VARIANTS OF SIRT6 FOR USE IN PREVENTING AND/OR TREATING AGE-RELATED DISEASES
20240277868 ยท 2024-08-22
Assignee
- University Of Rochester (Rochester, NY)
- The Trustees Of Columbia University In The City Of New York (New York, NY)
- Albert Einstein College Of Medicine (Bronx, NY)
Inventors
- Vera GORBUNOVA (Honeoye Falls, NY, US)
- Andrei SELUANOV (Honeoye Falls, NY, US)
- Yousin SUH (New York, NY, US)
Cpc classification
C12Y203/01
CHEMISTRY; METALLURGY
A61P1/00
HUMAN NECESSITIES
C12N9/1029
CHEMISTRY; METALLURGY
C12N2740/16043
CHEMISTRY; METALLURGY
C12N15/70
CHEMISTRY; METALLURGY
A61K48/0016
HUMAN NECESSITIES
H02K7/18
ELECTRICITY
C12N15/86
CHEMISTRY; METALLURGY
International classification
A61K48/00
HUMAN NECESSITIES
A61P35/00
HUMAN NECESSITIES
Abstract
An isolated nucleic acid molecule encoding a variant of sirtuin 6 (SIRT6) having at least 75% identity with sequence SEQ ID NO: 1, the variant having at least one mutation selected from a N308K substitution and a A313S substitution with respect to sequence SEQ ID NO: 1. Also, means for the regulation of ageing, and/or senescence, and/or lifespan in an individual. Further, means for the repair of double strand breaks in a cell. Finally, means for the prevention and/or the treatment of an age-related disease.
Claims
1-15. (canceled)
16. An isolated nucleic acid molecule encoding a variant of sirtuin 6 (SIRT6) having at least 75% identity with sequence SEQ ID NO: 1, the variant having at least one mutation selected in the group comprising or consisting of a substitution N308K and a substitution A313S with respect to sequence SEQ ID NO: 1.
17. The isolated nucleic acid molecule according to claim 16, wherein the nucleic acid molecule is of sequence selected in the group comprising or consisting of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8.
18. The isolated nucleic acid molecule according to claim 16, wherein the nucleic acid molecule is of sequence SEQ ID NO: 6.
19. The isolated nucleic acid molecule according to claim 16, wherein the nucleic acid molecule is of sequence SEQ ID NO: 7.
20. The isolated nucleic acid molecule according to claim 16, wherein the nucleic acid molecule is of sequence SEQ ID NO: 8.
21. An isolated polypeptide encoded by the nucleic acid molecule according to claim 16.
22. The isolated polypeptide according to claim 21, wherein the polypeptide is of sequence selected in the group comprising or consisting of SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4.
23. The isolated polypeptide according to claim 21, wherein the polypeptide is of sequence SEQ ID NO: 2.
24. The isolated polypeptide according to claim 21, wherein the polypeptide is of sequence SEQ ID NO: 3.
25. The isolated polypeptide according to claim 21, wherein the polypeptide is of sequence SEQ ID NO: 4.
26. A method for the prevention and/or the treatment of an age-related disease in an individual in need thereof, comprising the administration to said individual of a therapeutically efficient amount of the isolated nucleic acid molecule according to claim 16 or of an isolated polypeptide encoded by the nucleic acid molecule.
27. The method according to claim 26, wherein the individual is a mammalian individual.
28. The method according to claim 27, wherein the individual is a human individual.
29. The method according to claim 26, wherein the age-related disease is selected in the group comprising or consisting of progeria, Werner syndrome, neurodegenerative disease, Alzheimer's disease, cancer, cardiovascular disease, obesity, type 2 diabetes, hypercholesterolemia, hypertension, ocular disorders, cataracts, glaucoma, osteoporosis, blood clotting disorders, arthritis, hearing loss and stroke.
30. The method according to claim 26, wherein the age-related disease is selected in the group comprising or consisting of Hutchinson Gilford progeria, Werner syndrome, Alzheimer's disease and cancer.
31. The method according to claim 26, wherein the age-related disease is progeria or Werner syndrome.
32. The method according to claim 26, wherein the age-related disease is cancer.
33. The method according to claim 26, wherein the isolated nucleic acid molecule or the isolated polypeptide encoded by the nucleic acid molecule is to be co-administered, or sequentially administered, with a drug suitable for preventing and/or treating an age-related disease.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0040]
[0041]
[0042]
[0043]
[0044]
[0045]
[0046]
[0047]
[0048]
[0049]
[0050]
[0051]
[0052]
[0053]
[0054]
[0055]
[0056]
[0057]
[0058]
[0059]
[0060]
[0061]
[0062]
[0063]
[0064]
[0065]
[0066]
[0067]
[0068]
[0069]
[0070]
[0071]
[0072]
[0073]
DETAILED DESCRIPTION
[0074] The inventors used herein an alternative, candidate functional association approach to directly identify rare longevity gene variants enriched in the genome of a cohort of Ashkenazi Jewish (AJ) centenarians.
