VARIANTS OF AMYLOID beta-PROTEIN PRECURSOR INHIBITOR DOMAIN
20180362616 ยท 2018-12-20
Inventors
Cpc classification
A61K51/088
HUMAN NECESSITIES
C12N9/50
CHEMISTRY; METALLURGY
A61K51/08
HUMAN NECESSITIES
International classification
Abstract
Variants of amyloid -protein precursor inhibitor domain (APPI), effective in inhibiting mesotrypsin and/or kallikrein-6, and composition comprising same, are provided. Further, methods of use of said peptides or composition, including, but not limited to treatment of cancer are provided.
Claims
1. An isolated polypeptide comprising the amino acid of SEQ ID NO: 1
(EVCSEQAEX.sub.1GPCRAX.sub.2X.sub.3X.sub.4RWYFDVTEGX.sub.5CAPFX.sub.6YGGCGGNRNNFDTEEYCMAVCG SAI) wherein: X.sub.1 is threonine, serine, cysteine or valine; X.sub.2 is glycine, cysteine, leucine, histidine, serine, phenylalanine or alanine; X.sub.3 is phenylalanine, leucine, tyrosine or tryptophan; X.sub.4 is serine or phenylalanine; X.sub.5 is lysine, isoleucine, leucine or methionine; and X.sub.6 is valine, cysteine, isoleucine, leucine or methionine; or a fragment, a derivative or analog thereof.
2. The isolated polypeptide of claim 1, wherein X.sub.1 is threonine, serine, cysteine or valine; X.sub.2 is glycine, cysteine or alanine; X.sub.3 is phenylalanine, leucine, tyrosine or tryptophan; X.sub.4 is serine; X.sub.5 is lysine, isoleucine, leucine or methionine; and X.sub.6 is valine, cysteine, isoleucine, leucine or methionine, or a fragment, a derivative or analog thereof.
3. The isolated polypeptide of claim 1, wherein X.sub.1 is threonin or valine; X.sub.2 is glycine; X.sub.3 is phenylalanine; X.sub.4 is serine; X.sub.5 is lysine or leucine; X.sub.6 is valine, or a fragment, a derivative or analog thereof.
4. The isolated polypeptide of claim 1, wherein X.sub.1 is cysteine, valine or threonine; X.sub.2 is glycine or cysteine; X.sub.3 is phenylalanine; X.sub.4 is serine; X.sub.5 is lysine or leucine; and X.sub.6 is cysteine, or a fragment, a derivative or analog thereof.
5. The isolated polypeptide of claim 1, wherein X.sub.1 is threonine; X.sub.2 is glycine, leucine, histidine, serine or phenylalanine; X.sub.3 is phenylalanine; X.sub.4 is serine or phenylalanine; X.sub.5 is lysine; and X.sub.6 is valine, or a fragment, a derivative or analog thereof.
6. The isolated polypeptide of claim 1, wherein X.sub.1 is threonine; X.sub.2 is glycine or leucine; X.sub.3 is phenylalanine; X.sub.4 is serine or phenylalanine; X.sub.5 is lysine; and X.sub.6 is valine, or a fragment, a derivative or analog thereof.
7. The isolated polypeptide of claim 1, wherein X.sub.1 is threonine; X.sub.2 is leucine; X.sub.3 is phenylalanine; X.sub.4 is serine or phenylalanine; X.sub.5 is lysine; and X.sub.6 is valine, or a fragment, a derivative or analog thereof.
8. The isolated polypeptide of claim 1, comprising the amino acid sequence selected from the group consisting of SEQ ID NO: 8-14 or a fragment, a derivative or analog thereof.
9. The isolated polypeptide of claim 1, comprising the amino acid sequence as set forth in SEQ ID NO: 8 (EVCSEOAETGPCRAGFSRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYCMAVCGSAI) or a fragment, a derivative or analog thereof.
10-14. (canceled)
15. The isolated polypeptide of claim 1 having a length of at most 80 amino acid residues.
16. The isolated polypeptide of claim 1, wherein said analog has at least 95% sequence identity to any one of SEQ ID NOs: 1-14, and wherein said analog differs by at least one amino acid residue compared to SEQ ID NO: 25.
17. A pharmaceutical composition comprising the polypeptide of claim 1 and a pharmaceutical acceptable carrier.
18. A method for treating cancer in a subject in need thereof, the method comprising the step of administering to said subject a pharmaceutical composition comprising an effective amount of an amino acid molecule comprising the amino acid selected from the group consisting of SEQ ID NOs: 1-14, and a pharmaceutical acceptable carrier, thereby treating cancer in a subject in need thereof.
19. The method of claim 18, wherein said cancer is a metastatic-associated cancer.
20. The method of claim 18, wherein said cancer is a mesotrypsin-associated cancer.
21. The method of claim 18, wherein said cancer is selected from the group consisting of prostate, lung, colon, breast, pancreas, gastric, non-small cell lung cancer (NSCLC) and metastasis thereof.
22. The method of claim 18, wherein said cancer is prostate cancer.
23. The method of claim 18, wherein said cancer is gastric cancer.
24. The method of claim 18, wherein said treating is inhibiting invasiveness of a cancerous cell.
25. A method for imaging a mesotrypsin associated and/or kallikrein-6 associated neoplastic tissue in a subject in need thereof, the method comprising the steps of: administering an imaging reagent compound comprising: an effective amount of an amino acid molecule comprising the amino acid selected from the group consisting of SEQ ID NOs: 1-14, and an imaging agent to a subject, wherein said imaging reagent compound distributes in vivo; and detecting the compound in said subject, thereby imaging mesotrypsin associated and/or kallikrein-6 associated neoplastic tissue.
26-27. (canceled)
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0039]
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
DETAILED DESCRIPTION OF THE INVENTION
[0054] The present invention provides amyloid precursor protein inhibitor domain (APPI) variants, and pharmaceutical compositions comprising same. The invention further provides methods of treating, ameliorating or inhibiting mesotrypsin-associated pathological conditions (e.g., malignancies, including but not limited to prostate cancer and/or Kallikrein-6-associated pathological conditions.
[0055] In some embodiments, the invention provides a method of reducing/inhibiting mesotrypsin activity and/or kallikrein-6 activity, the method comprises the step of contacting mesotrypsin and/or kallikrein-6 with the APPI variants of the invention. In some embodiments, the contacting is in vitro. In some embodiments, the contacting is in vivo.
[0056] According to some embodiments, the invention provides an APPI variant comprising at least one amino acid substitution compared to SEQ ID NO: 25 (EVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAI).
[0057] In some embodiments, the APPI variant comprises at least two amino acid substitutions compared to SEQ ID NO: 25. In some embodiments, the APPI variant comprises at least three amino acid substitutions compared to SEQ ID NO: 25. According to some embodiments, the APPI variant of the invention is selected from the amino acid sequences listed in Table 1 herein below.
TABLE-US-00001 TABLE1 APPIvariantsoftheinvention Peptide Aminoacidsequence SEQIDNO:1 EVCSEQAEX.sub.1GPCRAX.sub.2X.sub.3X.sub.4RWYFDVTEGX.sub.5CAPFX.sub.6YGGCGGNRNNFDT EEYCMAVCGSAI X.sub.1= T,S,C,V;X.sub.2= G,C,A,L,H,S,F;X.sub.3= F,L,Y,W;X.sub.4= S,F; X.sub.5= K,I,L,M;X.sub.6= V,C,I,L,M; SEQIDNO:2 EVCSEQAEX.sub.1GPCRAX.sub.2X.sub.3X.sub.4RFDVTEGX.sub.5CAPFX.sub.6YGGCGGNRNNFFDT EEYCMAVCGSAI X.sub.1= T,S,C,V;X.sub.2= G,C,A;X.sub.3= F,L,Y,W;X.sub.4= S;X.sub.5= K,I,L,M; X.sub.6= V,C,I,L,M; SEQIDNO:3 EVCSEQAEX.sub.1GPCRAX.sub.2X.sub.3X.sub.4RWYFDVTEGX.sub.5CAPFX.sub.6YGGCGGNRNNFDT EEYCMAVCGSAI X.sub.1= T,V;X.sub.2= G;X.sub.3= F;X.sub.4= K,L;X.sub.5= V; SEQIDNO:4 EVCSEQAEX.sub.1GPCRAX.sub.2X.sub.3X.sub.4RWYFDVTEGX.sub.5CAPFX.sub.6YGGCGGNRNNFDT EEYCMAVCGSAI X.sub.1= C,T,V;X.sub.2= G,C;X.sub.3= F;X.sub.4= S;X.sub.5= K,L;X.sub.6= C; SEQIDNO:5 EVCSEQAEX.sub.1GPCRAX.sub.2X.sub.3X.sub.4RWYFDVTEGX.sub.5CAPFX.sub.6YGGCGGNRNNFDT EEYCMAVCGSAI X.sub.1= T;X.sub.2= G,L,H,S,F;X.sub.3= F;X.sub.4= S,F;X.sub.5= K;X.sub.6= V; SEQIDNO:6 EVCSEQAEX.sub.1GPCRAX.sub.2X.sub.3X.sub.4RWYFDVTEGX.sub.5CAPFX.sub.6YGGCGGNRNNFDT EEYCMAVCGSAI X.sub.1= T;X.sub.2= G,L;X.sub.3= F;X.sub.4= S,F;X.sub.5= K;X.sub.6= V; SEQIDNO:7 EVCSEQAEX.sub.1GPCRAX.sub.2X.sub.3X.sub.4RWYFDVTEGX.sub.5CAPFX.sub.6YGGCGGNRNNFDT EEYCMAVCGSAI X.sub.1= T;X.sub.2= L;X.sub.3= F;X.sub.4= S,F;X.sub.5= K;X.sub.6= V; SEQIDNO:8 EVCSEQAETGPCRAGFSRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYC M17G_I18F_F34V MAVCGSAI SEQIDNO:9 EVCSEQAENGPCRAGFSRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYC T11V_M17G_ MAVCGSAI I118F_F34V SEQIDNO:10 EVCSEQAETGPCRAGFSRWYFDVTEGLCAPFVYGGCGGNRNNFDTEEYC M17G_I18F_ MAVCGSAI K29L_F34V SEQIDNO:11 EVCSEQAECGPCRAGFSRWYFDVTEGKCAPFCYGGCGGNRNNFDTEEYC T11C_M17G_ MAVCGSAI I18F_F34C SEQIDNO:12 EVCSEQAETGPCRACFSRWYFDVTEGKCAPFCYGGCGGNRNNFDTEEYC M17C_I18F_F34C MAVCGSAI SEQIDNO:13 EVCSEQAETGPCRALFFRWYEDVTEGKCAPFVYGGCGGNRNNFDTEEYC M17L,I118F,S1917, MAVCGSAI F34V SEQIDNO:14 EVCSEQAETGPCRALFSRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYC M17L,II8F,F34V MAVCGSAI SEQIDNO:15 EVCSEQAETGPCRAHFSRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYC M17H,I18F,F34V MAVCGSAI SEQIDNO:16 EVCSEQAETGPCRASFSRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYC M17S,I18F,F34V MAVCGSAI SEQIDNO:17 EVCSEQAETGPCRAFFSRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYC M17F,I18F,F34V MAVCGSAI SEQIDNO:18 EVCSEQAETGPCRAGISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYC M17G MAVCGSAI SEQIDNO:19 EVCSEQAETGPCRAMFSRWYEDVTEGKCAPFFYGGCGGNRNNFDTEEYC I18F MAVCGSAI SEQIDNO:20 EATSEQAETGPCRAMFSRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYC I18F_F34V MAVCGSAI SEQIDNO:21 EVCSEQAETGPCRAGISRWYTDVTEGKCAPFVYGGCGGNRNNFDTEEYC M17G_F34V MAVCGSAI SEQIDNO:22 EVCSEQAETGPCRAGFSRWYEDVTEGKCAPFFYGGCGGNRNNFDTEEYC M17G_I18F MAVCGSAI SEQIDNO:23 EVCSEQAETGPCRAMISRWYFDVTEGKCAPFVYGGCGGNRNNFDTEEYC F34V MAVCGSAI
[0058] The present invention is based, in part, on the surprising finding that the APPI variants disclosed herein specifically bind mesotrypsin with substantially greater affinity than WT APPI and reduces or inhibits activity thereof. As exemplified in the example section below, the APPI variants disclosed herein exhibit higher stability than WT APPI. As further exemplified in the example section below, the APPI variants disclosed herein exhibit enhanced potency for inhibition of mesotrypsin-dependent cancer cells invasiveness. The present invention is further based, in part, on the surprising finding that some of the APPI variants disclosed herein further bind kallikrein-6 with substantially greater affinity than WT APPI and reduces or inhibits activity of both mesotrypsin and kallikrein-6 with substantially greater affinity than WT APPI. As exemplified in the example section below, these APPI variants significantly lower invasiveness of gastric cancer cells.
[0059] According to another embodiment, the isolated polypeptide has a higher selectivity and/or binding affinity to mesotrypsin than WT APPI. According to another embodiment, the isolated polypeptide has a higher selectivity and/or binding affinity to kallikrein-6 than WT APPI. According to another embodiment, the isolated polypeptide has a higher selectivity and/or binding affinity to mesotrypsin and kallikrein-6 than WT APPI. According to another embodiment, the isolated polypeptide has a higher stability than WT APPI. According to another embodiment, the isolated polypeptide comprises higher specificity to mesotrypsin than to other trypsins.
