ANTI-CD276 MAB TO TARGET BREAST CANCER
20240279337 ยท 2024-08-22
Inventors
Cpc classification
C07K16/2863
CHEMISTRY; METALLURGY
A61K47/6881
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
International classification
C07K16/28
CHEMISTRY; METALLURGY
A61K47/68
HUMAN NECESSITIES
Abstract
Disclosed herein is anti-human CD276 mAb expressing the Fc-fused fragments from the extracellular domain of human CD276 (Leu29-Pro245), producing the N-glycosylated peptides as immunogen, and generating hybridoma cells through fusing mouse splenocytes and myeloma cells. The specific targeting of cancer cells and intracellular release of potent drugs enables high anti-cancer efficiency and minimal side effects.
Claims
1. An anti-human CD276 antibody that selectively binds the extracellular domain of CD276 (Leu29-Pro245), comprising a variable heavy (V.sub.H) domain having CDR1, CDR2 and CDR3 sequences and a variable light (V.sub.L) domain having CDR1, CDR2 and CDR3 sequences, wherein the CDR1 sequence of the V.sub.H domain comprises the amino acid sequence GYTFTEYT (SEQ ID NO:1); the CDR2 sequence of the V.sub.H domain comprises the amino acid sequence NNPNTGGT (SEQ ID NO:2); the CDR3 sequence of the V.sub.H domain comprises the amino acid sequence SRSGNDVGWYFAV (SEQ ID NO:3); the CDR1 sequence of the V.sub.L comprises the amino acid sequence SSVSY (SEQ ID NO:4); the CDR2 sequence of the V.sub.L domain comprises the amino acid sequence DTS; and the CDR3 sequence of the V.sub.L domain comprises the amino acid sequence QQWSSNPLT (SEQ ID NO:5).
2. The antibody of claim 1, wherein the V.sub.H domain comprises the amino acid sequence SEQ ID NO:6.
3. The antibody of claim 1, wherein the V.sub.L domain comprises the amino acid sequence SEQ ID NO:7.
4. The antibody of claim 1, wherein the antibody is a monoclonal antibody.
5. The antibody of claim 1, wherein the antibody is a recombinant antibody.
6. The antibody of claim 5, wherein the recombinant antibody is a single chain antibody (scFv).
7. The antibody of claim 6, wherein the V.sub.H domain comprises the amino acid sequence SEQ ID NO:9 and wherein the V.sub.L domain comprises the amino acid sequence SEQ ID NO:10.
8. An antibody drug conjugate (ADC) comprising a chemotherapeutic agent conjugated to the antibody of claim 1.
9. The ADC of claim 8, wherein the chemotherapeutic agent comprises cetuximab.
10. A method of treating breast cancer in a subject, comprising administering an effective amount of the ADC of claim 8, in a pharmaceutically acceptable carrier.
11. The method of claim 10, further comprising administering to the subject an ADC comprising a chemotherapeutic agent conjugated to an anti-EGFR antibody.
12. The method of claim 11, wherein the breast cancer is triple-negative breast cancer.
Description
BRIEF DESCRIPTION OF FIGURES
[0007]
[0008]
[0009]
[0010]
[0011]
[0012]
[0013]
[0014]
DETAILED DESCRIPTION
[0015] Before the present disclosure is described in greater detail, it is to be understood that this disclosure is not limited to particular embodiments described, and as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present disclosure will be limited only by the appended claims.
[0016] Where a range of values is provided, it is understood that each intervening value, to the tenth of the unit of the lower limit unless the context clearly dictates otherwise, between the upper and lower limit of that range and any other stated or intervening value in that stated range, is encompassed within the disclosure. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges and are also encompassed within the disclosure, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the disclosure.
[0017] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present disclosure, the preferred methods and materials are now described.
[0018] All publications and patents cited in this specification are herein incorporated by reference as if each individual publication or patent were specifically and individually indicated to be incorporated by reference and are incorporated herein by reference to disclose and describe the methods and/or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present disclosure is not entitled to antedate such publication by virtue of prior disclosure. Further, the dates of publication provided could be different from the actual publication dates that may need to be independently confirmed.
[0019] As will be apparent to those of skill in the art upon reading this disclosure, each of the individual embodiments described and illustrated herein has discrete components and features which may be readily separated from or combined with the features of any of the other several embodiments without departing from the scope or spirit of the present disclosure. Any recited method can be carried out in the order of events recited or in any other order that is logically possible.
[0020] Embodiments of the present disclosure will employ, unless otherwise indicated, techniques of chemistry, biology, and the like, which are within the skill of the art.
[0021] The following examples are put forth so as to provide those of ordinary skill in the art with a complete disclosure and description of how to perform the methods and use the probes disclosed and claimed herein. Efforts have been made to ensure accuracy with respect to numbers (e.g., amounts, temperature, etc.), but some errors and deviations should be accounted for. Unless indicated otherwise, parts are parts by weight, temperature is in ? C., and pressure is at or near atmospheric. Standard temperature and pressure are defined as 20? C. and 1 atmosphere.
[0022] Before the embodiments of the present disclosure are described in detail, it is to be understood that, unless otherwise indicated, the present disclosure is not limited to particular materials, reagents, reaction materials, manufacturing processes, or the like, as such can vary. It is also to be understood that the terminology used herein is for purposes of describing particular embodiments only, and is not intended to be limiting. It is also possible in the present disclosure that steps can be executed in different sequence where this is logically possible.
[0023] It must be noted that, as used in the specification and the appended claims, the singular forms a, an, and the include plural referents unless the context clearly dictates otherwise.