[0075] Based on previous evidences of DNA damage as a driver of ageing, the inventors performed targeted sequencing of 301 genes involved in Genome Maintenance (GM), a major longevity assurance system, in 496 AJ centenarians and 572 controls.
[0076] Among the ten GM genes containing nominally significant missense genetic variants enriched in the centenarian genome, was SIRT6, a deacylase and mono-ADP ribosyl transferase (mADPr) enzyme-6, involved in both DNA double-strand breaks (DSB) repair and longevity in model organisms.
[0077] The inventors selected two genetically linked variants in the same allele (N308K and A313S), for further functional analysis. Characterization of this SIRT6 centenarian allele (centSIRT6) demonstrated it to be a stronger suppressor of LINE1 retrotransposons, confer enhanced stimulation of DNA DSB repair, and more robust cancer cell killing compared to the wild type allele.
[0078] Surprisingly, centSIRT6 displayed weaker deacetylase activity compared to the wild type. Conversely, its mADPr activity was strongly enhanced. FRET-based analysis demonstrated the centSIRT6 had a more open conformation. centSIRT6 displayed a stronger interaction with Lamin A/C (LMNA), which correlated with enhanced ribosylation of LMNA.
[0079] This invention relates to an isolated nucleic acid molecule encoding a variant of sirtuin 6 (SIRT6) having at least 75% identity with sequence SEQ ID NO: 1, the variant having at least one mutation selected in the group comprising or consisting of a N308K substitution and an A313S substitution with respect to sequence SEQ ID NO: 1.
[0080] As used herein the expression at least 75% identity encompasses 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100% identity.
[0081] The level of identity of 2 polypeptides may be performed by using any one of the known algorithms available from the state of the art. Illustratively, the amino acid identity percentage may be determined using the CLUSTAL W software (version 1.83), the parameters being set as follows: [0082] for slow/accurate alignments: (1) Gap Open Penalty: 10.00; (2) Gap Extension Penalty:0.1; (3) Protein weight matrix: BLOSUM; [0083] for fast/approximate alignments: (4) Gap penalty: 3; (5) K-tuple (word) size: 1; (6) No. of top diagonals: 5; (7) Window size: 5; (8) Scoring Method: PERCENT.
[0084] In certain embodiments, the isolated nucleic acid molecule encodes a variant of SIRT6 having at least 80%, preferably at least 85%, more preferably at least 90%, even more preferably at least 95%, most preferably at least 96%, 97%, 98% or 99% identity with sequence SEQ ID NO: 1, the variant having at least one mutation selected in the group comprising or consisting of a N308K substitution and an A313S substitution with respect to sequence SEQ ID NO: 1.
[0085] Within the scope of the invention the sequence SEQ ID NO: 1 refers to the 361 amino acid residues sequence of wild type SIRT6 polypeptide. In practice, substitutions N308K and A313S refer to the mutations of the codon encoding the naturally occurring Asn (N) amino acid residue at position 308 in the SIRT6 polypeptide, and the Ser (S) amino acid residue at position 313 in the SIRT6 polypeptide, respectively.
[0086] Within the scope of the invention the sequence SEQ ID NO: 5 refers to the 1,068 nucleotides (bp) sequence of wild type SIRT6 polypeptide.
[0087] In some embodiments, the naturally occurring Asn (N) amino acid residue at position 308 in the SIRT6 polypeptide is encoded by codon aac at positions 922 to 924 of SEQ ID NO: 5. In some embodiments, the naturally occurring Ser (S) amino acid residue at position 313 in the SIRT6 polypeptide is encoded by codon gcc at positions 937 to 939 of SEQ ID NO: 5.
[0088] In certain embodiments, the N308K substitution is represented by a mutation of codon aac at positions 922 to 924 of SEQ ID NO: 5 into codon aag or codon aaa, preferably into codon aag. In other words, the N308K substitution is represented by a mutation of nucleotide c at positions 924 of SEQ ID NO: 5 into nucleotide g or nucleotide a, preferably into nucleotide g.