[0060] In some embodiments, the APPI variants of the invention reduce or inhibit the activity of mesotrypsin. In some embodiments, the activity of mesotrypsin is reduced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 90%, 95%, or 100%. Each possibility represents a separate embodiment of the present invention. In some embodiments, the APPI variants reduce or inhibit mesotrypsin-dependent cancer cells invasiveness. In such embodiments, the invasiveness of mesotrypsin-dependent cancer cells is reduced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 90%, 95%, or 100%. Each possibility represents a separate embodiment of the present invention.
[0061] In some embodiments, the APPI variants of the invention further reduce or inhibit the activity of kallikrein-6. In some embodiments, the activity of kallikrein-6 is reduced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 90%, 95%, or 100%. Each possibility represents a separate embodiment of the present invention. In some embodiments, the APPI variants capable of reducing or inhibiting activity of mesotrypsin and kallikrein-6 reduce, ameliorate or inhibit mesotrypsin-associated diseases and/or kallikrein-6-associated disease. In some embodiments, the APPI variants capable of reducing or inhibiting activity of mesotrypsin and kallikrein-6 reduce, ameliorate or inhibit cancer cells invasiveness. In some embodiments, the APPI variants capable of reducing or inhibiting activity of mesotrypsin and kallikrein-6 reduce, ameliorate or inhibit mesotrypsin-dependent and/or kallikrein-6 dependent cancer cells invasiveness.
[0062] As used herein, such as in connection with selective binding affinity, higher and substantially greater are used interchangeably to refer to at least a two-fold, at least a three-fold, at least a four-fold or at least a five-fold increase in the selectivity to mesotrypsin than WT APPI.
[0063] The term peptide as used herein encompasses native peptides (degradation products, synthetic peptides or recombinant peptides), peptidomimetics (typically including non-peptide bonds or other synthetic modifications) and the peptide analogues peptoids and semipeptoids, and may have, for example, modifications rendering the peptides more stable while in the body or more capable of penetrating into cells.
[0064] The terms polypeptide, amino acid molecule and protein are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical analogue of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers.
[0065] The term isolated peptide refers to a peptide that is essentially free from contaminating cellular components, such as carbohydrate, lipid, or other proteinaceous impurities associated with the peptide in nature. Typically, a preparation of isolated peptide contains the peptide in a highly-purified form, i.e., at least about 80% pure, at least about 90% pure, at least about 95% pure, greater than 95% pure, or greater than 99% pure. Each possibility represents a separate embodiment of the present invention.
[0066] The present invention further provides fragments, analogs and chemical modifications of the APPI variants of the present invention as long as they are capable of binding mesotrypsin and/or modulating (e.g. reducing or inhibiting) mesotrypsin activity. In some embodiments, the fragments, analogs and chemical modifications of the APPI variants encompassed by the present invention are further capable of binding kallikrein-6 and/or modulating (e.g. reducing or inhibiting) kallikrein-6 activity.
[0067] The peptides may comprise additional amino acids, either at the peptide's N-terminus, at the peptide's C-terminus or both. In another embodiment, the peptide has a length of at most 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100 amino acids. Each possibility represents a separate embodiment of the present invention. In another embodiment, the peptide has a length of at most 80 amino acids.
[0068] According to another embodiment, the APPI variants of the invention encompass truncated forms and/or fragments of any one of SEQ ID NOs: 1-14 as long as they are capable of binding mesotrypsin and/or modulating (e.g. reducing or inhibiting) mesotrypsin activity and/or binding kallikrein-6 and/or modulating kallikrein-6 activity. In some embodiments, the APPI variants comprises amino acids 9-32 of any one of SEQ ID NOs: 1-14 or an analog thereof. In another embodiment, the fragments or the truncated forms of APPI variants of the invention comprise at least 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, or 57 amino acids derived from any one of SEQ ID NOs: 1-14. Each possibility represents a separate embodiment of the present invention. In another embodiment, the fragments or the truncated forms of APPI variants of the invention comprise 20 to 57, 20 to 56, 20 to 55, 20 to 54, 20 to 53, 20 to 52, 20 to 51, 20 to 50, 20 to 49, 20 to 48, 20 to 47, 20 to 46, 20 to 45, 20 to 44, 20 to 43, 20 to 42, 20 to 41, 20 to 40, 20 to 39, 20 to 38, 20 to 37, 20 to 36, 20 to 35, 20 to 34, 20 to 33, 20 to 32, 24 to 57, 24 to 56, 24 to 55, 24 to 54, 24 to 53, 24 to 52, 24 to 51, 24 to 50, 24 to 49, 24 to 48, 24 to 47, 24 to 46, 24 to 45, 24 to 44, 24 to 43, 24 to 42, 24 to 41, 24 to 40, 24 to 39, 24 to 38, 24 to 37, 24 to 36, 24 to 35, 24 to 34, 24 to 33, 24 to 32, 26 to 57, 26 to 56, 26 to 55, 26 to 54, 26 to 53, 26 to 52, 26 to 51, 26 to 50, 26 to 49, 26 to 48, 26 to 47, 26 to 46, 26 to 45, 26 to 44, 26 to 43, 26 to 42, 26 to 41, 26 to 40, 26 to 39, 26 to 38, 26 to 37, 26 to 36, 26 to 35, 26 to 34, 26 to 33, 26 to 32, amino acids derived from any one of SEQ ID NOs: 1-14. Each possibility represents a separate embodiment of the present invention.
[0069] Conservative substitution of amino acids as known to those skilled in the art are within the scope of the present invention. Conservative amino acid substitutions include replacement of one amino acid with another having the same type of functional group or side chain e.g. aliphatic, aromatic, positively charged, negatively charged. One of skill will recognize that individual substitutions, deletions or additions to peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a conservatively modified variant where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art.
[0070] The following six groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Serine (S), Threonine (T); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); and 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W) (see, e.g., Creighton, Proteins, 1984).
[0071] The term analog includes any peptide having an amino acid sequence substantially identical to one of the sequences specifically shown herein in which one or more residues have been conservatively substituted with a functionally similar residue and which displays the abilities as described herein. Examples of conservative substitutions include the substitution of one non-polar (hydrophobic) residue such as isoleucine, valine, leucine or methionine for another, the substitution of one polar (hydrophilic) residue for another such as between arginine and lysine, between glutamine and asparagine, between glycine and serine, the substitution of one basic residue such as lysine, arginine or histidine for another, or the substitution of one acidic residue, such as aspartic acid or glutamic acid for another. Each possibility represents a separate embodiment of the present invention.
[0072] The phrase conservative substitution also includes the use of a chemically derivatized residue in place of a non-derivatized residue provided that such peptide displays the requisite function of modulating the immune system's innate response as specified herein.
[0073] The term derived from or corresponding to refers to construction of an amino acid sequence based on the knowledge of a sequence using any one of the suitable means known to one skilled in the art, e.g. chemical synthesis in accordance with standard protocols in the art.
[0074] According to another embodiment, the APPI variant of the invention has at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% sequence identity to any one of SEQ ID NO: 1-14. Each possibility represents a separate embodiment of the present invention. According to another embodiment, the APPI variant has at least 75% sequence identity to any one of SEQ ID NO: 1-14. According to another embodiment, the APPI variant has at least 80% sequence identity to any one of SEQ ID NO: 1-14. According to another embodiment, said APPI variant has at least 85% sequence identity to any one of SEQ ID NO: 1-14. According to another embodiment, said APPI variant has at least 90% sequence identity to any one of SEQ ID NO: 13. According to another embodiment, said APPI variant has at least 95% sequence identity to any one-of SEQ ID NO: 1-14. In some embodiments, the APPI variant of the invention comprises a sequence having at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to any one of SEQ ID NOs: 1-14, wherein the APPI variant: (i) binds mesotrypsin with substantially greater affinity than WT APPI and reduces activity thereof, and (ii) is capable of reducing, inhibiting or ameliorating a mesotrypsin associated pathological conditions (e.g., cancer). Each possibility represents a separate embodiment of the present invention. In some embodiments, the APPI variant further binds kallikrein-6 with substantially greater affinity than WT APPI and reduces activity thereof. In some embodiments, the APPI variant is capable of reducing, inhibiting or ameliorating a mesotrypsin associated and or kallikrein-6-associated pathological conditions.
[0075] As used herein, the term APPI variant includes at least one amino acid substitution with respect to the WT APPI (SEQ ID NO: 25). In some embodiments, the APPI variant includes at least two amino acid substitutions with respect to the WT APPI (SEQ ID NO: 25). In some embodiments, the APPI variant includes at least three amino acid substitutions with respect to the WT APPI (SEQ ID NO: 25). In some embodiments, the APPI variants of the invention include an amino acid substitution of methionine at position 15 of SEQ ID NO: 25 and at least one additional amino acid substitution. In some embodiments, the at least one additional amino acid substitution is a substitution of the amino acid at a position selected from: 9, 16, 17, 27 and 32 of SEQ ID NO: 25. In some embodiments, the APPI variants of the invention have the amino acid sequence of SEQ ID NO: 1 wherein at least one of X.sub.1, X.sub.3, X.sub.4, X.sub.5, and X.sub.6 differs from the corresponding amino acid of SEQ ID NO: 25.
[0076] In some embodiments, the APPI variants of the invention have at least 50 folds, 60 folds, 70 folds, 80 folds, 90 folds, 100 folds, 150 folds, 200 folds, 250 folds, 300 folds, 400 folds, 500 folds, 600 folds, 700 folds, 800 folds, 900 folds, or 1000 folds decrease in Ki value for inhibiting mesotrypsin, relative to WT APPI. In some embodiments, the APPI variants of the invention have at least 50 folds, 60 folds, 70 folds, 80 folds, 90 folds, 100 folds, 150 folds, 200 folds, 250 folds, 300 folds, 400 folds, 500 folds, 600 folds, 700 folds, 800 folds, 900 folds, or 1000 folds decrease in Ki value for inhibiting kallikrein-6, relative to WT APPI.
[0077] As used herein Ki refers to an inhibition constant which represents the concentration required to produce half maximum inhibition of a target protein (e.g., enzyme such as mesotrypsin, kallikrein-6). The inhibition constant (Ki) is ordinarily used as a measure of capacity to inhibit enzyme activity, with a low Ki indicating a more potent inhibitor.
[0078] Percentage sequence identity can be determined, for example, by the Fitch et al. version of the algorithm (Fitch et al, Proc. Natl. Acad. Sci. U.S.A. 80: 1382-1386 (1983)) described by Needleman et al, (Needleman et al, J. Mol. Biol. 48: 443-453 (1970)), after aligning the sequences to provide for maximum homology. Alternatively, the determination of percent identity between two sequences can be accomplished using the mathematical algorithm of Karlin and Altschul (1993) Proc. Natl. Acad. Sci. USA 90:5873-5877. Such an algorithm is incorporated into the BLASTP program of Altschul et al. (1990) J. Mol. Biol. 215, 403-410. To obtain gapped alignments for comparative purposes, Gapped BLAST is utilized as described in Altschul et al (1997) Nucleic Acids Res. 25:3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST) are used.
[0079] Typically, the present invention encompasses derivatives of the APPI peptides. The term derivative or chemical derivative includes any chemical derivative of the peptide having one or more residues chemically derivatized by reaction of side chains or functional groups. Such derivatized molecules include, for example, those molecules in which free amino groups have been derivatized to form amine hydrochlorides, p-toluene sulfonyl groups, carbobenzoxy groups, t-butyloxycarbonyl groups, chloroacetyl groups or formyl groups. Free carboxyl groups may be derivatized to form salts, methyl and ethyl esters or other types of esters or hydrazides. Free hydroxyl groups may be derivatized to form O-acyl or O-alkyl derivatives. The imidazole nitrogen of histidine may be derivatized to form N-im-benzylhistidine. Also included as chemical derivatives are those peptides, which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acid residues. For example: 4-hydroxyproline may be substituted for proline; 5-hydroxylysine may be substituted for lysine; 3-methylhistidine may be substituted for histidine; homoserine may be substituted or serine; and ornithine may be substituted for lysine.
[0080] In addition, a peptide derivative can differ from the natural sequence of the peptides of the invention by chemical modifications including, but are not limited to, terminal-NH2 acylation, acetylation, or thioglycolic acid amidation, and by terminal-carboxlyamidation, e.g., with ammonia, methylamine, and the like. Peptides can be either linear, cyclic or branched and the like, which conformations can be achieved using methods well known in the art.
[0081] The peptide derivatives and analogs according to the principles of the present invention can also include side chain bond modifications, including but not limited to CH2-NH, CH2-S, CH2-S=0, OCNH, CH2-O, CH2-CH2-, SCNH, and CHCH, and backbone modifications such as modified peptide bonds. Peptide bonds (CONH) within the peptide can be substituted, for example, by N-methylated bonds (N(CH3)-CO); ester bonds (C(R)HC-0-0-C(R)HN); ketomethylene bonds (COCH2-); a-aza bonds (NHN(R)CO), wherein R is any alkyl group, e.g., methyl; carba bonds (CH2-NH); hydroxyethylene bonds (CH(OH)CH2-); thioamide bonds (CSNH); olefmic double bonds (CHCH); and peptide derivatives (N(R)CH2-CO), wherein R is the normal side chain, naturally presented on the carbon atom. These modifications can occur at one or more of the bonds along the peptide chain and even at several (e.g., 2-3) at the same time.