[0024] Triple-negative breast cancers (TNBCs) accounting for 15-20% of breast cancers are highly aggressive, metastatic in lung, bone and brain, and heterogenous. Standard cytotoxic chemotherapies (e.g. anthracycline-taxane) (Liedtke, C. et al. J Clin Oncol 26:1275-1281 (2008); Silver, D. P. et al. J Clin Oncol 28:1145-1153 (2010); Nedeljkovic, M. & Damjanovic, A. Cells 8 (2019); Wein, L. & Loi, S. Breast 34 Suppl 1:S27-S30 (2017)) are the main treatment strategy for TNBCs. The drug resistance, high recurrence rate (>50%) post primary treatment (Silver, D. P. et al. J Clin Oncol 28:1145-1153 (2010); Nedeljkovic, M. & Damjanovic, A. Cells 8 (2019); Wein, L. & Loi, S. Breast 34 Suppl 1:S27-S30 (2017); Martinelli, E., et al. Clin Exp Immunol 158:1-9 (2009)) and adverse effects minimize the clinical benefits of these drugs (Al-Mahmood, S., et al. Drug Deliv Transl Res 8:1483-1507 (2018); Lebert, J. M., et al. Curr Oncol 25:S142-S150 (2018)). Monoclonal antibodies (mAbs) that target epidermal growth factor receptor (EGFR) (Martinelli, E., et al. Clin Exp Immunol 158:1-9 (2009); Flynn, J. F., et al. J Oncol 2009:526963 (2009)) and folate receptor (Cheung, A. et al. Clin Cancer Res 24:5098-5111 (2018); Frontera, E. D. et al. Breast Cancer Res Treat 172:551-560 (2018)) showed limited efficacy as a single agent in clinical trials. FDA approved an immunotherapy-chemotherapy, Atezolizumab and Abraxane, to treat PD-L1.sup.+ TNBC (Romero, D. Nat Rev Clin Oncol 16:6 (2019); Marra, A., et al. BMC Med 17:90 (2019); Zhu, X. et al. Cancer Biol Ther 20:1105-1112 (2019)), indicating the great potential of combined therapies. Antibody-drug conjugates (ADCs) have been developed to treat various cancers (de Claro, R. A. et al. Clin Cancer Res 18:5845-5849 (2012); Doi, T. et al. Lancet Oncol 18:1512-1522 (2017)), which combine the advantages of mAbs, such as cancer-targeting, antibody-dependent cell-mediated cytotoxicity (ADCC) and other immune responses, and highly potent payload (Zhou, L., et al. Cancer Lett 352:145-151 (2014); Almasbak, H., et al. J Immunol Res 2016:5474602 (2016); Dai, H., et al. J Natl Cancer Inst 108 (2016); Magee, M. S. & Snook, A. E. Discov Med 18:265-271 (2014); Zhang, B. L. et al. Sci China Life Sci 59:340-348 (2016); Kunert, R. & Reinhart, D. Appl Microbiol Biotechnol 100:3451-3461 (2016); Polakis, P. Pharmacol Rev 68:3-19 (2016)). Despite the promising clinical efficiency of ADC, no targeted ADC is available to eliminate TNBC.
[0025] Disclosed herein is an isolated anti-human CD276 monoclonal antibody that selectively binds the extracellular domain of CD276 (Leu29-Pro245). Therefore, recombinant antibodies and other proteins comprising the antigen binding regions from these antibodies are also disclosed. Also disclosed are recombinant, humanized, and/or chimeric antibodies comprising at least the antigen binding regions of one or more of these antibodies.
[0026] In some embodiments, the anti-CD276 antibody can comprise a variable heavy (V.sub.H) domain having CDR1, CDR2 and CDR3 sequences and a variable light (V.sub.L) domain having CDR1, CDR2 and CDR3 sequences.
[0027] For example, in some embodiments, the CDR1 sequence of the V.sub.H domain comprises the amino acid sequence GYTFTEYT (SEQ ID NO:1), CDR2 sequence of the V.sub.H domain comprises the amino acid sequence NNPNTGGT (SEQ ID NO:2), CDR3 sequence of the V.sub.H domain comprises the amino acid sequence SRSGNDVGWYFAV (SEQ ID NO:3), CDR1 sequence of the V.sub.L comprises the amino acid sequence SSVSY (SEQ ID NO:4), CDR2 sequence of the V.sub.L domain comprises the amino acid sequence DTS, and CDR3 sequence of the V.sub.L domain comprises the amino acid sequence QQWSSNPLT (SEQ ID NO:5).
[0028] Therefore, in some embodiments, the V.sub.H domain comprises the amino acid sequence
TABLE-US-00001 (SEQIDNO:6) EVQLQQSGPELVKPGASVKISCKTSGYTFTEYTMHWVKQSHGKSLEWIGS NNPNTGGTTYNQKFKDKATLTVDKSSNTAYMELRSLTSDDSAVYYCSRSG NDVGWYFAVWGAGTTVTVSS.
[0029] Therefore, in some embodiments, the V.sub.L domain comprises the amino acid sequence
TABLE-US-00002 (SEQIDNO:7) QIVLTQSPAIMSASPGEKVTMTCTATSSVSYMHWYQQKSDSSPKRWIYDT SKLASGVPDRFSGSGSGTSYSLIISSMEAEDAATYYCQQWSSNPLTFGAG TKLELKR.