[0089] In certain embodiments, the A313S substitution is represented by a mutation of codon gcc at positions 937 to 939 of SEQ ID NO: 5 into a codon selected in a group consisting of codons tcc, tct, tca and tcg, preferably codon tcc. In other words, the A313S substitution is represented by one or two mutation(s) selected in a group consisting of a mutation of nucleotide g at positions 937 of SEQ ID NO: 5 into nucleotide t; a mutation of nucleotide g at positions 937 of SEQ ID NO: 5 into nucleotide t and of nucleotide c at positions 939 of SEQ ID NO: 5 into nucleotide t; a mutation of nucleotide g at positions 937 of SEQ ID NO: 5 into nucleotide t and of nucleotide c at positions 939 of SEQ ID NO: 5 into nucleotide a; and a mutation of nucleotide g at positions 937 of SEQ ID NO: 5 into nucleotide t and of nucleotide c at positions 939 of SEQ ID NO: 5 into nucleotide g.
[0090] In some embodiments, the nucleic acid molecule is of sequence selected in the group comprising or consisting of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8.
[0091] As used herein, sequence SEQ ID NO: 6 refers to the nucleic acid sequence of the variant of SIRT6 with N308K substitution, in particular, with mutation of codon aac at positions 922 to 924 of SEQ ID NO: 5 into codon aag.
[0092] As used herein, sequence SEQ ID NO: 7 refers to the nucleic acid sequence of the variant of SIRT6 with A313S substitution, in particular, with mutation of codon gcc at positions 922 to 924 of SEQ ID NO: 5 into codon tcc.
[0093] As used herein, sequence SEQ ID NO: 8 refers to the nucleic acid sequence of the variant of SIRT6 with N308K and A313S substitutions, in particular, with mutation of codon aac at positions 922 to 924 of SEQ ID NO: 5 into codon aag and with mutation of codon gcc at positions 922 to 924 of SEQ ID NO: 5 into codon tcc.
[0094] In some embodiments, the variant of SIRT6 encoded by the isolated nucleic acid molecule as defined herein has a deacylase and/or mono-ADP ribosyl transferase (mADPr) activity.
[0095] In practice, the deacylase activity and mono-ADP ribosyl transferase (mADPr) activity may be assayed accordingly to any suitable from the state in the art, or a method adapted therefrom. Illustratively, deacylase activity may be assayed by contacting in vitro the variant of SIRT6 with histones, in the presence of NAD+, MgCl.sub.2, DTT and performing a Western blot analysis using anti-H3K9ac and anti-H3K18ac antibodies. Illustratively, mono-ADP ribosyl transferase (mADPr) activity may be assayed by contacting in vitro the variant of SIRT6 with PARP1, in the presence of ZnCl.sub.2, MgCl.sub.2, NAD+, DTT, salmon sperm DNA and performing a Western blot analysis using anti-PADPR antibodies.
[0096] In certain embodiments, the variant of SIRT6 has at most about 90%, preferably at most about 50%, more preferably at most about 25% deacylase activity as compared to wild type SIRT6 (of sequence SEQ ID NO: 1). Within the scope of the invention, the expression at most about 90% encompasses about 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 5%, 1% or less.
[0097] In some embodiments, the variant of SIRT6 has at most least 100%, preferably at least about 200%, more preferably at least about 300% mono-ADP ribosyl transferase (mADPr) activity as compared to wild type SIRT6 (of sequence SEQ ID NO: 1). Within the scope of the invention, the expression at least about 100% encompasses about 100%, 120%, 140%, 160%, 180%, 200%, 220%, 240%, 260%, 280%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650%, 700%, 750% or more.
[0098] Another aspect of the invention relates to an isolated polypeptide encoded by a nucleic acid molecule according to the instant invention.
[0099] This invention relates to an isolated polypeptide being a variant of SIRT6 having at least 75% identity with sequence SEQ ID NO: 1, the variant having at least one mutation selected in the group comprising or consisting of a substitution N308K and a substitution A313S with respect to sequence SEQ ID NO: 1.
[0100] As used herein the expression at least 75% identity encompasses 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% identity.
[0101] In certain embodiments, the isolated polypeptide being a variant of SIRT6 has at least 80%, preferably at least 85%, more preferably at least 90%, even more preferably at least 95%, most preferably at least 96%, 97%, 98% or 99% identity with sequence SEQ ID NO: 1, the variant having at least one mutation selected in the group comprising or consisting of a substitution N308K and a substitution A313S with respect to sequence SEQ ID NO: 1.
[0102] In some embodiments, the polypeptide is of sequence selected in the group comprising or consisting of SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4.
[0103] As used herein, sequence SEQ ID NO: 2 refers to the amino acid sequence of the variant of SIRT6 with N308K substitution. In some embodiments, the polypeptide of sequence SEQ ID NO: 2 is encoded by a nucleic acid molecule of sequence SEQ ID NO: 6.
[0104] As used herein, sequence SEQ ID NO: 3 refers to the amino acid sequence of the variant of SIRT6 with A313S substitution. In some embodiments, the polypeptide of sequence SEQ ID NO: 3 is encoded by a nucleic acid molecule of sequence SEQ ID NO: 7.