[0082] The present invention also encompasses peptide derivatives and analogs in which free amino groups have been derivatized to form amine hydrochlorides, p-toluene sulfonylamino groups, carbobenzoxyamino groups, t-butyloxycarbonylamino groups, chloroacetylamino groups or formylamino groups. Free carboxyl groups may be derivatized to form, for example, salts, methyl and ethyl esters or other types of esters or hydrazides. The imidazole nitrogen of histidine can be derivatized to form N-im-benzylhistidine.
[0083] The peptide analogs can also contain non-natural amino acids. Examples of non-natural amino acids include, but are not limited to, sarcosine (Sar), norleucine, ornithine, citrulline, diaminobutyric acid, homoserine, isopropyl Lys, 3-(2-naphtyl)-Ala, nicotinyl Lys, amino isobutyric acid, and 3-(3-pyridyl-Ala).
[0084] Furthermore, the peptide analogs can contain other derivatized amino acid residues including, but not limited to, methylated amino acids, N-benzylated amino acids, O-benzylated amino acids, N-acetylated amino acids, O-acetylated amino acids, carbobenzoxy-substituted amino acids and the like. Specific examples include, but are not limited to, methyl-Ala (Me Ala), MeTyr, MeArg, MeGlu, MeVal, MeHis, N-acetyl-Lys, O-acetyl-Lys, carbobenzoxy-Lys, Tyr-O-Benzyl, Glu-O-Benzyl, Benzyl-His, Arg-Tosyl, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, and the like.
[0085] The invention further includes peptide analogs, which can contain one or more D-isomer forms of the amino acids. Production of retro-inverso D-amino acid peptides where at least one amino acid, and perhaps all amino acids are D-amino acids is well known in the art. When all of the amino acids in the peptide are D-amino acids, and the N- and C-terminals of the molecule are reversed, the result is a molecule having the same structural groups being at the same positions as in the L-amino acid form of the molecule. However, the molecule is more stable to proteolytic degradation and is therefore useful in many of the applications recited herein. Diastereomeric peptides may be highly advantageous over all L- or all D-amino acid peptides having the same amino acid sequence because of their higher water solubility, lower immunogenicity, and lower susceptibility to proteolytic degradation. The term diastereomeric peptide as used herein refers to a peptide comprising both L-amino acid residues and D-amino acid residues. The number and position of D-amino acid residues in a diastereomeric peptide of the preset invention may be variable so long as the peptide is capable of displaying the requisite function binding and/or modulating (e.g. reducing or inhibiting) mesotrypsin activity, as specified herein.
[0086] The peptides of the invention may be synthesized or prepared by techniques well known in the art. The peptides can be synthesized by a solid phase peptide synthesis method of Merrifield (see J. Am. Chem. Soc, 85:2149, 1964). Alternatively, the peptides of the present invention can be synthesized using standard solution methods well known in the art (see, for example, Bodanszky, M., Principles of Peptide Synthesis, Springer-Verlag, 1984) or by any other method known in the art for peptide synthesis.
[0087] In general, these methods comprise sequential addition of one or more amino acids or suitably protected amino acids to a growing peptide chain bound to a suitable resin.
[0088] Normally, either the amino or carboxyl group of the first amino acid is protected by a suitable protecting group. The protected or derivatized amino acid can then be either attached to an inert solid support (resin) or utilized in solution by adding the next amino acid in the sequence having the complimentary (amino or carboxyl) group suitably protected, under conditions conductive for forming the amide linkage. The protecting group is then removed from this newly added amino acid residue and the next amino acid (suitably protected) is added, and so forth. After all the desired amino acids have been linked in the proper sequence, any remaining protecting groups are removed sequentially or concurrently, and the peptide chain, if synthesized by the solid phase method, is cleaved from the solid support to afford the final peptide.
[0089] In the solid phase peptide synthesis method, the alpha-amino group of the amino acid is protected by an acid or base sensitive group. Such protecting groups should have the properties of being stable to the conditions of peptide linkage formation, while being readily removable without destruction of the growing peptide chain. Suitable protecting groups are t-butyloxycarbonyl (BOC), benzyloxycarbonyl (Cbz), biphenylisopropyloxycarbonyl, t-amyloxycarbonyl, isobornyloxycarbonyl, (alpha,alpha)-dimethyl-3,5 dimethoxybenzyloxycarbonyl, o-nitrophenylsulfenyl, 2-cyano-t-butyloxycarbonyl, 9-fluorenylmethyloxycarbonyl (FMOC) and the like.
[0090] In the solid phase peptide synthesis method, the C-terminal amino acid is attached to a suitable solid support. Suitable solid supports useful for the above synthesis are those materials, which are inert to the reagents and reaction conditions of the stepwise condensation-deprotection reactions, as well as being insoluble in the solvent media used. Suitable solid supports are chloromethylpolystyrene-divinylbenzene polymer, hydroxymethyl-polystyrene-divinylbenzene polymer, and the like. The coupling reaction is accomplished in a solvent such as ethanol, acetonitrile, N,N-dimethylformamide (DMF), and the like. The coupling of successive protected amino acids can be carried out in an automatic polypeptide synthesizer as is well known in the art.
[0091] The peptides of the invention may alternatively be synthesized such that one or more of the bonds, which link the amino acid residues of the peptides are non-peptide bonds. These alternative non-peptide bonds include, but are not limited to, imino, ester, hydrazide, semicarbazide, and azo bonds, which can be formed by reactions well known to skilled in the art.
[0092] In some embodiments, recombinant protein techniques are used to generate the protein of the invention. In some embodiments, recombinant protein techniques are used for generation of relatively long peptides (e.g., longer than 18-25 amino acid). In some embodiments, recombinant protein techniques are used for the generation of large amounts of the protein of the invention. In some embodiments, recombinant techniques are described by Bitter et al., (1987) Methods in Enzymol. 153:516-544, Studier et al. (1990) Methods in Enzymol. 185:60-89, Brisson et al. (1984) Nature 310:511-514, Takamatsu et al. (1987) EMBO J. 6:307-311, Coruzzi et al. (1984) EMBO J. 3:1671-1680 and Brogli et al, (1984) Science 224:838-843, Gurley et al. (1986) Mol. Cell. Biol. 6:559-565 and Weissbach & Weissbach, 1988, Methods for Plant Molecular Biology, Academic Press, NY, Section VIII, pp 421-463.
[0093] The peptides of the present invention, analogs or derivatives thereof produced by recombinant techniques can be purified so that the peptides will be substantially pure when administered to a subject. The term substantially pure refers to a compound, e.g., a peptide, which has been separated from components, which naturally accompany it.
[0094] Typically, a peptide is substantially pure when at least 50%, preferably at least 75%, more preferably at least 90%, and most preferably at least 99% of the total material (by volume, by wet or dry weight, or by mole percent or mole fraction) in a sample is the peptide of interest. Purity can be measured by any appropriate method, e.g., in the case of peptides by HPLC analysis.
[0095] According to another aspect, the present invention provides an isolated polynucleotide sequence encoding the polypeptides of the present invention, or an analog or a conjugate thereof.
[0096] The term polynucleotide means a polymer of deoxyribonucleic acid (DNA), ribonucleic acid (RNA) or a combination thereof, which can be derived from any source, can be single- or double-stranded, and can optionally contain synthetic, non-natural, or altered nucleotides, which are capable of being incorporated into DNA or RNA polymers.
[0097] An isolated polynucleotide refers to a polynucleotide segment or fragment which has been separated from sequences which flank it in a naturally occurring state, e.g., a DNA fragment which has been removed from the sequences which are normally adjacent to the fragment, e.g., the sequences adjacent to the fragment in a genome in which it naturally occurs. The term also applies to polynucleotides, which have been substantially purified from other components, which naturally accompany the polynucleotide in the cell, e.g., RNA or DNA or proteins. The term therefore includes, for example, a recombinant DNA which is incorporated into a vector, into an autonomously replicating plasmid or virus, or into the genomic DNA of a prokaryote or eukaryote, or which exists as a separate molecule (e.g., as a cDNA or a genomic or cDNA fragment produced by PCR or restriction enzyme digestion) independent of other sequences. It also includes a recombinant DNA, which is part of a hybrid gene encoding additional polypeptide sequence, and RNA such as mRNA.
[0098] The term encoding refers to the inherent property of specific sequences of nucleotides in an isolated polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (i.e., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a peptide or protein if transcription and translation of mRNA corresponding to that gene produces the peptide or protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the peptide or protein or other product of that gene or cDNA.
[0099] One who is skilled in the art will appreciate that more than one polynucleotide may encode any given peptide or protein in view of the degeneracy of the genetic code and the allowance of exceptions to classical base pairing in the third position of the codon, as given by the so-called Wobble rules. It is intended that the present invention encompass polynucleotides that encode the peptides of the present invention as well as any analog thereof.
[0100] A polynucleotide of the present invention can be expressed as a secreted peptide where the polypeptide of the present invention or analog thereof is isolated from the medium in which the host cell containing the polynucleotide is grown, or the polynucleotide can be expressed as an intracellular polypeptide by deleting the leader or other peptides, in which case the polypeptide of the present invention or analog thereof is isolated from the host cells. The polypeptide of the present invention or analog thereof are then purified by standard protein purification methods known in the art.
[0101] The polypeptide of the present invention, analogs, or derivatives thereof can also be provided to the tissue of interest by transferring an expression vector comprising an isolated polynucleotide encoding the polypeptide of the present invention, or analog thereof to cells associated with the tissue of interest. The cells produce the peptide such that it is suitably provided to the cells within the tissue to exert a biological activity such as, for example, to reduce or inhibit inflammatory processes within the tissue of interest.
[0102] The expression vector according to the principles of the present invention further comprises a promoter. In the context of the present invention, the promoter must be able to drive the expression of the peptide within the cells. Many viral promoters are appropriate for use in such an expression vector (e.g., retroviral ITRs, LTRs, immediate early viral promoters (IEp) (such as herpes virus IEp (e.g., ICP4-IEp and ICPO-IEp) and cytomegalovirus (CMV) IEp), and other viral promoters (e.g., late viral promoters, latency-active promoters (LAPs), Rous Sarcoma Virus (RSV) promoters, and Murine Leukemia Virus (MLV) promoters). Other suitable promoters are eukaryotic promoters, which contain enhancer sequences (e.g., the rabbit -globin regulatory elements), constitutively active promoters (e.g., the -actin promoter, etc.), signal and/or tissue specific promoters (e.g., inducible and/or repressible promoters, such as a promoter responsive to TNF or RU486, the metallothionine promoter, etc.), and tumor-specific promoters.
[0103] Within the expression vector, the polynucleotide encoding the polypeptide of the present invention, or analog thereof and the promoter are operably linked such that the promoter is able to drive the expression of the polynucleotide. As long as this operable linkage is maintained, the expression vector can include more than one gene, such as multiple genes separated by internal ribosome entry sites (IRES). Furthermore, the expression vector can optionally include other elements, such as splice sites, polyadenylation sequences, transcriptional regulatory elements (e.g., enhancers, silencers, etc.), or other sequences.
[0104] The expression vectors are introduced into the cells in a manner such that they are capable of expressing the isolated polynucleotide encoding the polypeptide of the present invention or analog thereof contained therein. Any suitable vector can be so employed, many of which are known in the art. Examples of such vectors include naked DNA vectors (such as oligonucleotides or plasmids), viral vectors such as adeno-associated viral vectors (Berns et al, 1995, Ann. N.Y. Acad. Sci. 772:95-104, the contents of which are hereby incorporated by reference in their entirety), adenoviral vectors, herpes virus vectors (Fink et al, 1996, Ann. Rev. Neurosci. 19:265-287), packaged amplicons (Federoff et al, 1992, Proc. Natl. Acad. Sci. USA 89: 1636-1640, the contents of which are hereby incorporated by reference in their entirety), papilloma virus vectors, picomavirus vectors, polyoma virus vectors, retroviral vectors, SV40 viral vectors, vaccinia virus vectors, and other vectors. Additionally, the vector can also include other genetic elements, such as, for example, genes encoding a selectable marker (e.g., -gal or a marker conferring resistance to a toxin), a pharmacologically active protein, a transcription factor, or other biologically active substance.
[0105] Methods for manipulating a vector comprising an isolated polynucleotide are well known in the art (e.g., Sambrook et al., 1989, Molecular Cloning: A Laboratory Manual, 2d edition, Cold Spring Harbor Press, the contents of which are hereby incorporated by reference in their entirety) and include direct cloning, site specific recombination using recombinases, homologous recombination, and other suitable methods of constructing a recombinant vector. In this manner, an expression vector can be constructed such that it can be replicated in any desired cell, expressed in any desired cell, and can even become integrated into the genome of any desired cell.
[0106] The expression vector comprising the polynucleotide of interest is introduced into the cells by any means appropriate for the transfer of DNA into cells. Many such methods are well known in the art (e.g., Sambrook et al, supra; see also Watson et al, 1992, Recombinant DNA, Chapter 12, 2d edition, Scientific American Books, the contents of which are hereby incorporated by reference in their entirety). Thus, in the case of prokaryotic cells, vector introduction can be accomplished, for example, by electroporation, transformation, transduction, conjugation, or mobilization. For eukaryotic cells, vectors can be introduced through the use of, for example, electroporation, transfection, infection, DNA coated microprojectiles, or protoplast fusion. Examples of eukaryotic cells into which the expression vector can be introduced include, but are not limited to, ovum, stem cells, blastocytes, and the like.