[0030] Antibodies that can be used in the disclosed compositions and methods include whole immunoglobulin (i.e., an intact antibody) of any class, fragments thereof, and synthetic proteins containing at least the antigen binding variable domain of an antibody. The variable domains differ in sequence among antibodies and are used in the binding and specificity of each particular antibody for its particular antigen. However, the variability is not usually evenly distributed through the variable domains of antibodies. It is typically concentrated in three segments called complementarity determining regions (CDRs) or hypervariable regions both in the light chain and the heavy chain variable domains. The more highly conserved portions of the variable domains are called the framework (FR). The variable domains of native heavy and light chains each comprise four FR regions, largely adopting a beta-sheet configuration, connected by three CDRs, which form loops connecting, and in some cases forming part of, the beta-sheet structure. The CDRs in each chain are held together in close proximity by the FR regions and, with the CDRs from the other chain, contribute to the formation of the antigen binding site of antibodies.
[0031] Transgenic animals (e.g., mice) that are capable, upon immunization, of producing a full repertoire of human antibodies in the absence of endogenous immunoglobulin production can be employed. For example, it has been described that the homozygous deletion of the antibody heavy chain joining region (J(H)) gene in chimeric and germ-line mutant mice results in complete inhibition of endogenous antibody production. Transfer of the human germ-line immunoglobulin gene array in such germ-line mutant mice will result in the production of human antibodies upon antigen challenge (see, e.g., Jakobovits et al., Proc. Natl. Acad. Sci. USA, 90:2551-255 (1993); Jakobovits et al., Nature, 362:255-258 (1993); Bruggemann et al., Year in Immuno., 7:33 (1993)). Human antibodies can also be produced in phage display libraries (Hoogenboom et al., J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991)). The techniques of Cote et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al., J. Immunol., 147(1):86-95 (1991)).
[0032] Optionally, the antibodies are generated in other species and humanized for administration in humans. Humanized forms of non-human (e.g., murine) antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab, F(ab)2, or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues from a complementarity determining region (CDR) of the recipient antibody are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992))
[0033] Methods for humanizing non-human antibodies are well known in the art. Generally, a humanized antibody has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain. Antibody humanization techniques generally involve the use of recombinant DNA technology to manipulate the DNA sequence encoding one or more polypeptide chains of an antibody molecule. Humanization can be essentially performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, a humanized form of a non human antibody (or a fragment thereof) is a chimeric antibody or fragment (U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
[0034] Also disclosed are fragments of antibodies which have bioactivity. The fragments, whether attached to other sequences or not, include insertions, deletions, substitutions, or other selected modifications of particular regions or specific amino acids residues, provided the activity of the fragment is not significantly altered or impaired compared to the non-modified antibody or antibody fragment.
[0035] Techniques can also be adapted for the production of single-chain antibodies specific to an antigenic protein of the present disclosure. Methods for the production of single-chain antibodies are well known to those of skill in the art. A single chain antibody can be created by fusing together the variable domains of the heavy and light chains using a short peptide linker, thereby reconstituting an antigen binding site on a single molecule. Single-chain antibody variable fragments (scFvs) in which the C-terminus of one variable domain is tethered to the N-terminus of the other variable domain via a 15 to 25 amino acid peptide or linker have been developed without significantly disrupting antigen binding or specificity of the binding. The linker is chosen to permit the heavy chain and light chain to bind together in their proper conformational orientation.
[0036] Divalent single-chain variable fragments (di-scFvs) can be engineered by linking two scFvs. This can be done by producing a single peptide chain with two V.sub.H and two V.sub.L regions, yielding tandem scFvs. ScFvs can also be designed with linker peptides that are too short for the two variable regions to fold together (about five amino acids), forcing scFvs to dimerize. This type is known as diabodies. Diabodies have been shown to have dissociation constants up to 40-fold lower than corresponding scFvs, meaning that they have a much higher affinity to their target. Still shorter linkers (one or two amino acids) lead to the formation of trimers (triabodies or tribodies). Tetrabodies have also been produced. They exhibit an even higher affinity to their targets than diabodies.
[0037] Bivalent and bispecific antibodies can be constructed using only antibody variable domains. A fairly efficient and relatively simple method is to make the linker sequence between the V.sub.H and V.sub.L domains so short that they cannot fold over and bind one another. Reduction of the linker length to 3-12 residues prevents the monomeric configuration of the scFv molecule and favors intermolecular VH-VL pairings with formation of a 60 kDa non-covalent scFv dimer diabody. The diabody format can also be used for generation of recombinant bis-pecific antibodies, which are obtained by the noncovalent association of two single-chain fusion products, consisting of the VH domain from one antibody connected by a short linker to the VL domain of another antibody. Reducing the linker length still further below three residues can result in the formation of trimers (triabody, about 90 kDa) or tetramers (tetrabody, about 120 kDa). For a review of engineered antibodies, particularly single domain fragments, see Holliger and Hudson, 2005, Nature Biotechnology, 23:1126-1136. All of such engineered antibodies may be used in the fusion polypeptides provided herein. Tetravalent Tandab? may be prepared substantially as described in WO 1999057150 A3 or US20060233787, which are incorporated by reference for the teaching of methods of making Tandab? molecules.
[0038] The antigen recognition sites or entire variable regions of the engineered antibodies may be derived from one or more parental antibodies directed against any antigen of interest (e.g., CD276). The parental antibodies can include naturally occurring antibodies or antibody fragments, antibodies or antibody fragments adapted from naturally occurring antibodies, antibodies constructed de novo using sequences of antibodies or antibody fragments known to be specific for an antigen of interest. Sequences that may be derived from parental antibodies include heavy and/or light chain variable regions and/or CDRs, framework regions or other portions thereof.
