapy. Nat. Rev. Cancer 8, 299-308 (2008). [0347] 20. Dudley, M. E., et al. Adoptive cell therapy for patients with metastatic melanoma: evaluation of intensive myeloablative chemoradiation preparative regimens. J Clin Oncol 26, 5233-5239 (2008). [0348] 21. Brentjens, R. J., et al. Genetically targeted T cells eradicate systemic acute lymphoblastic leukemia xenografts. Clin. Cancer Res. 13, 5426-5435 (2007). [0349] 22. Gade, T. P., et al. Targeted elimination of prostate cancer by genetically directed human T lymphocytes. Cancer Res. 65, 9080-9088 (2005). [0350] 23. Maher, J., Brentjens, R. J., Gunset, G., Riviere, I. & Sadelain, M. Human T-lymphocyte cytotoxicity and proliferation directed by a single chimeric TCRzeta/CD28 receptor. Nat. Biotechnol. 20, 70-75 (2002). [0351] 24. Kershaw, M. H., et al. Gene-engineered T cells as a superior adjuvant therapy for metastatic cancer. J Immunol 173, 2143-2150 (2004). [0352] 25. Sadelain, M., Brentjens, R. & Riviere, I. The promise and potential pitfalls of chimeric antigen receptors. Curr Opin Immunol (2009). [0353] 26. Hollyman, D., et al. Manufacturing validation of biologically functional T cells targeted to CD19 antigen for autologous adoptive cell therapy. J Immunother 32, 169-180 (2009). [0354] 27. Sadelain, M., Brentjens, R. & Riviere, I. The basic principles of chimeric antigen receptor design. Cancer discovery 3, 388-398 (2013). [0355] 28. Riviere, I., Sadelain, M. & Brentjens, R. J. Novel strategies for cancer therapy: the potential of genetically modified T lymphocytes. Curr Hematol Rep 3, 290-297 (2004). [0356] 29. Stephan, M. T., et al. T cell-encoded CD80 and 4-1BBL induce auto- and transco-stimulation, resulting in potent tumor rejection. Nat. Med. 13, 1440-1449 (2007). [0357] 30. Krause, A., et al. Antigen-dependent CD28 signaling selectively enhances survival and proliferation in genetically modified activated human primary T lymphocytes. J Exp Med 188, 619-626 (1998). [0358] 31. Gong, M. C., et al. Cancer patient T cells genetically targeted to prostate-specific membrane antigen specifically lyse prostate cancer cells and release cytokines in response to prostate-specific membrane antigen. Neoplasia. 1, 123-127 (1999). [0359] 32. Lyddane, C., et al. Cutting Edge: CD28 controls dominant regulatory T cell activity during active immunization. J. Immunol. 176, 3306-3310 (2006). [0360] 33. Carpenter et al., B-cell maturation antigen is a promising target for adoptive T-cell therapy of multiple myeloma. Clin Cancer Res. 2013 Apr. 15; 19(8):2048-60. [0361] 34. WO2013/154760 [0362] 35. Maus et al., Cancer Immunol Res (2003); 1(1):26-31
[0363] From the foregoing description, it will be apparent that variations and modifications may be made to the invention described herein to adopt it to various usages and conditions. Such embodiments are also within the scope of the following claims.
[0364] All patents and publications and sequences referred to by accession or reference number mentioned in this specification are herein incorporated by reference to the same extent as if each independent patent and publication and sequence was specifically and individually indicated to be incorporated by reference.