[0107] Cells, into which the polynucleotide has been transferred under the control of an inducible promoter if necessary, can be used as transient trans formants. Such cells themselves may then be transferred into a subject for therapeutic benefit therein. Thus, the cells can be transferred to a site in the subject such that the peptide of the invention is expressed therein and secreted therefrom and thus reduces or inhibits, for example, T cell mediated processes so that the clinical condition of the subject is improved. Alternatively, particularly in the case of cells to which the vector has been added in vitro, the cells can first be subjected to several rounds of clonal selection (facilitated usually by the use of a selectable marker sequence in the vector) to select for stable transformants. Such stable transformants are then transferred to a subject, preferably a human, for therapeutic benefit therein.
[0108] Within the cells, the polynucleotide encoding the peptides of the present invention, or analog thereof is expressed, and optionally is secreted. Successful expression of the polynucleotide can be assessed using standard molecular biology techniques (e.g., Northern hybridization, Western blotting, immunoprecipitation, enzyme immunoassay, etc.).
[0109] The present invention encompasses transgenic animals comprising an isolated to polynucleotide encoding the peptides of the invention.
Pharmaceutical Compositions
[0110] In some embodiments, there is provided compositions (i.e., pharmaceutical compositions) comprising as an active ingredient a therapeutically effective amount of an amino acid molecule (i.e., polypeptides) of the present invention (e.g., SEQ ID NO: 1-23), and a pharmaceutically acceptable carrier.
[0111] The pharmaceutical compositions of the invention can be formulated in the form of a pharmaceutically acceptable salt of the polypeptides of the invention or their analogs, or derivatives thereof. Pharmaceutically acceptable salts include those salts formed with free amino groups such as salts derived from non-toxic inorganic or organic acids such as hydrochloric, phosphoric, acetic, oxalic, tartaric acids, and the like, and those salts formed with free carboxyl groups such as salts derived from non-toxic inorganic or organic bases such as sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, and the like. In one embodiment, pharmaceutical compositions of the present invention are manufactured by processes well known in the art, e.g., by means of conventional mixing, dissolving, granulating, dragee-making, levigating, emulsifying, encapsulating, entrapping or lyophilizing processes.
[0112] The term pharmaceutically acceptable means suitable for administration to a subject, e.g., a human. For example, the term pharmaceutically acceptable can mean approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term carrier refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic compound is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents such as acetates, citrates or phosphates. Antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; and agents for the adjustment of tonicity such as sodium chloride or dextrose are also envisioned. The carrier may constitute, in total, from about 0.1% to about 99.99999% by weight of the pharmaceutical compositions presented herein.
[0113] The compositions can take the form of solutions, suspensions, emulsions, tablets, pills, capsules, powders, gels, creams, ointments, foams, pastes, sustained-release formulations and the like. The compositions can be formulated as a suppository, with traditional binders and carriers such as triglycerides, microcrystalline cellulose, gum tragacanth or gelatin. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in: Remington's Pharmaceutical Sciences by E. W. Martin, the contents of which are hereby incorporated by reference herein. Such compositions will contain a therapeutically effective amount of the peptide of the invention, preferably in a substantially purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the subject.
[0114] An embodiment of the invention relates to a polypeptide presented in unit dosage form and are prepared by any of the methods well known in the art of pharmacy. In an embodiment of the invention, the unit dosage form is in the form of a tablet, capsule, lozenge, wafer, patch, ampoule, vial or pre-filled syringe. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation will also depend on the route of administration, and the nature of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses can be extrapolated from dose-response curves derived from in-vitro or in-vivo animal model test bioassays or systems.
[0115] Depending on the location of the tissue of interest, the polypeptides of the present invention can be supplied in any manner suitable for the provision of the peptide to cells within the tissue of interest. Thus, for example, a composition containing the polypeptides can be introduced, for example, into the systemic circulation, which will distribute said peptide to the tissue of interest. Alternatively, a composition can be applied topically to the tissue of interest (e.g., injected, or pumped as a continuous infusion, or as a bolus within a tissue, applied to all or a portion of the surface of the skin, etc.).
[0116] In an embodiment of the invention, polypeptides are administered via oral, rectal, vaginal, topical, nasal, ophthalmic, transdermal, subcutaneous, intramuscular, intraperitoneal or intravenous routes of administration. The route of administration of the pharmaceutical composition will depend on the disease or condition to be treated. Suitable routes of administration include, but are not limited to, parenteral injections, e.g., intradermal, intravenous, intramuscular, intralesional, subcutaneous, intrathecal, and any other mode of injection as known in the art. Although the bioavailability of peptides administered by other routes can be lower than when administered via parenteral injection, by using appropriate formulations it is envisaged that it will be possible to administer the compositions of the invention via transdermal, oral, rectal, vaginal, topical, nasal, inhalation and ocular modes of treatment. In addition, it may be desirable to introduce the pharmaceutical compositions of the invention by any suitable route, including intraventricular and intrathecal injection; intraventricular injection may be facilitated by an intraventricular catheter, for example, attached to a reservoir. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer.
[0117] For topical application, a peptide of the present invention, derivative, analog or a fragment thereof can be combined with a pharmaceutically acceptable carrier so that an effective dosage is delivered, based on the desired activity. The carrier can be in the form of, for example, and not by way of limitation, an ointment, cream, gel, paste, foam, aerosol, suppository, pad or gelled stick.
[0118] For oral applications, the pharmaceutical composition may be in the form of tablets or capsules, which can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose; a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate; or a glidant such as colloidal silicon dioxide. When the dosage unit form is a capsule, it can contain, in addition to materials of the above type, a liquid carrier such as fatty oil. In addition, dosage unit forms can contain various other materials which modify the physical form of the dosage unit, for example, coatings of sugar, shellac, or other enteric agents. The tablets of the invention can further be film coated.
[0119] For purposes of parenteral administration, solutions in sesame or peanut oil or in aqueous propylene glycol can be employed, as well as sterile aqueous solutions of the corresponding water-soluble salts. Such aqueous solutions may be suitably buffered, if necessary, and the liquid diluent first rendered isotonic with sufficient saline or glucose. These aqueous solutions are especially suitable for intravenous, intramuscular, subcutaneous and intraperitoneal injection purposes.
[0120] The compositions of the present invention are generally administered in the form of a pharmaceutical composition comprising at least one of the active components of this invention together with a pharmaceutically acceptable carrier or diluent. Thus, the compositions of this invention can be administered either individually or together in any conventional oral, parenteral or transdermal dosage form.
[0121] Pharmaceutical compositions according to embodiments of the invention may contain 0.1%-95% of the active components(s) of this invention, preferably 1%-70%. In any event, the composition or formulation to be administered may contain a quantity of active components according to embodiments of the invention in an amount effective to treat the condition or disease of the subject being treated.
[0122] The compositions also comprise preservatives, such as benzalkonium chloride and thimerosal and the like; chelating agents, such as EDTA sodium and others; buffers such as phosphate, citrate and acetate; tonicity agents such as sodium chloride, potassium chloride, glycerin, mannitol and others; antioxidants such as ascorbic acid, acetylcystine, sodium metabisulfote and others; aromatic agents; viscosity adjustors, such as polymers, including cellulose and derivatives thereof; and polyvinyl alcohol and acid and bases to adjust the pH of these aqueous compositions as needed. The compositions may also comprise local anesthetics or other actives.
[0123] In addition, the compositions may further comprise binders (e.g. acacia, cornstarch, gelatin, carbomer, ethyl cellulose, guar gum, hydroxypropyl cellulose, hydroxypropyl methyl cellulose, povidone), disintegrating agents (e.g. cornstarch, potato starch, alginic acid, silicon dioxide, croscarmelose sodium, crospovidone, guar gum, sodium starch glycolate), buffers (e.g., Tris-HCl, acetate, phosphate) of various pH and ionic strength, additives such as albumin or gelatin to prevent absorption to surfaces, detergents (e.g., Tween 20, Tween 80, Pluronic F68, bile acid salts), protease inhibitors, surfactants (e.g. sodium lauryl sulfate), permeation enhancers, solubilizing agents (e.g., glycerol, polyethylene glycerol), anti-oxidants (e.g., ascorbic acid, sodium metabisulfite, butylated hydroxyanisole), stabilizers (e.g. hydroxypropyl cellulose, hyroxypropylmethyl cellulose), viscosity increasing agents (e.g. carbomer, colloidal silicon dioxide, ethyl cellulose, guar gum), sweeteners (e.g. aspartame, citric acid), preservatives (e.g., Thimerosal, benzyl alcohol, parabens), lubricants (e.g. stearic acid, magnesium stearate, polyethylene glycol, sodium lauryl sulfate), flow-aids (e.g. colloidal silicon dioxide), plasticizers (e.g. diethyl phthalate, triethyl citrate), emulsifiers (e.g. carbomer, hydroxypropyl cellulose, sodium lauryl sulfate), polymer coatings (e.g., poloxamers or poloxamines), coating and film forming agents (e.g. ethyl cellulose, acrylates, polymethacrylates) and/or adjuvants.
[0124] The polypeptides of the present invention, derivatives, or analogs thereof can be delivered in a controlled release system. Thus, an infusion pump can be used to administer the peptide such as the one that is used, for example, for delivering insulin or chemotherapy to specific organs or tumors. In one embodiment, the peptide of the invention is administered in combination with a biodegradable, biocompatible polymeric implant, which releases the peptide over a controlled period of time at a selected site. Examples of preferred polymeric materials include, but are not limited to, polyanhydrides, polyorthoesters, polyglycolic acid, polylactic acid, polyethylene vinyl acetate, copolymers and blends thereof (See, Medical applications of controlled release, Langer and Wise (eds.), 1974, CRC Pres., Boca Raton, Fla., the contents of which are hereby incorporated by reference in their entirety). In yet another embodiment, a controlled release system can be placed in proximity to a therapeutic target, thus requiring only a fraction of the systemic dose.
[0125] In one embodiment, compositions of the present invention are presented in a pack or dispenser device, such as an FDA approved kit, which contain one or more unit dosage forms containing the active ingredient. In one embodiment, the pack or dispenser device is accompanied by instructions for administration.
[0126] In one embodiment, it will be appreciated that the polypeptides of the present invention can be provided to the individual with additional active agents to achieve an improved therapeutic effect as compared to treatment with each agent by itself. In another embodiment, measures (e.g., dosing and selection of the complementary agent) are taken to adverse side effects which are associated with combination therapies.
[0127] A therapeutically effective amount of the peptide is that amount of peptide which is sufficient to provide a beneficial effect to the subject to which the peptide is administered. More specifically, a therapeutically effective amount means an amount of the peptide effective to prevent, alleviate or ameliorate tissue damage or symptoms of a disease of the subject being treated.
[0128] In some embodiments, preparation of effective amount or dose can be estimated initially from in vitro assays. In one embodiment, a dose can be formulated in animal models and such information can be used to more accurately determine useful doses in humans.
[0129] In one embodiment, toxicity and therapeutic efficacy of the active ingredients described herein can be determined by standard pharmaceutical procedures in vitro, in cell cultures or experimental animals. In one embodiment, the data obtained from these in vitro and cell culture assays and animal studies can be used in formulating a range of dosage for use in human. In one embodiment, the dosages vary depending upon the dosage form employed and the route of administration utilized. In one embodiment, the exact formulation, route of administration and dosage can be chosen by the individual physician in view of the patient's condition. [See e.g., Fingl, et al., (1975) The Pharmacological Basis of Therapeutics, Ch. 1 p. 1].
[0130] In one embodiment, depending on the severity and responsiveness of the condition to be treated, dosing can be of a single or a plurality of administrations, with course of treatment lasting from several days to several weeks or until cure is effected or diminution of the disease state is achieved. In one embodiment, the amount of a composition to be administered will, of course, be dependent on the subject being treated, the severity of the affliction, the manner of administration, the judgment of the prescribing physician, etc. In one embodiment, compositions including the preparation of the present invention formulated in a compatible pharmaceutical carrier are also prepared, placed in an appropriate container, and labeled for treatment of an indicated condition.
[0131] As used herein, the terms treatment or treating of a disease, disorder, or condition encompasses alleviation of at least one symptom thereof, a reduction in the severity thereof, or inhibition of the progression thereof. Treatment need not mean that the disease, disorder, or condition is totally cured. To be an effective treatment, a useful composition herein needs only to reduce the severity of a disease, disorder, or condition, reduce the severity of symptoms associated therewith, or provide improvement to a patient or subject's quality of life.
Therapeutic Use
[0132] According to another aspect, there is provided a method for treating a mesotrypsin-associated and/or kallikrein-6 associated pathological condition in a subject in need thereof, the method comprising the step of administering to said subject a pharmaceutical composition comprising an effective amount of an isolated polypeptide comprising the amino acid selected from the group consisting of SEQ ID NO: 1-23, and a pharmaceutically acceptable carrier, thereby treating the mesotrypsin-associated and/or kallikrein-6 associated pathological condition in a subject in need thereof. In some embodiments, the mesotrypsin-associated and/or kallikrein-6 associated pathological condition is a cancer.
[0133] According to another aspect, the invention provides a pharmaceutical composition comprising an effective amount of an isolated polypeptide comprising the amino acid selected from the group consisting of SEQ ID NO: 1-23, and a pharmaceutically acceptable carrier, for use in treating mesotrypsin-associated and/or kallikrein-6 associated pathological condition in a subject in need thereof. In some embodiments, the mesotrypsin-associated and/or kallikrein-6 associated pathological condition is a cancer.