[0039] Multivalent, multispecific antibodies may contain a heavy chain comprising two or more variable regions and/or a light chain comprising one or more variable regions wherein at least two of the variable regions recognize different epitopes on the same antigen.
[0040] Candidate engineered antibodies for inclusion in the fusion polypeptides, or the fusion polypeptides themselves, may be screened for activity using a variety of known assays. For example, screening assays to determine binding specificity are well known and routinely practiced in the art. For a comprehensive discussion of such assays, see Harlow et al. (Eds.), ANTIBODIES: A LABORATORY MANUAL; Cold Spring Harbor Laboratory; Cold Spring Harbor, N.Y., 1988, Chapter 6.
[0041] In some embodiments, the anti-CD276 binding agent is single chain variable fragment (scFv) antibody. The affinity/specificity of an anti-CD276 scFv is driven in large part by specific sequences within complementarity determining regions (CDRs) in the heavy (V.sub.H) and light (V.sub.L) chain. Each V.sub.H and V.sub.L sequence will have three CDRs (CDR1, CDR2, CDR3). The heavy and light chains are preferably separated by a linker. Suitable linkers for scFv antibodies are known in the art. In some embodiments, the linker comprises the amino acid sequence GGGGSGGGGSGGGGS (SEQ ID NO:8).
[0042] In some embodiments, the anti-CD276 antibody is a recombinant full-length antibody. For example, in some embodiments, the heavy chain full length sequence is: MGWSWIFLFLLSGTAGVLSEVQLQQSGPELVKPGASVKISCKTSGYTFTEYTMHWVKQSHGK SLEWIGSNNPNTGGTTYNQKFKDKATLTVDKSSNTAYMELRSLTSDDSAVYYCSRSGNDVGW YFAVWGAGTTVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSS GVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPTIKPCPPCKC PAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHRE DYNSTIRVVSTLPIQHQDWMSGKEFKCKVNNKDLPSPIERTISKIKGLVRAPQVYILPPPAEQLS RKDVSLTCLVVGFNPGDISVEWTSNGHTEENYKDTAPVLDSDGSYFIYSKLNMKTSKWEKTDS FSCNVRHEGLKNYYLKKTISRTPGK (SEQ ID NO:9). For example, in some embodiments, the light chain full length sequence is:
TABLE-US-00003 (SEQIDNO:10) MDYQVQIFSFLLISASVIISRGQIVLTQSPAIMSASPGEKVTMTCTATSS VSYMHWYQQKSDSSPKRWIYDTSKLASGVPDRFSGSGSGTSYSLIISSME AEDAATYYCQQWSSNPLTFGAGTKLELKRADAAPTVSIFPPSSEQLTSGG ASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTL TLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC.
EXAMPLES
Example 1: CD276-Targeted Antibody-Drug Conjugate to Treat Triple-Negative Breast Cancer
INTRODUCTION
[0043] Recently, the cell surface expression of glycoprotein CD276 (B7-H3), which is comprised of two Ig-like V-type and two Ig-like C2-type extracellular domains and seven N-linked glycosylation sites (Chen R, et al. J Proteome Res. 2009 8(2):651-61), was detected in more than 80% of breast cancer tissues (Sun J, et al. Onco Targets Ther. 2014 7:1979-86; Bachawal S V, et al. Cancer Res. 2015 75(12):2501-9; Liu C, et al. Mol Med Rep. 2013 7(1):134-8). This study demonstrated high expression of CD276 in multiple TNBC cell lines and majority of primary TNBC samples. The CD276 is also associated with angiogenesis, invasion, metastasis and poor prognosis in cancer patients (Sun J, et al. Onco Targets Ther. 2014 7:1979-86; Ye Z, et al. Cell Physiol Biochem. 2016 39(4):1568-80; Castellanos J R, et al. Am J Clin Exp Immunol. 2017 6(4):66-75; Kraan J, et al. Br J Cancer. 2014 111(1):149-56; Picarda E, et al. Clin Cancer Res. 2016 22(14):3425-31). Importantly, literature (Bachawal S V, et al. Cancer Res. 2015 75(12):2501-9; Seaman S, et al. Cancer Cell. 2017 31(4):501-15 e8) showed that CD276 is nearly undetectable or low in important normal organs (brain, heart, lung, liver, pancreas, kidney, and others) and normal breast tissue, making it an appealing target for cancer treatment. Of note, CD276 expression is limited at steady state in normal fibroblasts and endothelial cells (ECs) but is highly detectable in tumor-associated ECs (Picarda E, et al. Clin Cancer Res. 2016 22(14):3425-31; Seaman S, et al. Cancer Cell. 2017 31(4):501-15 e8; Seaman S, et al. Cancer Cell. 2007 11(6):539-54). CD276 is also involved in the inhibition of natural killer (NK) and T cells (Pardoll D M. Nat Rev Cancer. 2012 12(4):252-64; Vigdorovich V, et al. Structure. 2013 21(5):707-17; Chen C, et al. Exp Cell Res. 2013 319(1):96-102) and the production of effector cytokine (e.g., IFN-?, TNF-?) (Suh W K, et al. Nat Immunol. 2003 4(9):899-906; Prasad D V, et al. J Immunol. 2004 173(4):2500-6). It is found that the blockade of CD276 in antigen-presenting cells (APC) could neutralize the inhibitory signaling in NK/T immune cells and enable the effector immune function (Picarda E, et al. Clin Cancer Res. 2016 22(14):3425-31; Maeda N, et al. Ann Surg Oncol. 2014 21 Suppl 4:S546-54). The anti-CD276 enoblituzumab (Picarda E, et al. Clin Cancer Res. 2016 22(14):3425-31) and bispecific antibody targeting CD276/CD3 (MGD009) (Weidle U H, et al. Semin Oncol. 2014 41(5):653-60) are being developed and evaluated to treat melanoma, colorectal, prostate and lung cancers in Phase I clinical trial (Picarda E, et al. Clin Cancer Res. 2016 22(14):3425-31). All these previous studies indicated that CD276 is a promising and safe target for TNBC patients.