[0105] As used herein, sequence SEQ ID NO: 4 refers to the amino acid sequence of the variant of SIRT6 with N308K and A313S substitutions. In some embodiments, the polypeptide of sequence SEQ ID NO: 4 is encoded by a nucleic acid molecule of sequence SEQ ID NO: 8.
[0106] In certain embodiments, the polypeptide is a recombinant polypeptide. As used herein, the term recombinant polypeptide refers to a polypeptide encoded by an engineered nucleic acid and synthesized upon transformation of said engineered nucleic acid into a microorganism or transfection in an eukaryotic cell for synthesis purposes.
[0107] A further aspect of the invention relates to a vector comprising the isolated nucleic acid molecule according to the invention.
[0108] In some embodiments, the vector in a minicircle nucleic acid, a plasmid, a cosmid or a bacterial artificial chromosome.
[0109] As used herein, the term minicircle nucleic acid encompasses non-viral vectors that merely comprise a gene expression cassette and are free of viral and/or bacterial backbone DNA elements from standard plasmids.
[0110] As used herein, the term plasmid is intended to refer to a small extra-genomic DNA molecule, most commonly found as circular double stranded DNA molecules that may be used as a cloning vector in molecular biology, to make and/or modify copies of DNA fragments up to about 15 kb (i.e., 15,000 base pairs). Plasmids may also be used as expression vectors to produce large amounts of proteins of interest encoded by a nucleic acid sequence found in the plasmid downstream of a promoter sequence.
[0111] A used herein, the term cosmid refers to a hybrid plasmid that contains cos sequences from Lambda phage, allowing packaging of the cosmid into a phage head and subsequent infection of bacterial cell wherein the cosmid is cyclized and can replicate as a plasmid. Cosmids are typically used as cloning vector for DNA fragments ranging in size from about 32 to 52 kb.
[0112] As used herein, the term bacterial artificial chromosome or BAC refers to extra-genomic nucleic acid molecule based on a functional fertility plasmid that allows the even partition of said extra-genomic DNA molecules after division of the bacterial cell. BACs are typically used as cloning vector for DNA fragment ranging in size from about 150 to 350 kb.
[0113] In practice, the vector comprising the nucleic acid molecule encoding a variant of SIRT6 may be in the form of a plasmid, in particular resulting from the cloning of a nucleic acid of interest into a nucleic acid vector. In some embodiments, non-limitative suitable nucleic acid vectors are pBluescript vectors, pET vectors, pETduet vectors, pGBM vectors, pBAD vectors, pUC vectors. In one embodiment, the plasmid is a low copy plasmid. In one embodiment, the plasmid is a high copy plasmid.
[0114] In some embodiments, the vector is a viral vector. In some embodiments, the viral vector is selected in a group comprising or consisting of an adenovirus; an adeno-associated virus (AAV); an exosome-associated AAV (exo-AAV); an alphavirus; a herpesvirus; a retrovirus, such as, e.g., a lentivirus or a non-integrative lentivirus; vaccinia virus; a baculovirus; or virus like particles such as, e.g., particles derived from Hepatitis B virus, Parvoviridae, Retroviridae, Flaviviridae, Paramyxoviridae or bacteriophages.
[0115] In certain embodiments, the vector is a viral vector, in particular an adeno-associated viral vector (AAV), an exosome-associated AAV vector (exo-AAV), an adenoviral vector, a retroviral vector, or a herpes virus vector.
[0116] In some embodiments, the adeno-associated viral vector (AAV) is AAV serotype 2 or AAV serotype 5.
[0117] In certain embodiments, the vector, in particular the viral vector, is an exo-AAV vector. As used herein, exo-AAV refers to a vector wherein an adeno-associated virus (AAV) vector, or parts thereof, is associated with an extracellular vesicle (also referred to as exosome), wherein the AAV vector is partially fused, embedded or internalized in the extracellular vesicle. The extracellular vesicle may express specific proteins or markers, for example for targeting purposes.
[0118] In certain embodiments, the vector, in particular the viral vector, does not cross the blood-brain barrier. In some alternative embodiments, the vector, in particular viral vector crosses the blood-brain barrier. In practice, the choice of the viral vector may depend of the organ or tissue that is targeted. For example, for brain cancer, neurodegenerative disease, Alzheimer's disease and progeria, a vector that crosses the blood-brain barrier may be preferably selected. On the contrary for obesity, cardiovascular diseases, type 2 diabetes, hypercholesterolemia, ocular diseases, a vector that does not cross the blood-brain barrier may be preferably selected.