[0134] According to another aspect, the invention provides use of a pharmaceutical composition comprising an effective amount of an isolated polypeptide comprising the amino acid selected from the group consisting of SEQ ID NO: 1-23 and a pharmaceutically acceptable carrier, for preparation of a medicament for treating a mesotrypsin-associated and/or kallikrein-6 associated pathological condition in a subject in need thereof. In some embodiments, the medicament for treating cancer in a subject in need thereof.
[0135] According to another embodiment, the pharmaceutical composition comprises an effective amount of an isolated polypeptide comprising the amino acid selected from the group consisting of SEQ ID NO: 1-14, and a pharmaceutically acceptable carrier.
[0136] According to another embodiment, the cancer is a mesotrypsin-associated cancer. According to another embodiment, said cancer is selected from the group consisting of prostate, lung, colon, breast, pancreas, gastric and non-small cell lung cancer (NSCLC) or metastasis thereof. According to another embodiment, said cancer is prostate cancer. According to another embodiment, said cancer is gastric cancer.
[0137] According to another embodiment, said treating is inhibiting invasiveness of a cancerous cell.
Diagnostic Use
[0138] According to some aspects, the APPI variants of the invention may be utilized as affinity agents for the detection and/or analysis of mesotrypsin and/or kallikrein-6. The term affinity agent generally refers to a molecule that specifically binds to an antigen (e.g., mesotrypsin, kallikrein-6).
[0139] In some embodiments, the APPI variants of the invention are labeled. Non-limiting examples of labels are fluorescent labels for fluorescence microscopy, radioactive labels for autoradiography, or electron dense for electron microscopy. The labeled APPI variant may be used essentially in the same type of applications as labeled monoclonal antibodies, e.g. fluorescence and radio assays, cytofluorimetry, fluorescence activated cell sorting etc. The principles of such techniques can be found in immunochemistry handbooks, for example: A Johnstone and R Thorpe, Immunochemistry in practice, 2.sup.nd Edition (1987), blackwell Scientific publications, Oxford London Edinburgh Boston Palo Alto Melbourne.
[0140] According to some aspects, the invention provides a method for directly visualizing the cellular distribution of mesotrypsin and/or kallikrein-6. In some embodiments, the method comprises the step of contacting a cell with a labeled APPI variants of the invention. In some embodiments, the method further includes a step of imaging the cell. In some embodiments, the cell is a whole cell, a population of cells, cells fixed onto slides or sections through solid tissue. In some embodiments, the contacting is performed in-vitro. In other embodiments, the contacting is performed in vivo.
[0141] In some embodiments, there is provided an imaging reagent composed of the peptide of the invention (i.e., the APPI variant described herein) as an affinity agent coupled, directly or indirectly, to an imaging agent. In one embodiment, said imaging reagent is predictive of a mesotrypsin-associated disease or a disease state. In another embodiment, said mesotrypsin-associated disease or disorder is cancer such as prostate cancer. In one embodiment, the imaging reagent is predictive of a kallikrein-6-associated disease or a disease state.
[0142] A disease state refers to the current status of a disease which may have been previously diagnosed, such prognosis, risk-stratification, assessment of ongoing drug therapy, prediction of outcomes, determining response to therapy, diagnosis of a disease or disease complication, following progression of a disease or providing any information relating to a patient's health status over time.
[0143] In one embodiment, said imaging agent is an isotope. Typically, useful diagnostic isotopes (e.g., for PET and SPECT-based detection and imaging) for use in accordance with the present invention include: .sup.18F, .sup.47Sc, .sup.51Cr, .sup.52Fe, .sup.52mMn, .sup.56Ni, .sup.57Ni, .sup.62Cu, .sup.64Cu, .sup.67Ga, .sup.68Ga, .sup.72As, .sup.75Br, .sup.76Br, .sup.77Br, .sup.82Br, .sup.89Zr, .sup.94mTc, .sup.97Ru, .sup.99mTc, .sup.111In, .sup.123I, .sup.124I, .sup.131I, .sup.191Pt, .sup.197Hg, .sup.201Tl, .sup.203Pb, .sup.101mIn, .sup.120I.
[0144] In another embodiment, the invention provides a method of imaging a neoplastic tissue, the method comprises administering to a subject having (or suspected of having) a neoplasia, an imaging reagent compound of the invention, and detecting the compound following distribution thereof in vivo. In some embodiments, said method of imaging includes the subsequent step (e.g., following the detection step) of generating an image of the detected distributed compound. The detection step may be performed using PET or single photon emission computed tomography (SPECT) when the label is a radionuclide. When magnetic or paramagnetic labels are employed, magnetic resonance imaging may be used.
[0145] In another embodiment, the present invention provides a kit comprising: [0146] a. an APPI variant of the invention or an analog, a derivative or fragment thereof, or a composition comprising said APPI variant; and [0147] b. at least one signal producing label.
[0148] In some embodiments, the APPI variant of said kit is conjugated, directly or indirectly, to the signal-producing label, such as a tag, as described herein.
[0149] In some embodiments, the kit is for assessing mesotrypsin function in a cell. In some embodiments, the kit is for assessing kallikrein-6 function in a cell. In some embodiments, the kit is for diagnosing a mesotrypsin associated pathological condition in a subject in need thereof. In some embodiments, the kit is for diagnosing a kallikrein-6 associated pathological condition in a subject in need thereof. In some embodiments, the kit is for diagnosing cancer in a subject in need thereof.
[0150] In the discussion unless otherwise stated, adjectives such as substantially and about modifying a condition or relationship characteristic of a feature or features of an embodiment of the invention, are understood to mean that the condition or characteristic is defined to within tolerances that are acceptable for operation of the embodiment for an application for which it is intended. Unless otherwise indicated, the word or in the specification and claims is considered to be the inclusive or rather than the exclusive or, and indicates at least one of, or any combination of items it conjoins.
[0151] In the description and claims of the present application, each of the verbs, comprise, include and have and conjugates thereof, are used to indicate that the object or objects of the verb are not necessarily a complete listing of components, elements or parts of the subject or subjects of the verb.
[0152] Additional objects, advantages, and novel features of the present invention will become apparent to one ordinarily skilled in the art upon examination of the following examples, which are not intended to be limiting. Additionally, each of the various embodiments and aspects of the present invention as delineated hereinabove and as claimed in the claims section below finds experimental support in the following examples.
EXAMPLES
[0153] Generally, the nomenclature used herein and the laboratory procedures utilized in the present invention include molecular, biochemical, microbiological and recombinant DNA techniques. Such techniques are thoroughly explained in the literature. See, for example, Molecular Cloning: A laboratory Manual Sambrook et al., (1989); Current Protocols in Molecular Biology Volumes I-III Ausubel, R. M., ed. (1994); Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1989); Perbal, A Practical Guide to Molecular Cloning, John Wiley & Sons, New York (1988); Watson et al., Recombinant DNA, Scientific American Books, New York; Birren et al. (eds) Genome Analysis: A Laboratory Manual Series, Vols. 1-4, Cold Spring Harbor Laboratory Press, New York (1998); methodologies as set forth in U.S. Pat. Nos. 4,666,828; 4,683,202; 4,801,531; 5,192,659 and 5,272,057; Cell Biology: A Laboratory Handbook, Volumes I-III Cellis, J. E., ed. (1994); Culture of Animal CellsA Manual of Basic Technique by Freshney, Wiley-Liss, N. Y. (1994), Third Edition; Current Protocols in Immunology Volumes I-III Coligan J. E., ed. (1994); Stites et al. (eds), Basic and Clinical Immunology (8th Edition), Appleton & Lange, Norwalk, Conn. (1994); Mishell and Shiigi (eds), Strategies for Protein Purification and CharacterizationA Laboratory Course Manual CSHL Press (1996); all of which are incorporated by reference. Other general references are provided throughout this document.
Materials and Methods
Plasmids and Cell Culture
[0154] Cells.
[0155] PC3-M cells were maintained in RPMI 1640 (Invitrogen) supplemented with 10% fetal bovine serum (Invitrogen).
[0156] Reagents.
[0157] Synthetic oligonucleotides were obtained from Integrated DNA Technologies. Restriction enzymes and polymerases were purchased from New England Biolabs, and dNTPs, from Jena Bioscience. Bacterial plasmid extraction and purification kits were obtained from RBC Bioscience, and yeast plasmid extraction kits, from Zymo Research. The methylotrophic yeast Pichia pastoris strain GS115, Pichia expression vector (pPIC9K), and fluorescein (FITC)-conjugated streptavidin were obtained from Invitrogen. Bovine trypsin, phycoerytherin (PE)-conjugated anti mouse antibody, and the substrates benzyloxycarbonyl-Gly-Pro-Arg-p-nitroanalide (Z-GPR-pNA), 4-nitrophenyl 4-guanidinobenzoate (pNPGB), and benzoyl-L-arginine-p-nitroanilide (L-BAPA) were obtained from Sigma-Aldrich. Mouse anti-c-Myc antibody (Ab-9E10) was obtained from Abcam. EZ-Link NHS-PEG4 biotinylation kit was purchased from ThermoFisher Scientific. Factor-XIa and its substrate S-2366 (Chromogenix) were obtained from Hematologic Technologies Inc. and Diapharma, respectively.
[0158] Synthesis and Cloning of the DNA Encoding APPI.sub.WT.
[0159] The inhibitor domain of the amyloid precursor protein (APPI.sub.WT) gene was constructed based on a published sequence (PDB id IZJD) by using codons optimized for both Saccharomyces cerevisiae and P. pastoris usage and synthesized by PCR-assembly using six overlapping oligonucleotides. The final PCR assembled fragment was gel-purified and cloned into the YSD vector (pCTCON) via transformation of EBY100 yeast cell with linearized vector (digested with NheI and BamHI) and the PCR product. This simultaneous cloning and transformation occurs via the in vivo homologous recombination between the vector and the PCR insert to generate the YSD plasmid. After sequence verification, the DNA construct served as the template for combinatorial library generation. The individual YSD APPI mutants were prepared by the same methodology.
[0160] Generation of a Combinatorial Based APPI Library.
[0161] Generation of the YSD APPI library is described in detail below. In brief, a randomly mutated version of the APPI gene was first constructed by error-prone PCR using nucleotide analogues and low-fidelity Taq polymerase. The resulting insert was amplified and transformed into yeast through homologous recombination. Random mutagenesis in the APPI sequence generated an APPI library with 0-3 mutations per clone, yielding an experimental library size of about 910.sup.6 clones.
[0162] Flow Cytometry and Cell Sorting.
[0163] Yeast-displayed APPI library and individual APPI variants were grown in SDCAA selective medium (2% dextrose, 1.47% sodium citrate, 0.429% citric acid monohydrate, 0.67% yeast nitrogen base and 0.5% casamino acids) and induced for expression with galactose medium (same as for SDCAA, but with galactose instead of dextrose), according to established protocols. Due to the different enzymatic turnover times of APPI and its variants by the target trypsins, i.e., bovine trypsin or mesotrypsin, two methods for trypsin-labeling were used, namely, double staining and triple staining, for the detection of proteolytically resistant clones, as described below. In the first step of labeling, approximately 110.sup.6 cells were labeled with the appropriate catalytically active trypsin and a 1:50 dilution of mouse anti-c-Myc antibody in trypsin buffer (TB; 100 mM Tris-HCl, pH 8.0, 1 mM CaCl.sub.2) supplemented with 1% bovine serum albumin (BSA) for 30 min at room temperature. In the second step of labeling, for double staining the cells were exposed to biotinylated-bovine trypsin or mesotrypsin, and for triple staining the cells were treated with non-biotinylated bovine trypsin or mesotrypsin. For triple staining, a third labelling step was then applied: the cells were washed with TB and incubated with 2 M of biotinylated catalytically inactive mesotrypsin-S195A for 1 h at room temperature. Finally, for both double staining and triple staining, cells were washed with ice-cold TB followed by incubation with a 1:800 dilution of fluorescein (FITC)-conjugated streptavidin and a 1:50 dilution of PE-conjugated anti mouse secondary antibody for 30 min on ice. Cells were washed again and analyzed by dual-color flow cytometry (Accuri C6; BD Biosciences).
[0164] Cell sorting of triple-stained cells was carried out as described in
[0165] Production of Recombinant Proteins.
[0166] Recombinant human anionic trypsinogen, human cationic trypsinogen and human mesotrypsinogen, in addition to the catalytically inactive S195A mutant of mesotrypsinogen, were expressed in E. coli, extracted from inclusion bodies, refolded, purified and activated with bovine enteropeptidase as described in previous work (alameh, M. A., et al., J Biol Chem, 2008. 283(7): p. 4115-23; Salameh, M. A., et al., Biochem J, 2011. 440(1): p. 95-105). Mesotrypsin and mesotrypsin-S195A were biotinylated for use in YSD screens, and biotin incorporation quantified by 4-hydroxyazobenzene-2-carboxylic acid (HABA) assay, using the EZ-Link NHS-PEG4 biotinylation kit (ThermoFisher Scientific) according to manufacturer instructions. Constructs, cloning, expression and purification of APPI variants are described in detail below. In brief, APPI variants were expressed in P. pastoris strain GS115 under control of the AOX1 (alcohol oxidase) promoter using the expression vector pPIC9K. Inhibitors were purified from the yeast culture supernatant by immobilized metal affinity chromatography using a HisTrap 5-ml column (GE Healthcare). Eluted inhibitors were concentrated, and the buffer was replaced with TB. Gel filtration chromatography was performed on a 16/600 Superdex 75 column (GE Healthcare) equilibrated with TB at a flow rate of 1 ml/min on an KTA pure instrument (GE Healthcare). Purification yields for all APPI variants were 5-20 mg per one-liter culture flask.