[0044] The US FDA has approved a combined Atezolizumab (immune checkpoint inhibitor) and Abraxane (nab-paclitaxel) to treat PD-L1.sup.+ TNBC (Romero D. Nat Rev Clin Oncol. 2019 16(1):6; Marra A, et al. BMC Med. 2019 17(1):90; Zhu X, et al. Cancer Biol Ther. 2019 20(8):1105-12) and an antibody-drug conjugate (ADC), i.e. Sacituzumab Govitecan, to treat trophoblast cell-surface antigen 2 (Trop-2).sup.+ TNBC (Bardia A, et al. N Engl J Med. 2021 384(16):1529-41; Bardia A, et al. N Engl J Med. 2019 380(8):741-51; McGuinness J E, et al. Expert Opin Biol Ther. 2020:1-11; Seligson J M, et al. Ann Pharmacother. 2021 55(7):921-31; Wahby S, et al. Clin Cancer Res. 2021 27(7):1850-4). These achievements demonstrated the great potential of targeted therapies and the combination of cancer-targeting antibody with highly potent chemotherapy to treat TNBC pateints. Therefore, this study developed and evaluated a new mAb that targets the glycosylated extracellular domain of CD276 surface receptor and a CD276-targeting ADC.
[0045] The objective of this study was to evaluate CD276 as a surface receptor of TNBC, develop a new mAb that targets the glycosylated extracellular domain, construct ADC, and evaluate the anti-cancer cytotoxicity in three TNBC cell lines and the anti-tumor efficacy using both cell line-derived xenograft models and PDX models.
Materials and Methods
Cell Lines and Culture Media
[0046] The human TNBC cell lines, including MDA-MB-231 (ATCC, Manassas, VA, USA), MDA-MB-468 (ATCC), MDA-MB-231-FLuc (GenTarget, San Diego, CA, USA), and MDA-MB-468-FLuc (GeneCopoeia, Rockville, MD, USA), were maintained in DMEM medium supplemented with 10% fetal bovine serum (FBS, v/v) and 1% Pen/Strep (v/v). The mouse TNBC cell lines 4T1 and 4T1-FLuc (ATCC) were cultivated in RPMI-1640 medium supplemented with 10% FBS and 1% P/S. The anti-CD276 mAb hybridoma cells were cultivated in DMEM with the addition of 4.5 g/L glucose, 6 mM L-glutamine, 1 mM sodium pyruvate, 10% FBS and 1% P/S. All cell lines were incubated at 37? C. and 5% CO.sub.2 in a humidified incubator (Caron, Marietta, OH, USA). All media, supplements and bioreagents used in this study were purchased from Fisher Scientific (Waltham, MA, USA) unless otherwise specified.
[0047] The TNBC (ER.sup.?/PR.sup.?/HER2.sup.?) patient tissue microarray (TMA) was purchased from US Biomax (Derwood, MD, USA) to detect CD276 expression with immunohistochemistry (IHC) staining (Si Y, et al. Cancer Gene Therapy. Cancer Gene Therapy. 2020; Si Y, et al. Vaccines (Basel) 2021 Aug. 10; 9(8):882; Guenter R, et al. Surgery. 2021 170(1):351; Guenter R, et al. Surgery. 2020 167(1):189-96). First, the TMA slide was baked overnight at 60? C., de-paraffinized with xylene, and hydrated in ethanol and deionized water. Then the sectioned tissues were subjected to antigen retrieval in 0.01 M sodium citrate buffer (pH 6) for 5 mins, washed gently in deionized water, and transferred to solution comprised of 0.05 M Tris, 0.15 M NaCl and 0.1% Triton-X-100 (TBST, pH 7.6). The endogenous peroxidase was blocked with 3% H.sub.2O.sub.2 for 15 mins and slides were incubated with 5% normal goat serum for 45 mins to reduce nonspecific background staining. All slides were incubated at 4? C. overnight with anti-CD276 antibody (Abcam, Rabbit monoclonal, 1/500 dilution). After washing with TBST, slide was incubated with goat anti-rabbit secondary antibody conjugated with HRP (Abcam ab6721, 1:1000). Finally, the stained TMA slide was scanned with Lionheart FX Automated Microscope (BioTek, Winooski, VT, USA) and images were processed with Gen5 software. Following previously established method (Si Y, et al. Cancer Gene Ther. 2020), ImageJ was used to score the CD276 expression in the stained TMA. Briefly, the expression score of CD276 was calculated as (red.sub.intensity?blue.sub.intensity)/blue.sub.intensity?100 with definition of high expression with score of >10, medium expression with score of 6-10, low expression with score of 3-6, and no or minimal expression with score of 0-3.