[0119] In practice, assessing whether a vector, in particular a viral vector, crosses the blood/brain barrier may be performed by any suitable method acknowledged from the state of the art, or a method adapted therefrom. Illustratively, this assessment may be performed by the means of one of the two gold-standard experimental measures of blood/brain barrier permeability, namely, (1) logBB, which is intended to measure the concentration of a compound in the brain divided by concentration in the blood; and (2) logPS, which measures the permeability surface-area product.
[0120] In some embodiments, the vector, in particular the viral vector, comprises a promoter sequence suitable for gene expression in mammalian individuals, preferably in human individuals.
[0121] Non-limitative examples of promoter sequence suitable for gene expression in mammalian individuals, preferably in human individuals, include CMV (human cytomegalovirus) promoter, EF1a (human elongation factor 1 alpha) promoter, SV40 (Simian vacuolating virus 40) promoter, PGK1 (phosphoglycerate kinase) promoter, Ubc (human ubiquitin C) promoter, and the like.
[0122] In certain embodiments, the promoter sequence is preferably the CMV promoter.
[0123] In some embodiments, the vector, in particular the viral vector, further comprises a nucleic acid sequence that facilitates the nuclear localization of the polypeptide encoded by the nucleic acid molecule according to the invention into a target recipient cell. In practice, these nuclear localization signal (NLS) have been abundantly discussed in the state of the art.
[0124] In certain embodiments, the vector, in particular the viral vector, may comprise a S/MAR (for scaffold/matrix attachment region) nucleic acid sequence. As used herein, the S/MAR nucleic acid sequence, also referred to SAR (for scaffold-attachment region) or MAR (for matrix-associated region), is intended to refer to a nucleic acid sequence that is naturally found in the DNA of eukaryotic chromosomes and that promotes attachment to the nuclear matrix. In some embodiments, the S/MAR nucleic acid sequence may serve as an origin of replication. In practice, vectors comprising a S/MAR nucleic acid sequence may behave as extra-chromosome in a transfected cell and be advantageously transmitted to its progeny. Illustratively, suitable S/MAR nucleic acid sequence may be determined as described in Narwade et al. (Nucleic Acids Research, 2019; 47(14):7247-7261).
[0125] In one aspect, the invention relates to a suspension comprising a vector according to the invention.
[0126] In some embodiments, the suspension further comprises a fluid including one or more ingredients selected from the group consisting of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and a combination thereof.
[0127] In certain embodiment, the suspension is formulated for intravenous infusion. In practice, the suspension formulated for intravenous infusion may comprise saline (e.g., 0.9% NaCl); lactated Ringers; 5% dextrose; a colloid, such as, e.g., albumin; the like; and any combination thereof.
[0128] In one aspect, the invention pertains to a cell expressing the polypeptide, the cell being preferably transfected with an isolated nucleic acid molecule, or a vector according to the instant invention.
[0129] In certain embodiments, the cell is a eukaryote cell, preferably an animal cells, more preferably a mammalian cell. As used herein mammalian cell includes non-human mammalian cells and human cells. In some embodiments, the cell is a human cell.
[0130] In some embodiments, the cell is selected in the group comprising or consisting of nerve cells, bone cells, breast cells, red blood cells, white blood cells, cartilage cells, epithelial cells, endothelial cells, skin cells, muscle cells, bladder cells, kidney cells, liver cells, prostate cells, cervix cells, ovarian cells, pulmonary cells, retinal cells, conjunctival cells, corneal cells, fat cells, and the like.
[0131] It is to be understood that the cell according to the invention has been transfected with an isolated nucleic acid molecule according to the invention, or transduced with an isolated nucleic acid molecule according to the invention, or contacted with the vector or the suspension containing the nucleic acid molecule according to the invention. Therefore, the cell contains the nucleic acid molecules either integrated or not in its genome. In practice, because the vector is an expression system, the nucleic acid molecule encoding the variant of SIRT6 is present within the cell in a form allowing its expression and its final location, i.e., the cell nucleus and cytoplasm.
[0132] Another aspect of the invention relates to a pharmaceutical composition comprising (i) an isolated nucleic acid molecule, or an isolated polypeptide, or a vector according to the instant invention, and (ii) a pharmaceutically acceptable excipient.
[0133] In some embodiments, a suitable pharmaceutically acceptable carrier according to the invention includes any and all conventional solvents, dispersion media, fillers, solid carriers, aqueous solutions, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like. In certain embodiments, suitable pharmaceutically acceptable carriers may include, water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and a mixture thereof. In some embodiments, pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the cells. The preparation and use of pharmaceutically acceptable carriers are well known in the art.
[0134] One aspect of the invention relates to the use of an isolated nucleic acid molecule, or an isolated polypeptide, or a vector according to the instant invention, in the regulation of ageing, and/or senescence, and/or lifespan in an individual, preferably a mammalian individual, more preferably a human individual.