[0167] Trypsin Inhibition Studies.
[0168] The concentrations of mesotrypsin, cationic trypsin, anionic trypsin and bovine trypsin were quantified by active site titration using pNPGB, which serves as both irreversible trypsin inhibitor and substrate. Concentrations of FXIa and Kallikrein-6 were determined by UV-Vis absorbance at 280 nm with extinction coefficient (.sub.280) of 214.410.sup.3 M.sup.1 cm.sup.1 and 34.6710.sup.3 M.sup.1 cm.sup.1, respectively. Concentrations of the chromogenic substrates Z-GPR-pNA and S-2366 were determined by an end-point assay (from the change in the absorbance (plateau after complete hydrolysis) that is obtained by the release of p-nitroaniline). Concentrations of APPI variants were determined by titration with pre-titrated bovine trypsin and the substrate L-BAPA, as previously described (Salameh, M. A., et al., Protein Sci, 2012. 21(8): p. 1103-12.).
[0169] The constant K.sub.i of APPI.sub.WT and its variants: APPI.sub.M17G, APPI.sub.I18F and APPI.sub.F34V in complex with mesotrypsin were determined according to the previously described methodology with minor changes (Salameh, M. A., et al., 2012, ibid). Later, this methodology was adjusted for measuring the dissociation constant of APPI.sub.M17G/I18F/F34V in complex with FXIa. Briefly, stock solutions of enzyme, substrate, and APPI proteins were prepared at 40the desired final concentrations. Assays were performed at 37 C. in the presence of different concentrations of substrate and inhibitor in a Synergy2 microplate spectrophotometer (BioTek). The concentrations of reagents are given in
[0170] Inhibition studies of (i) mesotrypsin with APPI variants M17G, M17G/I18F, M17G/F34V, I18F/F34V and M17G/I18F/F34V, (ii) cationic trypsin, anionic trypsin and Kallikrein-6 with APPI.sub.WT and APPI.sub.M17G/I18F/F34V, and (iii) FXIa with APPI.sub.M17G/I18F/F34V, were carried out in a similar manner, but the finding of slow, tight binding behavior required a different kinetic treatment as compared to the one presented in Eq. 1. In tight binding kinetics, the reduction of the inhibitor concentration upon binding is significant (i.e. tight binding/strong interactions) and should be considered. Briefly, tight binding experiments including the reactions of mesotrypsin, cationic trypsin and anionic trypsin were conducted at fixed concentration of Z-GPR-pNA (145 M), the inhibitor concentrations ranged between 5-80 nM, and the enzyme concentration was 0.1 nM (
[0171] Tight binding reactions of FXIa and Kallikrein-6 were carried out in the same manner with minor changes as follows: for FXIa the substrate (S-2366) concentration was 600 M, inhibitor concentrations ranged between 2-10 nM, enzyme concentration was 0.125 nM, assay buffer was FB, and the reactions were run at 37 C. and followed spectroscopically for 1 h. Reactions of Kallikrein-6 were carried out at fixed concentration of BOC-Phe-Ser-Arg-AMC (1 mM), the inhibitor concentrations ranged between 5-50 nM, enzyme concentration was 1 nM, assay buffer was Kallikrein buffer (KB; 50 mM Tris-HCl, pH 7.3, 100 mM NaCl and 0.2% BSA) and the reactions were run at 37 C. (for 5 h) and followed by fluorescent signal in a Tecan Infinite 200 PRO NanoQuant microplate reader set at 355 nm for excitation and 460 nm for emission.
[0172] Inhibition constants for tight binding reactions were calculated using Equation 2, as described previously (Salameh, M. A., et al., 2012, ibid.), where v.sub.i and v.sub.0 are the steady-state rates in the presence and absence of inhibitor, K.sub.M is the Michaelis constant for substrate cleavage, and [S].sub.0 and [I].sub.0 are the initial concentrations of substrate and inhibitor, respectively. Calculations were performed using K.sub.M values of 24.661.3 M for mesotrypsin, 22.841.9 M for cationic trypsin, 10.690.65 M for anionic trypsin, 361.312.1 M for FXIa, and 329.32.5 M for Kallikrein-6 as determined from at least three Michaelis-Menten kinetic experiments.
[0173] Hydrolysis Studies.
[0174] The cleavage of intact APPI variants (between the residues Arg15-Ala16) in time course incubations with catalytically active mesotrypsin was monitored by HPLC as described previously, with minor modifications. Briefly, mesotrypsin was incubated with the APPI mutants in TB at 37 C.; inhibitor concentrations were 50 M and mesotrypsin concentrations were varied from 0.05 M to 2.5 M. For HPLC analysis, aliquots of 30 l were withdrawn from the hydrolysis reactions at periodic intervals (over six hours), and samples were quenched immediately by acidification with 70 l of 0.3 M HCl. Samples were resolved on a 502.0-mm Jupiter 4 90- C.sub.12 column (Phenomenex) with a gradient of 0-100% acetonitrile in 0.1% trifluoroacetic acid (TFA) at a flow rate of 0.6 ml/min over 50 min. Intact inhibitors were quantified by peak integration of absorbance traces monitored at 210 nm. Initial rates were obtained by linear regression using a minimum of six data points within the initial linear phase of the reaction. Hydrolysis rates reported for each inhibitor represent the average of three independent experiments.
[0175] Prostate Cancer Cell Invasion Assays.
[0176] Matrigel transwell invasion assays of PC3-M human prostate cancer cells were conducted essentially as described previously (Hockla, A., et al., Mol Cancer Res, 2012. 10(12): p. 1555-66). Cells subjected to knockdown of PRSS3 expression, using lentiviral short hairpin RNA construct NM_002771.2-454s1c1 (Sigma), served as a positive control for suppression of mesotrypsin activity in all experiments. Efficient knockdown was confirmed by qRT/PCR using an Applied Biosystems 7900HT Fast Real-Time PCR System; PRSS3 was detected using TaqMan assay Hs00605637_m1 and normalized against GAPDH expression using Taqman assay Hs99999905_m1. Cells used for all other conditions were instead transduced with a non-target control lentiviral vector containing a short hairpin that does not recognize any human genes. Prior to invasion assays, cells were seeded at 1.510.sup.6 cells per 10 cm dish (day 1), media were replaced with a mixture of 3.6 mL RPMI containing 10% FBS and 10 g/ml polybrene and 2.4 mL conditioned lentiviral media containing lentiviral particles to transduce cells (day 2), media were changed after 24 h and cells selected with 2 g/ml puromycin (day 3), and then cells were trypsinized, washed, and seeded into 24-well 8.0 m cell culture inserts (BD) previously coated with 50 g Matrigel (210.sup.4 cells per insert in 400 l media; day 4). In some experimental conditions, APPI.sub.WT or APPI.sub.M17G/I18F/F34V proteins (1 nM-1 M) were added to the cell suspensions at the time of seeding into transwell inserts; quadruple biological replicates were performed per treatment. Cells were allowed to invade toward a chemoattractant medium comprised of 750 L NIH/3T3 cell-conditioned serum free medium (DMEM supplemented with 50 pig/mL ascorbic acid). After 18 hours (day 5), non-invading cells were removed, filters fixed with methanol, stained with crystal violet, and air dried. Stained filters were photographed and invading cells counted using Image-Pro 6.3 software (Media Cybernetics). Consistent results were obtained from 5 independent experiments.
[0177] Prostate Cancer Cell 3D Culture Assays.
[0178] PC3-M cells for 3D culture assays were transduced with either a lentiviral shRNA construct targeting PRSS3 or with a non-target control construct recognizing no human genes, following the schedule described above for Prostate cancer cell invasion assays. On day 4, cells were seeded into 3D cultures in Matrigel following the on-top protocol essentially as described previously (Hockla, A., et al., 2012, ibid.). Briefly, in 12-well plates, a base layer of 250 l 100% Matrigel was polymerized, PC3-M cells (210.sup.4 cells/well) in serum-free RPMI 1640 medium were seeded and allowed to attach, excess medium was aspirated, and cells were overlaid with 500 l of medium supplemented with 10% Matrigel and 0.5% fetal bovine serum as well as with 1 nM, 10 nM, or 100 nM of APPI.sub.WT or APPI.sub.M17G/I18F/F34V in some conditions as indicated. Cultures were maintained at 37 C. in 5% CO.sub.2 for 3 days, photographed, and analyzed.
[0179] Synthesis and Cloning of the DNA Encoding the APPI.sub.WT.
[0180] The DNA sequence of APPI.sub.WT attached to a peptide linker (NH.sub.3.sup.+-APPI.sub.WT-LPDKPLAFQDPS-COO.sup.) was generated by PCR assembly using the following six overlapping oligonucleotides (5-3):
TABLE-US-00002 Oligo1 (SEQIDNO:26) (GATGGTATTTCGATGTTACTGAAGGTAAATGTGCTCCATTCTTCTATGG TGGTTGTGGTG); Oligo1 (SEQIDNO:27) (CCACAAACAGCCATACAATATTCTTCAGTATCGAAATTATTTCTATTAC CACCACAACCACCATAGAAGAAT); Oligo2: (SEQIDNO:28) (GAAGTTTGTTCTGAACAAGCTGAAACTGGTCCATGTAGAGCTATGATTT CTAGATGGTATTTCGATGTTACTG); Oligo2: (SEQIDNO:29) (GGAAAGCCAATGGTTTATCTGGCAAGGATCCAATAGCAGAACCACAAAC AGCCATACAATATTC); Oligo3: (SEQIDNO:30) (GGTGGTTCTGGTGGTGGTGGTTCTGGTGGTGGTGGTCTGCTAGCGAAGT TTGTTCTGAACAAGCTG); Oligo3: (SEQIDNO:31) (GAGCTATTACAAGTCCTCTTCAGAAATAAGCTTTTGTTCAGATGGATCT TGGAAAGCCAATGGTTTATC).
[0181] The synthetic insert gene was assembled by a set of three PCRs using Phusion DNA polymerase, while each paired reaction (OligoX/X) served as a template for the following reaction.
[0182] DNA Sequence of APPI caring combination of specific mutations were generated using the same methodology, however with oligonucleotides containing the respectively mutations:
TABLE-US-00003 Oligo2.sup.a: (SEQIDNO:32) (GAAGTTTGTTCTGAACAAGCTGAAACTGGTCCATGTAGAGCTGGTTTTT CTAGATGGTATTTCGATGTTACTG); Oligo2.sup.b: (SEQIDNO:33) (GAAGTTTGTTCTGAACAAGCTGAAACTGGTCCATGTAGAGCTGGTATTT CTAGATGGTATTTCGATGTTACTG); Oligo2.sup.c: (SEQIDNO:34) (GAAGTTTGTTCTGAACAAGCTGAAACTGGTCCATGTAGAGCTATGTTTT CTAGATGGTATTTCGATGTTACTG); Oligo1.sup.a: (SEQIDNO:35) (CCACAAACAGCCATACAATATTCTTCAGTATCGAAATTATTTCTATTAC CACCACAACCACCATAGACGAATG).
[0183] The final PCR assembled fragment was gel-purified and subcloned into the YSD vector (pCTCON) using transformation by electroporation of EBY100 yeast cells having a linearized vector (digested with NheI and BamHI) and the PCR product. Next, plasmid DNA was extracted from the yeast clones using a Zymoprep kit and transformed into electrocompetent E. coli cells for plasmid miniprep and sequence analysis.
[0184] Generation of Combinatorial APPI Library.
[0185] After assembly and cloning of APPI.sub.WT, the plasmid construct served as the template for the subsequent generation of the combinatorial library by using error-prone PCR. To generate a mutation frequency of 3 mutations per clone, the PCR reaction was optimized to 15PCR doublings of the 300-bp APPI fragment (including plasmid homologue regions) with low-fidelity Taq polymerase, 1% nucleotide analogues and 2 mM MgCl.sub.2. The resulting mutated insert was amplified and transformed into yeast through homologous recombination to generate a library of about 910.sup.6 in size, as estimated by dilution plating on selective SDCAA plates (same as for SDCAA, but supplemented with 15% agar). Sequencing results revealed an average mutation rate of 0-3 mutations per 300 bp.
[0186] Construction and Cloning of the Expression Vector pPIC9K-APPI.
[0187] The human cDNA of APPI.sub.WT was amplified by PCR using Phusion DNA polymerase with an upstream primer: 5-AGCGTATACGTAGACTATAAGGATGACGACGACAAAGAATTCGAAGTTTGTTCTGAA CAAGCTG-3 (SEQ ID NO: 36) and a downstream primer: 5-ATAGTTTAGCGGCCGCATGATGGTGGTGATGGTGCCTAGGAATAGCAGAACCACAAA CAGC-3 (SEQ ID NO: 37). The resulting construct included four restriction sites and two epitope tags (FLAG and HIS.sub.6) as follows: SnaBI-FLAG-EcoRI-APPI.sub.WT-AvrII-HIS.sub.6-NotI. The obtained DNA fragment was digested with SnaBI and NotI, and subcloned by using the same restriction sites of Pichia expression vector pPIC9K by standard methods. Next, the recombinant expression plasmid was used as a template for the construction of the APPI variants as follows: cDNA of each variant was amplified by PCR with an upstream primer: 5-CGGAGCGAATTCGAAGTTTGTTCTGAACAAGCTG-3 (SEQ ID NO: 38) and a downstream primer: 5-CGCTACCCTAGGAATAGCAGAACCACAAACAGC-3 (SEQ ID NO: 39). The resulting construct included the restriction sites EcoRI and AvrII. The obtained DNA fragment was digested with EcoRI and AvrII, and subcloned using the same restriction sites of the template vector. Finally, the sequence each of the recombinant expression plasmids was confirmed by DNA sequencing analysis.