Anti-CD276 (87-H3) mAb Development and Production
[0048] The N-glycosylated peptide cloned from the extracellular domain (Leu29-Pro245) of human CD276 was used to stimulate immune response in BALB/cJ mice (The Jackson Laboratory, Bar Harbor, ME, USA). As described previously (Si Y, et al. Cancer Gene Therapy. Cancer Gene Therapy. 2020; Si Y, et al. Vaccines (Basel) 2021 Aug. 10; 9(8):882), blood samples were collected from tail vein to titrate serum concentration of CD276 mAb using ELISA at 14-21 days post-immunization. Once mAb was detected, splenocytes were harvested and fused with myeloma cells Sp2/0-Ag14 (ATCC) to generate hybridoma, followed with limiting dilution with seeding density of 1?4 cells/well in 96-well plates. The top hybridoma clone was identified based on the anti-CD276 mAb titer and used to produce mAb in this study. The adherent hybridoma cells were adapted to suspension culture in serum-free medium and fed-batch culture was performed in shaker flask and/or spinner flask for mAb production which was fed with 3.5 g/L of Cell Boost, 2-4 g/L of glucose and 2-4 mM of L-glutamine (Yang S, et al. Journal of Biopharmaceuticals Bioprocessing. 2013 1(2):133-6; Xu N, et al. Biochem Eng J. 2017 124:122-9). Liquid chromatography system (Bio-Rad, Hercules, CA, USA), which is equipped with Bio-Scale Mini UNOsphere SUPrA affinity chromatography cartridges (Protein A column, Bio-Rad), was utilized for mAb purification following an established procedure (Si Y, et al. Cancer Gene Therapy. Cancer Gene Therapy. 2020; Si Y, et al. Vaccines (Basel) 2021 Aug. 10; 9(8):882; Xu N, et al. Biochem Eng J. 2017 124:122-9; Ou J, et al. PLOS ONE. 2018; Xu N, et al. Biochemical Engineering Journal. 2018; Chen K, et al. Pharmaceuticals (Basel). 2021 14(5); Xu N, et al. Frontiers of Chemical Science & Engineering. 2017 9(3):376-80). The mobile phase A of 0.02 M sodium phosphate and 0.02 M sodium citrate (pH 7.5) and phase B (elution buffer) of 0.1 M sodium chloride and 0.02 M sodium citrate (pH 3.0) were used.
Anti-CD276 mAb-DM1 Conjugation and Characterization
[0049] The ADC was constructed following a previously reported platform with process optimization. Specifically, the purified anti-CD276 mAb was buffer exchanged to phosphate buffered saline (PBS) and concentrated to 2.5 mg/mL using 10 kDa MWCO PES concentrators. The 2.5 mg/mL of mAb, 10 mg/mL of Sulfo-SMCC linker, and 10 mM of Mertansine (DM1) were mixed with a molar ratio of 1:14:18.2 in PBS with a final reaction volume of 400 ?L. The conjugation was performed at 37? C. for 2 hrs, and the synthesized ADC was purified using Protein A column with liquid chromatography system. The ADC purity and drug-antibody ratio (DAR) were tested using HPLC (Shimadzu, Columbia, MD, USA) equipped with a MAbPac hydrophobicity interaction chromatography (HIC)-butyl column (5 ?m, 4.6?100 mm). The mobile phase A of 2 M ammonium sulfate and 100 mM sodium phosphate at pH 7.0 and mobile phase B of 100 mM sodium phosphate at pH 7.0 were used in HPLC analysis.
Flow Cytometry Analysis
[0050] The surface binding rates of the anti-CD276 mAb in TNBC cell lines, including MDA-MB-231, MDA-MB-468 and 4T1, were tested by flow cytometry analysis following reported protocols (Si Y, et al. Cancer Gene Therapy. Cancer Gene Therapy. 2020; Si Y, et al. Vaccines (Basel) 2021 Aug. 10; 9(8):882; Ou J, et al. PLOS ONE. 2018; Chen K, et al. Pharmaceuticals (Basel). 2021 14(5); Si Y, et al. Pharmaceutics. 2020 12(11):1079-90; Si Y, et al. Biotechnol J. 2019:e1900163; Si Y, et al. Eng Life Sci. 2021 21(1-2):37-44; Si Y, et al. Cancers (Basel). 2021 13(15); Ou J, et al. J Biol Eng. 2019 13:34). The anti-CD276 mAb was labeled with fluorescent Alexa Fluor? 647 labelling kit (Life Technologies, part of Fisher). One million TNBC cells were stained with 5 ?g of anti-CD276 mAb-AF647 at 37? C. for 30 mins. After washing three times with PBS, the stained cells were analyzed using BD LSRII flow cytometer (BD Biosciences, San Jose, CA, USA) with Flow-Jo software for data processing.
Live-Cell Confocal Microscopy
[0051] The surface binding and internalization of CD276 mAb was evaluated with live-cell confocal imaging following published protocols (Si Y, et al. Cancer Gene Therapy. Cancer Gene Therapy. 2020; Si Y, et al. Vaccines (Basel) 2021 Aug. 10; 9(8):882; Ou J, et al. PLOS ONE. 2018; Si Y, et al. Eng Life Sci. 2021 21(1-2):37-44; Ou J, et al. J Biol Eng. 2019 13:34). Briefly, the human MDA-MB-468 cells and mouse TNBC 4T1 cells were seeded in glass bottom ?-slide with a density of 5?10.sup.4 cells/mL in 100 ?L medium per well. BacMam GFP Transduction Control and NucBlue Live ReadyProbes were used to stain cytoplasm and nucleus, respectively. Then the AF647-mAb was added to cells with final concentration of 1 ?g of mAb/well. The live-cell images were captured at 2 hrs and 24 hrs after adding mAb using a Nikon A1R-HD25 confocal microscope with a high-speed resonance scanner (Nikon USA, Melville, NY, USA).