[0135] As used herein, the term regulating the senescence is intended to refer to the process of decreasing, reducing or stopping the senescence mechanism, in particular premature senescence.
[0136] As used herein, the term regulating the lifespan is intended to refer to the process of increasing or improving the lifespan, in other words increasing or improving the duration of the life time course.
[0137] The invention further relates to a method for the regulation of ageing, and/or senescence, and/or lifespan in an individual, preferably a mammalian individual, more preferably a human individual, in need thereof, comprising the administration of a therapeutically efficient amount of an isolated nucleic acid molecule, or an polypeptide isolated, or a vector according to the instant invention.
[0138] A further aspect of the invention pertains to the use of an isolated nucleic acid molecule, or an isolated polypeptide, or a vector according to the instant invention, in the repair of double strand breaks in a cell, preferably a mammalian cell, more preferably a human cell.
[0139] The invention relates also to a method for the repair of double strand breaks in a cell, preferably a mammalian cell, more preferably a human cell, comprising the administration of a therapeutically efficient amount of an isolated nucleic acid molecule, or an isolated polypeptide, or a vector according to the instant invention.
[0140] As used herein, repair of double strand breaks refers to the process allowing to recover DNA integrity by repair DNA damages consisting in the occurrence of a break in both strands of the double strand DNA nucleic acid. In practice, the repair of double strand breaks involves repair mechanisms such as non-homologous end joining (NHEJ) and homologous repair (HR).
[0141] In practice, efficiency of double strand breaks repair may be assessed by any suitable method from the state of the art, or a method adapted therefrom. Illustratively, double strand break repairs efficiency may be assessed by the methods described in Seluanov et al. (J Vis Exp, 2010; doi: 10.3791/2002).
[0142] Within the scope of the invention, the nucleic acid molecule, the polypeptide, the vector, the suspension or the pharmaceutical composition according to the invention are intended to increase, improve or ameliorate the efficiency of the DSB repair in the target cell, as compared to the efficiency of the DSB repair in the absence of any treatment, as a reference level.
[0143] As used herein, the term increase, improve or ameliorate the efficiency of the DSB repair encompasses at least 1.2-fold increase as compared to a reference level. Within the scope of the invention, the term at least 1.2-fold encompasses, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2.0, 2.2, 2.4, 2.6, 2.8, 3.0, 3.2, 3.4, 3.6, 3.8, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1,000-fold, or more.
[0144] In another aspect, the invention relates to an isolated nucleic acid molecule, or an isolated polypeptide, or a vector according to the instant invention, for use in the prevention and/or the treatment of an age-related disease.
[0145] The invention also relates to the to the use of an isolated nucleic acid molecule, or an isolated polypeptide, or a vector according to the instant invention, for the preparation or the manufacture of a medicament for the prevention and/or the treatment of an age-related disease.
[0146] In some further aspect, the invention pertains to a method for the prevention and/or the treatment of an age-related disease in an individual in need thereof, comprising the administration of a therapeutically efficient amount of an isolated nucleic acid molecule, or an isolated polypeptide, or a vector according to the instant invention.
[0147] In certain embodiments, the individual in need thereof is a mammalian individual, preferably a human individual.
[0148] In some embodiments, the age-related disease is selected in the group comprising or consisting of progeria, Werner syndrome, neurodegenerative disease, Alzheimer's disease, cancer, cardiovascular disease, obesity, type 2 diabetes, hypercholesterolemia, hypertension, ocular disorders, cataracts, glaucoma, osteoporosis, blood clotting disorders, arthritis, hearing loss and stroke.
[0149] In one embodiment, the age-related disease is progeria or Werner syndrome.
[0150] In some embodiments, the age-related disease is cancer. In certain embodiments, the cancer is a blood cancer or a solid cancer.
[0151] As used herein, the term blood cancer, also referred to as hematologic cancer, encompasses any cancer involving uncontrolled proliferation of blood cells, in particular white blood cells. Blood cancers includes leukemia, lymphoma (Hodgkin and non-Hodgkin lymphomas) and myeloma.
[0152] In certain embodiments, the cancer is a blood cancer. In some embodiments, said cancer is a blood cancer selected in the group consisting of Hodgkin's disease, immunoblastic lymphadenopathy, lymphoma, chronic lymphocytic leukemia, acute leukemia, and the like.
[0153] As used herein, the term solid cancer encompasses any cancer (also referred to as malignancy) that forms a discrete tumor mass, as opposed to cancers (or malignancies) that diffusely infiltrate a tissue without forming a mass.
[0154] In certain embodiments, the cancer is a solid cancer. In some embodiments, the solid cancer is selected in the group consisting of fibrosarcoma, melanoma, breast carcinoma, colon carcinoma, renal carcinoma, adrenocortical carcinoma, testicular teratoma, skin sarcoma, fibrosarcoma, lung carcinoma, adenocarcinoma, liver carcinoma (i.e., hepatocarcinoma), glioblastoma, prostate carcinoma, ovarian cancer and pancreatic carcinoma.