[0188] Expression vectors were linearized by SacI digestion and used to transform P. pastoris strain GS115 by electroporation. This resulted in insertion of the construct at the AOX1 locus of P. pastoris, thereby generating a His.sup.+ Mut.sup.+ phenotype. Transformants were selected for the His.sup.+ phenotype on 2% agar containing regeneration dextrose biotin (RDB; 18.6% sorbitol, 2% dextrose, 1.34% yeast nitrogen base, 410.sup.5 percent biotin, and 0.005% each of L-glutamic acid, L-methionine, L-lysine, L-leucine, and L-isoleucine) and allowed to grow for 2 d at 30 C. Cells were harvested from the plates and subjected to further selection for high copy number by their ability to grow on 2% agar containing 1% yeast extract, 2% peptone, 2% dextrose medium, and the antibiotic G418 (Geneticin, 4 mg/ml, Invitrogen).
[0189] To verify direct insertion of the construct at the AOX1 locus of P. pastoris, the genomic DNA of the highest APPI-expressing colony from each APPI variant was extracted and amplified by PCR with an AOX1 upstream primer: 5-GACTGGTTCCAATTGACAAGC-3 (SEQ ID NO: 40) and an AOX1 downstream primer: 5-GCAAATGGCATTCTGACATCC-3(SEQ ID NO: 41). The resulting linear DNA was gel purified and its correct sequence was confirmed by DNA sequencing analysis.
[0190] Large-Scale Expression and Purification of APPI.
[0191] GS II5-APPI clones were first inoculated into 50 mL of BMGY (1% yeast extract, 2% peptone, 0.23% potassium phosphate monobasic, 1.18% potassium phosphate dibasic, 1.34% yeast nitrogen base, 410.sup.5 percent biotin and 1% glycerol) to an OD.sub.600=10.0, followed by scale up to 500 mL of BMGY until OD.sub.600=10.0 was reached (overnight growth at 30 C. with shaking at 300 rpm). Cells were harvested by centrifugation and resuspended in 1 L BMMY (1% yeast extract, 2% peptone, 0.23% potassium phosphate monobasic, 1.18% potassium phosphate dibasic, 1.34% yeast nitrogen base, 410.sup.5 percent biotin and 0.5% methanol) to an OD.sub.600 of 5, to induce expression, and grown at 30 C. with shaking at 300 rpm. Methanol was added to a final concentration of 2% every 24 h to maintain induction. Following five days of induction, the culture was centrifuged again, and the supernatant containing the secreted recombinant inhibitors was prepared for purification by nickel-immobilized metal affinity chromatography (IMAC).
[0192] The supernatant containing the recombinant APPI was filtered through a Steritop bottle-top filter (Millipore). The filtered supernatant was adjusted to 10 mM imidazole and 0.5 M NaCl at pH 8.0 and left to stand overnight at 4 C. Thereafter, a second filtration was performed to remove any additional precipitation. The resulting supernatant was loaded on a HisTrap 5-ml column (GE Healthcare) at a flow rate of 0.7 ml/min for 24 h, washed with 20 mM sodium phosphate, 0.5 M NaCl, and 10 mM imidazole (pH 8.0) and eluted with 20 mM sodium phosphate, 0.5 M NaCl, 0.5 M imidazole (pH 8.0) in an KTA pure instrument (
[0193] Bovine Trypsin Activity Assay.
[0194] Assays were conducted at 37 C. in a Synergy2 plate reader spectrophotometer (BioTek). TB (185 l), bovine trypsins (5 l; 100 nM bovine trypsin), and APPI inhibitor (5 l) were mixed and equilibrated prior to initiation of the reaction by the addition of the substrate, Z-GPR-pNA (5 l; 1.5 mM). Reactions were followed spectroscopically for 5 min, and initial rates were determined from the increase in absorbance (410 nm) caused by the release of p-nitroaniline.
[0195] Far-UV Circular Dichroism Spectroscopy.
[0196] Circular dichroism (CD) spectra were recorded on a Jasco J-715 spectropolarimeter over a range of 190-260 nm using a quartz cuvette with a path length of 1 mm, a scanning speed of 50 nm/min and a data interval of 1 nm. Each sample of APPI variant was first analyzed at room temperature (20 C.), and left in the spectropolarimeter until 95 C. was reached (denaturation), then the sample was analyzed, cooled to 20 C. (renaturation), and analyzed again. Proteins were analyzed in TB. Three scans of 50 M protein solutions were averaged to obtain smooth data and background corrected with respect to protein-free buffer (see
Example 1
Yeast-Displayed APPI.SUB.WT .is Rapidly Cleaved by Human Mesotrypsin
[0197] The yeast surface display (YSD) system for directed evolution is based on expression of a library of mutant proteins on the surface of yeast, followed by selection of variants with improved affinity. However, this system has not been employed previously for identifying proteolytic cleavage or improving the proteolytic resistance of a displayed inhibitor. To test the compatibility of APPI.sub.WT with the YSD system, the coding region of APPI.sub.WT was cloned into a YSD plasmid for presentation on the yeast S. cerevisiae surface as a fusion with the Aga2p agglutinin protein. Correct folding of APPI.sub.WT was then verified using FACS by detection of bound fluorescently labeled bovine trypsin, which is an established, tight-binding target of APPI. As seen in
[0198] Next, the ability of mesotrypsin to similarly detect APPI displayed on the yeast cell surface was assessed. Using a broad range of mesotrypsin concentrations, mesotrypsin binding was not detected (
Example 2
Strategy for Proteolytic Stability Maturation of an APPI Library
[0199] Prompted by the discovery that active mesotrypsin proteolyzes surface-displayed APPI and that mesotrypsin-S195A can detect residual, uncleaved APPI on the cell surface, it was postulated that these reagents could be used in a stepwise fashion to enrich an APPI diversity library for variants with proteolytic resistance. As a starting point, a randomized library was generated in which mutations were introduced throughout the entire APPI gene at a frequency of 0-3 mutations per clone, producing a library of about 910.sup.6 independent variants. Diversity was introduced throughout the molecule, because while protease specificity is largely directed by the sequence of the canonical binding loop, it was previously found that proteolytic stability is a property strongly influenced by residues within the scaffold
[0200] The presented unique screening strategy, designated triple staining, was comprised of three steps (
[0201] Diagonal sorting gates were used for each of the sorts S3, S4 and S5 (where S stands for sort, and the number indicates the sort phase), which allow binding normalization versus expression in real-time during the flow-cytometric sorting process, thereby dramatically decreasing bias of the expression level (i.e., the avidity effect).
Example 3
High-Affinity and High-Stability Variants Identified at S5
[0202] Triple staining analysis of cells displaying APPI.sub.WT and cells from the library maturation cycles (S1 to S5) showed that the more the sort is advanced, the stability and affinity for mesotrypsin is higher (
Example 4
Identification of APPI Clones with Improved Resistance to Cleavage
[0203] DNA sequencing of 37 randomly selected APPI clones from S5 showed three repeating mutations, M17A, I18F, and F34V, along with a number of unique mutations (Table 1).
[0204] Staining of the YSD clones with active mesotrypsin showed that M17G and I18F exhibited high binding affinity and proteolytic stability, whereas F34V had only marginally enhanced binding affinity and stability vs. APPI.sub.WT (
Example 5
Affinity/Stability-Matured APPI Variants Show Improvements in Mesotrypsin Inhibition
[0205] The YSD data shown in
TABLE-US-00004 TABLE 2 Kinetic constants of mesotrypsin with APPI variants SEQ ID Turnover Turnover NO Inhibitor K.sub.i (M) K.sub.i (fold) K.sub.cat (s.sup.1) time (s) time (fold) 25 APPI-WT *(1.31 0.17) 10.sup.7 1 (35.6 2.3) 10.sup.3 28.1 1.8 1 23 APPI-F34V *(5.01 0.46) 10.sup.8 2.6 (16.1 1.6) 10.sup.3 62.4 4.3 2.2 18 APPI-M17G .sup.**3.69 10.sup.9 34.8 18 APPI-M17G *(3.29 0.25) 10.sup.9 39.8 (15.6 1.5) 10.sup.3 64.3 6.4 2.3 19 APPI-I18F *(3.29 0.21) 10.sup.9 39.8 (10.4 0.9) 10.sup.3 96.5 8.2 3.4 20 APPI-I18F/F34V **(3.3 0.07) 10.sup.9 39.8 (5.35 0.2) 10.sup.3 187.1 7.7 6.6 21 APPI-M17G/F34V **(1.40 0.11) 10.sup.9 93.6 (37.1 1.4) 10.sup.4 270.0 10.1 9.6 22 APPI-M17G/I18F **(45.25 0.36) 10.sup.11 290 (29.1 0.6) 10.sup.4 344.0 7.6 12.2 8 APPI-M17G/I18F/ **(89.8 0.23) 10.sup.12 1459 (4.29 0.3) 10.sup.4 2336.7 140.0 83 F34V * and ** represent fitted to Equations 1 and 2, respectively. .sup.Values are means SD
[0206] Considering that the lowest K.sub.i values of our single-mutation APPI variants are in the lower nano-molar range, close to the practical limit of 1-2 nM for K.sub.i determination using the classical competitive inhibition equation (Williams and Morrison, Methods Enzymol. 1979; 63:437-67), it was not possible to apply this method for combination variants expected to exhibit much lower K.sub.i values as a slow, tight binders (assuming additive or cooperative effect). Hence, the assumption of slow, tight binding behavior required a different kinetic treatment, as shown in
[0207] In addition to affinity and stability, inhibitor specificity is another significant factor for in-vivo applications. The S1 peptidase family to which mesotrypsin belongs is one of the largest protease families in the human degradome with over 100 enzymes, and contains 80 active proteases that, like mesotrypsin, have tryptic-like specificity for cleavage after Lys or Arg, and thus represent alternative targets for APPI and its variants. These enzymes therefore may acts as modulators of in-vivo APPI concentrations (i.e., mesotrypsin competitors), and their inhibition by may potentially lead to unwanted off-target effects of engineered mesotrypsin inhibitors. To test the specificity of the APPI.sub.M17G/I18F/F34V triple mutant, cationic trypsin, anionic trypsin, Factor XIa (FXIa) and Kallikrein-6 (KLK6) were selected as targets that bind tightly to APPI.sub.WT and therefore serve as competitors for in-vivo mesotrypsin binding. Importantly, it was found that while APPI.sub.M17G/I18F/F34V shows greatly improved binding affinity toward mesotrypsin by comparison with APPI.sub.WT, affinity improvements toward KLK6, cationic and anionic trypsins are negligible, and affinity is substantially weakened toward APPI physiological target FXIa. Thus, the mutations present in APPI.sub.M17G/I18F/F34V (SEQ ID NO: 8) result in enhancement of specificity toward mesotrypsin over other proteases by three to five orders of magnitude (Table 3).
TABLE-US-00005 TABLE 3 The inhibitor specificity of APPI-M17G/ I18F/ F34V towards a range of human serine proteases K.sub.i for meso- K.sub.i for kallikrein-6 K.sub.i for cationic K.sub.i for anionic Inhibitor trypsin (M) (M) trypsin (M) trypsin (M) K.sub.i for FXIa (M) APPI-WT (SEQ ID NO: 25) (1.31 0.17) 10.sup.7 (2.23 0.18) 10.sup.9 (6.27 1.01) 10.sup.12 (1.74 0.05) 10.sup.12 (4.1 0.14) 10.sup.10 APPI-M17G/ I18F/ F34V (89.8 0.23) 10.sup.12 (1.09 0.12) 10.sup.9 (4.96 0.25) 10.sup.12 (1.47 0.02) 10.sup.12 (9.84 0.32) 10.sup.8 (SEQ ID NO: 8) K.sub.i (fold) 1459 2.04 1.3 1.18 4.16 10.sup.3
[0208] Example 5 indicates that APPI.sub.M17G/I18F/F34V is a suitable candidate for in-vivo applications targeting mesotrypsin.
Example 6
Triple Mutant Cycle Analysis of the Interactions Between Residues at Positions 17, 18 and 34 in APPI
[0209] For the APPI-mesotrypsin complex, it was found that each of the mutations impacted the strength of binding and the rate of hydrolysis to different degrees. The data generated in this study enabled us to assess the extent to which the effects of the mutations on the measured functional properties (K.sub.i and k.sub.cat) are independent (non-cooperative) or cooperative. The strength of the (direct or indirect) interactions between residues X and Y in a protein (P) can be determined by constructing a cycle that comprises the wild-type protein P.sub.XY, two single mutants, P.sub.X0 and P.sub.0Y, and the corresponding double mutant, P.sub.00 (0 indicates a mutation). A measure for the strength of interaction is the coupling energy, G.sub.int, which is given by:
where R is the gas constant, T is the absolute temperature and G(P.sub.XY), G(P.sub.0Y), G(P.sub.X0) and G(P.sub.00) correspond to the free energies of binding or catalysis. A coupling energy of zero (i.e. additivity of mutational effects) indicates that there is no interaction between X and Y with respect to the process (e.g. association) that is considered.