In Vitro Cytotoxicity Assay
[0052] The human and mouse TNBC cells were seeded in 96-well plates with density of 1?10.sup.5 cells/mL for MDA-MB-468 and MDA-MB-231 and 5?10.sup.4 cells/mL for 4T1. The anti-CD276 mAb-DM1 ADC was added into each well to reach the final dosages of 0, 2, 4, 10, 20, 50, 100, 200 nM. The treated cells were incubated at 37? C. and 5% CO.sub.2 for three days and the cell viability was analyzed using MTT Cell Proliferation Assay kit (31, 42). The absorbance of each well, including the blank (medium), was measured at 570 nm in a microplate plate reader (BioTek, Winooski, VT, USA). The relative cell viability was calculated as: (absorbance of treated cellsabsorbance of blank medium)/(absorbance of untreated cellsabsorbance of blank medium)?100%.
In Vivo Imaging System (IVIS)
[0053] Both human TNBC MDA-MB-468-FLuc xenograft NSG (NOD scid gamma, Jackson Lab) mice and mouse TNBC 4T1-FLuc xenograft BALB/cJ mice were subcutaneously (s.c.) injected with 5?10.sup.6 cells each mouse to generate immunocompromised models and immunocompetent models, respectively. When the tumors volume reached 50-100 mm.sup.3, 40 ?g of anti-CD276 mAb which was labeled with cyanine-5.5 fluorescent dye (Lumiprobe, Hunt Valley, MD, USA) was intravenously (i.v.) injected into the mouse via tail vein. The live-animal images were captured at 24 hrs post-injection with i.p. injection of FLuc substrate. Then the mice were sacrificed to harvest major organs, including brain, heart, lung, spleen, liver, and kidneys, and tumors for ex vivo imaging. The excitation/emission wavelength of 660/710 nm and exposure time of 5 seconds were used in IVIS imaging.
Cell Line-Derived Xenograft and In Vivo Treatment
[0054] The 4T1-FLuc cells (5?10.sup.6 cells per mouse) were s.c. injected to 6-week BALB/cJ female mice and tumor growth was monitored every other day. When the average tumor volume reached 50-100 mm.sup.3, mice were randomized into four groups (n=7) and i.v. injected with PBS (control), 8 mg/kg of mAb (control), 8 mg/kg of ADC and 20 mg/kg of ADC following a Q4Dx4 schedule. Tumor size was measured by an electric caliper and tumor volume was calculated as (length?width.sup.2)/2. Tumor size and mice body weight were monitored twice a week. Mice were sacrificed when the tumor volume in control group reached >1,000 mm.sup.3. All tumors were harvested for wet weight measurement and the main organs (brain, heart, lung, kidneys, liver, and spleen) were collected for further analysis.
Patient-Derived Xenograft (PDX) Model and In Vivo Treatment
[0055] The TNBC PDX model was generated following published procedure (Si Y, et al. Cancers (Basel). 2021 13(15)). Briefly, the donor mice carrying CD276.sup.+ TNBC tumor were sacrificed when tumor reached 2,000-3,000 mm.sup.3, and the harvested tumors were either passaged or fresh frozen in liquid nitrogen. To passage the patient-derived xenograft, the tumors were minced into small fragments (<1 mm.sup.3), loaded into a 1-mL sterile syringe connected with a 16G needle (BD, Franklin Lakes, NJ, USA), and s.c. injected into the rear flank of 5?7-week-old NSG female mice with 40-50-?L implantation each mouse. The anti-TNBC efficacy of CD276 ADC was confirmed in PDX model by i.v. injecting PBS and 8 mg/kg ADC on a Q4Dx4 schedule (n=7).
Hematoxylin and Eosin (H & E) Staining
[0056] The slides of paraffin sectioned organs were dewaxed with xylene and hydrated with gradient ETOH (100%-50%) and dH.sub.2O, followed with hematoxylin staining, dipping in 1% HCl and 70% ETOH, immersing in 1% NH.sub.4OH for blue color development, and staining with eosin for 30 secs. Finally, the stained slides were dehydrated in 95% and 100% ethanol and cleared in xylene. The H & E-stained slides were imaged with Lionheart FX Automated Microscope (BioTek, Winooski, VT, USA).
Statistical Analysis
[0057] All experimental data were presented as mean?standard error of the mean (SEM). The significance of difference among groups was analyzed using two-tailed t test and the difference between two groups was analyzed using one-way ANOVA followed by post-hoc (Dunnett's) analysis. Statistical analysis was performed using GraphPad Prism and p-value of <0.005 was used for all tests.