[0155] In some embodiments, the age-related disease is selected in the group comprising or consisting of Hutchinson Gilford progeria, Werner syndrome, Alzheimer's disease and cancer.
[0156] In some embodiments, the age-related disease is selected in the group comprising or consisting of Hutchinson Gilford progeria, Werner syndrome, Alzheimer's disease and fibrosarcoma.
[0157] In some embodiments, the age-related disease is selected in the group comprising or consisting of Hutchinson Gilford progeria, Werner syndrome, Alzheimer's disease and hepatocarcinoma.
[0158] In one embodiment, the age-related disease is hepatocarcinoma. In one embodiment, the age-related disease is fibrosarcoma.
[0159] In certain embodiments, the progeria is the Hutchinson Gilford progeria.
[0160] In one embodiment, the age-related disease is Werner syndrome.
[0161] In some embodiments, the nucleic acid molecule, the polypeptide, the vector, the suspension, or the pharmaceutical composition according to the invention is to be administered to an individual in need thereof by any suitable route, i.e., by a dermal administration, by an oral administration, a topical administration or a parenteral administration, e.g., by injection, including a sub-cutaneous administration, a venous administration, an arterial administration, in intra-muscular administration, an intra-ocular administration and an intra-auricular administration.
[0162] In certain embodiments, the nucleic acid molecule, the polypeptide, the vector, the suspension, or the pharmaceutical composition according to the invention is to be administered to an individual in need thereof by a dermal administration. In certain embodiments, the nucleic acid molecule, the polypeptide, the vector, the suspension, or the pharmaceutical composition according to the invention is associated with a composition enabling and/or facilitating dermal administration, e.g., by increasing dermal tropism or by increasing dermal barrier penetration. In some embodiments, the dermal administration enables a prolonged liberation of the nucleic acid molecule, the polypeptide, the vector, the suspension, or the pharmaceutical composition according to the invention.
[0163] In certain embodiments, the nucleic acid molecule, the polypeptide, the vector, the suspension, or the pharmaceutical composition according to the invention is to be administered to an individual in need thereof by an intravenous administration, in particular by intravenous infusion or intravenous injection.
[0164] Within the scope of the instant invention, the therapeutically effective amount of the nucleic acid molecule, the polypeptide, the vector, the suspension, or the pharmaceutical composition according to the invention, to be administered may be determined by a physician or an authorized person skilled in the art and can be suitably adapted within the time course of the treatment.
[0165] In certain embodiments, the therapeutically effective amount to be administered may depend upon a variety of parameters, including the material selected for administration, whether the administration is in single or multiple doses, and the individual's parameters including age, physical conditions, size, weight, gender, and the severity of the age-related disease to be treated.
[0166] In certain embodiments, a therapeutically effective amount of the isolated polypeptide, or the pharmaceutical composition comprising the isolated polypeptide according to the invention, agent may range from about 0.001 mg to about 3,000 mg, per dosage unit, preferably from about 0.05 mg to about 100 mg, per dosage unit.
[0167] Within the scope of the instant invention, the expression from about 0.001 mg to about 3,000 mg includes, from about 0.001 mg, 0.002 mg, 0.003 mg, 0.004 mg, 0.005 mg, 0.006 mg, 0.007 mg, 0.008 mg, 0.009 mg, 0.01 mg, 0.02 mg, 0.03 mg, 0.04 mg, 0.05 mg, 0.06 mg, 0.07 mg, 0.08 mg, 0.09 mg, 0.1 mg, 0.2 mg, 0.3 mg, 0.4 mg, 0.5 mg, 0.6 mg, 0.7 mg, 0.8 mg, 0.9 mg, 1 mg, 2 mg, 3 mg, 4 mg, 5 mg, 6 mg, 7 mg, 8 mg, 9 mg, 10 mg, 20 mg, 30 mg, 40 mg, 50 mg, 60 mg, 70 mg, 80 mg, 90 mg, 100 mg, 150 mg, 200 mg, 250 mg, 300 mg, 350 mg, 400 mg, 450 mg, 500 mg, 550 mg, 600 mg, 650 mg, 700 mg, 750 mg, 800 mg, 850 mg, 900 mg, 950 mg, 1,000 mg, 1,100 mg, 1,150 mg, 1,200 mg, 1,250 mg, 1,300 mg, 1,350 mg, 1,400 mg, 1,450 mg, 1,500 mg, 1,550 mg, 1,600 mg, 1,650 mg, 1,700 mg, 1,750 mg, 1,800 mg, 1,850 mg, 1,900 mg, 1,950 mg, 2,000 mg, 2,100 mg, 2,150 mg, 2,200 mg, 2,250 mg, 2,300 mg, 2,350 mg, 2,400 mg, 2,450 mg, 2,500 mg, 2,550 mg, 2,600 mg, 2,650 mg, 2,700 mg, 2,750 mg, 2,800 mg, 2,850 mg, 2,900 mg, 2,950 mg and 3,000 mg per dosage unit.