[0210] The free energy changes of catalysis (G.sub.cat) and association (G.sub.a) upon single point mutation (e.g. G of P.sub.XY and P.sub.X0) were calculated in a similar manner using Eq. 4:
[0211] Previous studies of free energy of coupling have suggested an energy values with errors (from zero) of X kcal/mol in order to assume additivity. Indeed, our free energy of coupling results for catalysis and association (ranging from 1.04 to 0.99 kcal/mol) suggest that each mutation is independent (
Example 7
APPI.SUB.M17G/I18F/F34V .Variant Reveals Enhanced Potency for Inhibition of Mesotrypsin-Dependent Cancer Cell Invasiveness
[0212] Previously, mesotrypsin was implicated as an enzyme responsible for mediating invasiveness and malignant morphology of prostate cancer cells. To evaluate the ability of the APPI.sub.M17G/I18F/F34V triple mutant (SEQ ID NO: 8) to inhibit these phenotypes, experiments were carried out using human PC3-M prostate cancer cells, a hormone-independent, highly aggressive and metastatic cell line (Kozlowski, J. M., et al., Cancer research, 1984. 44(8): p. 3522-9). In Matrigel transwell invasion assays, it was confirmed that mesotrypsin expression is essential for the invasiveness of these cells, since transduction with a lentiviral shRNA construct targeting the PRSS3 gene (encoding mesotrypsin) results in profound inhibition of invasiveness (
Example 8
Additional Effective APPI Variant
[0213] Using a Pichia pastoris expression system, additional soluble APPI variants bearing several mutations were produced. Mutations in APPI.sub.T11V/M17G/I18F/F34V and APPI.sub.M17G/I18F/K29L/F34V contributed to striking improvements in affinity and proteolytic resistance relative to WT-APPI (Table 4). The mutants APPI.sub.T11V/M17G/I18F/F34V and APPI.sub.M17C/I18F/F34C, showed around 2000-fold improvement in affinity and around 100-fold improvement in proteolytic stability relative to APPI-WT. The mutant APPI.sub.M17G/I18F/K29L/F34V, showed around 1000-fold improvement in affinity and around 60-fold improvement in proteolytic stability relative to APPI-WT. The mutant APPI.sub.T11C/M17G/I18F/F34C, showed similar affinity and around 2-fold improvement in proteolytic stability relative to APPI-WT.
TABLE-US-00006 TABLE 4 Affinity and proteolytic resistance of additional APPI variants turnover turnover Ki (pM) Ki SD (pM) Kcat (1/s) Kcat SD (1/s) time (s) time SD (s) APPI.sub.T11V/M17G/I18F/F34V 49.88 0.78 0.000347 1.69E05 2880.96 136.66 (SEQ ID NO: 9) APPI.sub.M17G/I18F/K29L/F34V 89.06 0.95 0.000535 1.68E05 1868.76 59.66 (SEQ ID NO: 10) APPI.sub.T11C/M17G/I18F/F34C 148800 10630 0.00521 0.00021 192.21 7.69 (SEQ ID NO: 11) APPI.sub.M17C/I18F/F34C 52.4 0.78 0.00038 2631 (SEQ ID NO: 12)
Example 9
APPI Variants as a .SUP.64.Cu-Radiolabeled Tumor-Targeted Imaging Agent
[0214] Derivatization and Radiolabeling of the Best APPI-Derived Mesotrypsin Inhibitor and Evaluation of In Vivo Stability, Pharmacokinetics, Tumor Uptake and Biodistribution Profile.
[0215] A cross-bridged DOTA (1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid) chelator is used to derivatize the best APPI variant as a chemical handle for subsequent .sup.64Cu-radiolabeling to enable in vivo pharmacokinetic and imaging studies. For site-specific conjugation without disruption of mesotrypsin binding affinity or biological activity, a mutant with substitution of the one native lysine residue is used. DOTA chelator-modified protein (20 g) is radiolabeled using .sup.64CuCl.sub.2 (100-500 MBq) after optimization of pH values, reaction temperatures and times. Radiolabeled protein is purified using a SPE (solid phase extraction) protocol followed by sterile filtration. The radiochemical and chemical purity of the purified product (295% required) is determined by analytical radio-HPLC.
[0216] Stability and Pharmacokinetics of the .sup.64Cu-Labeled APPI Protein.
[0217] The .sup.64Cu-labeled APPI variant is incubated in serum for 0.5, 1, 4, and 24 h at 37 C. Thereafter, the serum proteins may be precipitated using acetonitrile, and the solution is analyzed by radio-HPLC for the presence of intact peptide, fragments, or free .sup.64Cu. In addition, in vivo studies are carried out. For this purpose, 3 anesthetized male Nod/Scid mice for each radiotracer and time-point are injected into the lateral tail vein with 5-10 MBq of the .sup.64Cu-labeled ligands. The animals are sacrificed at 0.5, 1, 2, 4, and 8 h post injection. Blood, kidney and liver are removed, the relevant tissues will be homogenized, and the homogenates are extensively filtered using the Nanosep 10K Omega filter (Pall Corporation). The filtrates are analyzed by radio-HPLC for the presence of intact peptides, fragments, or free .sup.64Cu.
[0218] In Vivo Evaluation of the .sup.64Cu-Labeled Proteins.
[0219] Initial studies employ the orthotopic PC3-M model of human prostate cancer. Subsequent studies implement additional orthotopic models of pancreatic, breast and lung cancers.
[0220] PET Imaging.
[0221] Anesthetized mice bearing PC-3M tumors are injected (via the lateral tail vein) with 5-10 MBq of .sup.64Cu-labeled protein and imaged on a PET/CT system. Images are acquired after 0.5, 1, 2, 4, and 24 h (15 min for each scan). To test mesotrypsin binding specificity in vivo, a control group is co-injected with an excess of unlabeled APPI protein.
[0222] Biodistribution Studies.
[0223] Mice are euthanized following intravenous administration of the radiolabeled APPI variant at the optimal time-point determined above. Blood, heart, lung, liver, spleen, pancreas, stomach, intestine, skin, muscle, bone, brain, tail, and tumor tissue are removed, and the radioactivity in each organ is determined by -counting. Results are expressed as the % ID/g of tissue. For each mouse, the activity of tissue samples is calibrated against a known aliquot of the radiotracer and is normalized to the whole body weight and to the residual activity present in the tail.
[0224] Post-Imaging Tumor Analysis.
[0225] Tumors are excised after in vivo imaging and sectioned using a cryostat (Leica Microsystems, Bannockburn, Ill.). Tumor sections are analyzed with high resolution autoradiography using a PhosphorImager SI (Amersham Biosciences, Piscataway, N.J.). Adjacent tumor sections are analyzed by immunohistochemistry, using appropriate antibodies to visualize expression of mesotrypsin and the results of immunohistochemistry and autoradiography is correlated.
Example 10
Generation of APPI Variants that Serve as High Affinity hK6 Inhibitors
Generation of a Combinatorial APPI Based Library
[0226] A library of variants of APPI.sub.M17G,I18F,F34V (SEQ ID NO: 8) which exhibits great stability and resistance toward cleavage by human mesotrypsin, was generated. The library of variant of SEQ ID NO: 8 was screened to isolate high affinity hK6 inhibitors. The APPI.sub.M17G,I18F,F34V gene was constructed by using codons optimized for yeast expression and synthesized by PCR-assembly. The APPI library was constructed using PCR-based NNS randomization strategy and error-prone PCR, generating a library with 1-2 mutations per clone, including one loop mutation (positions T11-F18) that is essential for binding to hK6.
Flow Cytometry and Cell Sorting
[0227] Screening of the library was performed using a yeast surface display (YSD) system. Five different high affinity clones were identified.
TABLE-US-00007 APPI.sub.M17L,I18F,S19F,F34V EVCSEQAETGPCRALFFRWYFDVTEGKCAPFVYGGCGGNRNNF (SEQIDNO:13) DTEEYCMAVCGSAI APPI.sub.M17L,I18F,F34V EVCSEQAETGPCRALFSRWYFDVTEGKCAPFVYGGCGGNRNNF (SEQIDNO:14) DTEEYCMAVCGSAI APPI.sub.M17H,I18F,F34V EVCSEQAETGPCRAHFSRWYFDVTEGKCAPFVYGGCGGNRNNF (SEQIDNO:15) DTEEYCMAVCGSAI APPI.sub.M17S,I18F,F34V EVCSEQAETGPCRASFSRWYFDVTEGKCAPFVYGGCGGNRNNFD (SEQIDNO:16) TEEYCMAVCGSAI APPI.sub.M17F,I18F,F34V EVCSEQAETGPCRAFFSRWYFDVTEGKCAPFVYGGCGGNRNNFD (SEQIDNO:17) TEEYCMAVCGSAI
Production and Purification of APPI Proteins.
[0228] APPI WT (SEQ ID NO: 25), and polypeptides having the amino acid sequence of SEQ ID NO: 8, 13, and 14 were expressed in Pichia pastoris yeast strain together with an His tag at the C-terminal. All variants were purified using affinity chromatography (with nickel columns) and later using SEC (with superdex 75 column).
Evaluation of the Clones Using YSD
[0229] Clones were isolated and expressed in the YSD system and their ability to bind human Kallikrein-6 was evaluated. Two high affinity clones were identified and selected namely, polypeptides having an amino acid sequence as set forth in SEQ ID NO: 13 and SEQ ID NO: 14.
[0230] The ability of the APPI variant having SEQ ID NO: 13 to inhibit mesotrypsin activity was confirmed, and the resulting Ki value was 5.38 nM0.28 nM.
[0231] A titration curve was generated in order to estimate the K.sub.D differences between APPI WT (SEQ ID NO: 25), APPI.sub.M17G,I18F,F34V (SEQ ID NO: 8), APPI.sub.M17L,I18F,F34V (SEQ ID NO: 14) and APPI.sub.M17L,I18F,S19F,F34V (SEQ ID NO: 13). The resultant titration curve showed apparent K.sub.D of 17.2 nM for APPI WT (SEQ ID NO: 25), 14.0 nM for SEQ ID NO: 8, 14.6 for SEQ ID NO: 14, and 7.8 nM for SEQ ID NO: 13 (
[0232] Next, different concentrations of the polypeptides having SEQ ID Nos: 8, 13, and 14 were tested for their ability to bind 50 nM hK6 in the presence of a small molecule which target and home the serine residue in the active pocket of hK6.
[0233] Results demonstrate higher binding of peptides having SEQ ID Nos: 13 and 14 to hK6 compared with the protein of SEQ ID NO: 8 (
Evaluation of the Clones in their Soluble Form
[0234] APPI WT (SEQ ID NO: 25) and APPI.sub.M17G,I18F,F34V (SEQ ID NO: 8), were tested for their ability to inhibit hK6 catalytic activity. The inhibition constants (Ki) for APPI variants were calculated assuming slow tight inhibition mechanism.
[0235] Results demonstrated that polypeptides having SEQ ID NO: 25 (APPI.sup.WT) and SEQ ID NO: 8 (APPI.sup.3M) inhibited the catalytic activity of hK6 in low nano-molar range with K.sub.i values of 2.24 nM and Ki=1.1 nM, respectively, assuming slow tight inhibition mechanism (
[0236] Further, APPI WT (SEQ ID NO: 25) and the variant having the amino acid sequence of SEQ ID NO: 13 were also evaluated for their ability to bind hK6 on a Surface Plasmon Resonance system. To this end, APPIs were mounted on a surface Plasmon resonance (SPR) nickel chip by their His tag, and hK6 molecules served as the analyte. SPR results showed 22.5 folds improvement in binding to hK6 for the polypeptide of SEQ ID NO: 13 (K.sub.D=351 M) compared to APPI WT (K.sub.D=7.91 nM) (
Example 11
Effect of APPI Variant on Proliferation and Invasion of Cancer Cells
[0237] The effect of an APPI variant (SEQ ID NO: 13) on proliferation of gastric cancer cells was evaluated by XTT assay. AGS, HCT-116 and SW-480 cells were plated into 96-well plates in 9600 cells/well in duplicate, and allowed to adhere for 4 hours. Each well was supplemented with 100 nM, 1 M, or 10 M APPI.sub.M17L,I18F,S19F,F34V (SEQ ID NO: 13) or a vehicle (50 mM Tris-HCl, 100 mM NaCl, Ph 7.3), and cells were incubated for 48 hours. Proliferation was measured by XTT following the manufacturer instructions (Biological Industries, Ill.).
[0238] As shown in
[0239] The effects of APPI.sub.M17L,I18F,S19F,F34V (SEQ ID NO: 13) on the invasive behavior of AGS gastric cancer cells was examined. For invasion assays AGS cells were plated in the top chamber of a Matrigel coated ThinCerts (Greiner Bio-One, Germany), with an 8 m pored membrane in 160 l serum-free Ham's F-12 medium, in triplicate. 1 uM-10 uM of APPI (SEQ ID NO: 13) or a vehicle (50 mM Tris-HCl, 100 mM NaCl, Ph 7.3) in 40 l were added to each insert. Next, the inserts were placed into the bottom chamber wells of a 24-well plate containing Ham's F-12 with 10% FBS as a chemo-attractant. After 48 hours of incubation, cells remaining on the inserts' top layers were removed by cotton swab scrubbing; Cells on the lower surface of the membrane were fixed in 100%/methanol and stained with Romanowski stain solutions. The cell numbers in 10 random fields (20) were counted for each chamber and the average value was calculated.
[0240] As shown in
[0241] While the present invention has been particularly described, persons skilled in the art will appreciate that many variations and modifications can be made. Therefore, the invention is not to be construed as restricted to the particularly described embodiments, and the scope and concept of the invention will be more readily understood by reference to the claims, which follow.