Results
CD276 Expression in TNBC Patient Tissues
[0058] The expression of CD276 receptor was evaluated using TNBC patient tissue microarray slide with IHC staining (
Anti-CD276 mAb Development and Production
[0059] The top CD276 mAb-producing hybridoma clone was screened using enzyme-linked immunosorbent assay (ELISA) with HEK293 expressed glycosylated extracellular peptide (Leu29-Pro245) as the coating antigen (
In Vitro and In Vivo TNBC-Targeting
[0060] To visualize the surface binding and receptor mediated internalization, the anti-CD276 mAb was labelled with fluorescent dye AF647. The live-cell confocal microscopy imaging demonstrated that AF647-mAb bound the TNBC MDA-MB-468 and 4T1 cells (BacMam GFP expressed in cytoplasm) at 2 hrs after mixing mAb and cells (
[0061] The MDA-MB-468-FLuc and 4T1-FLuc xenografted mouse models were used to further evaluate the TNBC-targeting and biodistribution of CD276 mAb-Cy5.5 using live-animal and ex vivo IVIS imaging. As shown in
ADC Construction and In Vitro Anti-TNBC Cytotoxicity
[0062] The purity, conjugation rate and DAR of CD276 ADC were analyzed using an HPLC procedure. These results showed that the antibody-drug conjugation rate was >90%, the ADC purity was >95%, and the calculated DAR was >4 (
[0063] The in vitro anti-cancer cytotoxicity of the constructed anti-CD276 mAb-DM1 (ADC) was tested in a three-day IC.sub.50 assay using three TNBC cell lines, such as MDA-MB-231, MDA-MB-468 and 4T1 cells. A serial dosages of 0, 2, 4, 10, 20, 50, 100, and 200 nM were tested, which reduced cell viability to 100%, 44%, 50%, 51%, 44%, 39%, 39%, and 38% for MDA-MB-231 cells, 100%, 28%, 25%, 22%, 21%, 22%, 26%, and 23% for MDA-MB-468 cells, and 100%, 101%, 104%, 97%, 86%, 18%, 7%, and 6% for 4T1 cells, respectively (
In Vivo Anti-Tumor Efficacy in 4T1 Xenograft Models
[0064] The in vivo anti-tumor efficacy of CD276 ADC was first evaluated in 4T1-FLuc xenograft models. When tumor volume reached 50-100 mm.sup.3, the mice were i.v. administrated with PBS (control), 8 mg/kg of mAb, 8 mg/kg of ADC, and 20 mg/kg of ADC following a Q4Dx4 schedule. As shown in
In Vivo Anti-TNBC Efficacy in PDX Models
[0065] To better evaluate or confirm the anti-TNBC efficacy of CD276 ADC, a CD276.sup.+ PDX model was established. The CD276 expression was confirmed with the PDX tumor tissue section slide (
Toxicity Analysis with H & E Staining and Whole Blood Analysis
[0066] The main organs, including brain, heart, liver, kidneys, lung, and spleen, harvested from the in vivo study in 4T1-FLuc xenografted BALB/cJ mouse models were sectioned and performed with H & E staining. There was no obvious difference of cell morphology between ADC treatment group and PBS control group (
DISCUSSION
[0067] In this study, the expression of CD276 receptor as evaluated and confirmed in around 60% of TNBC patient tissues. This finding was consistent with previous studies that detected CD276 in more than 80% of breast cancer tissues (Sun J, et al. Onco Targets Ther. 2014 7:1979-86; Bachawal S V, et al. Cancer Res. 2015 75(12):2501-9; Liu C, et al. Mol Med Rep. 2013 7(1):134-8). The recent clinical trials of enoblituzumab for prostate, breast and lung cancers treatment (Picarda E, et al. Clin Cancer Res. 2016 22(14):3425-31) demonstrated the minimal toxicity to target CD276. In addition, CD276 is involved in inhibiting the immune functions of natural killer (NK) and T cells and the production of effector cytokines (Pardoll D M. Nat Rev Cancer. 2012 12(4):252-64; Vigdorovich V, et al. Structure. 2013 21(5):707-17; Chen C, et al. Exp Cell Res. 2013 319(1):96-102), so blocking the CD276 signaling pathway could reactivate the immune functions of NK and T cells in tumor microenvironment (Picarda E, et al. Clin Cancer Res. 2016 22(14):3425-31; Maeda N, et al. Ann Surg Oncol. 2014 21 Suppl 4:S546-54). Targeting CD276 is a good strategy to treat TNBC because it could cover the majority of TNBC patients and might also upregulate the immunity in tumor microenvironment. A new anti-CD276 mAb and ADC was developed and their anti-TNBC effects evaluated both in vitro and in vivo.
[0068] The Fc-fused fragment cloned from the extracellular domain of human CD276 was expressed in HEK293 cells to generate the same glycan structure as human antigen. This N-glycosylated peptide was injected as immunogen to generate anti-human CD276 mAb using hybridoma technology, which is expected to have high CD276 specificity. As presented in this study, the top anti-CD276 mAb clone (IgG2b/kappa) showed high TNBC-targeting and drug delivery capability in flow cytometry analysis and IVIS imaging, which was further confirmed by the anti-TNBC cytotoxicity and anti-tumor efficacy studies. In addition to the direct cancer cell death caused by the microtubulin depolymerization via potent DM1 in ADC, which was investigated in this study, the synergism of the upregulation of immune function in tumor microenvironment by anti-CD276 mAb could significantly improve the anti-TNBC therapeutic effects.
[0069] To fully evaluate the anti-TNBC efficacy, a CD276.sup.+ PDX model was successfully identified, established, passaged and maintained. The in vivo evaluation of the new anti-CD276 ADC in PDX models confirmed its TNBC treatment effects, as indicated by the completely inhibited tumor growth post i.v. injection. The PDX models could recapitulate the biological nature, genetic and histological features and biological behaviors correlating with the high metastasis, high heterogeneity and poor survival of primary TNBC tumors. This model can be used to evaluate the therapeutic efficacy of different targeted therapies in future.
CONCLUSIONS
[0070] In this study, a new anti-CD276 mAb was developed to target CD276.sup.+ TNBC and deliver potent payload to achieve high anti-cancer cytotoxicity and reduce side effects. Moreover, the CD276 mAb has great potential to reactivate the immune functions of NK and T cells in tumor microenvironment, which needs a full evaluation in future study. The anti-CD276 mAb-based ADC could provide an effective targeted therapy with integrated anti-TNBC mechanisms, which needs further investigation.
[0071] Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of skill in the art to which the disclosed invention belongs. Publications cited herein and the materials for which they are cited are specifically incorporated by reference.
[0072] Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the following claims.