[0168] In certain embodiments, the isolated polypeptide or the pharmaceutical composition comprising the isolated polypeptide according to the invention, may be at dosage levels sufficient to deliver from about 0.001 mg/kg to about 100 mg/kg, from about 0.01 mg/kg to about 50 mg/kg, preferably from about 0.1 mg/kg to about 40 mg/kg, preferably from about 0.5 mg/kg to about 30 mg/kg, from about 0.01 mg/kg to about 10 mg/kg, from about 0.1 mg/kg to about 10 mg/kg, and more preferably from about 1 mg/kg to about 25 mg/kg, of subject body weight per day. Within the scope of the instant invention, the expression from about 0.001 mg/kg to about 100 mg/kg includes about 0.001 mg/kg, 0.002 mg/kg, 0.003 mg/kg, 0.004 mg/kg, 0.005 mg/kg, 0.006 mg/kg, 0.007 mg/kg, 0.008 mg/kg, 0.009 mg/kg, 0.01 mg/kg, 0.02 mg/kg, 0.03 mg/kg, 0.04 mg/kg, 0.05 mg/kg, 0.06 mg/kg, 0.07 mg/kg, 0.08 mg/kg, 0.09 mg/kg, 0.1 mg/kg, 0.2 mg/kg, 0.3 mg/kg, 0.4 mg/kg, 0.5 mg/kg, 0.6 mg/kg, 0.7 mg/kg, 0.8 mg/kg, 0.9 mg/kg, 1 mg/kg, 2 mg/kg, 3 mg/kg, 4 mg/kg, 5 mg/kg, 6 mg/kg, 7 mg/kg, 8 mg/kg, 9 mg/kg, 10 mg/kg, 20 mg/kg, 30 mg/kg, 40 mg/kg, 50 mg/kg, 60 mg/kg, 70 mg/kg, 80 mg/kg, 90 mg/kg and 100 mg/kg.
[0169] In some embodiments, the therapeutically efficient amount of the isolated nucleic acid molecule, vector, or pharmaceutical composition according to the invention is ranging from about 10.sup.1 to about 10.sup.15 copies per ml. In practice, a therapeutically efficient amount includes about 10.sup.1, 5?10.sup.1, 10.sup.2, 5?10.sup.2, 10.sup.3, 5?10.sup.3, 10.sup.4, 5?10.sup.4, 10.sup.5, 5?10.sup.5, 10.sup.6, 5?10.sup.6, 10.sup.7, 5?10.sup.7, 10.sup.8, 5?10.sup.8, 10.sup.9, 5?10.sup.9, 10.sup.10, 5?10.sup.10, 10.sup.11, 5?10.sup.11, 10.sup.12, 5?10.sup.12, 10.sup.13, 5?10.sup.13, 10.sup.14, 5?10.sup.14 and 10.sup.15 copies per ml. In certain embodiments, the therapeutically efficient amount is from about 10.sup.1 to about 10.sup.15 copies per cm.sup.3, which includes about 10.sup.1, 5?10.sup.1, 10.sup.2, 5?10.sup.2, 10.sup.3, 5?10.sup.3, 10.sup.4, 5?10.sup.4, 10.sup.5, 5?10.sup.5, 10.sup.6, 5?10.sup.6, 10.sup.7, 5?10.sup.7, 10.sup.8, 5?10.sup.8, 10.sup.9, 5?10.sup.9, 10.sup.10, 5?10.sup.10, 10.sup.11, 5?10.sup.11, 10.sup.12, 5?10.sup.12, 10.sup.13, 5?10.sup.13, 10.sup.14, 5?10.sup.14 and 10.sup.15 copies per cm.sup.3. In some embodiments, the therapeutically efficient amount is from about 10.sup.1 to about 10.sup.15 copies per dose, which includes about 10.sup.1, 5?10.sup.1, 10.sup.2, 5?10.sup.2, 10.sup.3, 5?10.sup.3, 10.sup.4, 5?10.sup.4, 10.sup.5, 5?10.sup.5, 10.sup.6, 5?10.sup.6, 10.sup.7, 5?10.sup.7, 10.sup.8, 5?10.sup.8, 10.sup.9, 5?10.sup.9, 10.sup.10, 5?10.sup.10, 10.sup.11, 5?10.sup.11, 10.sup.12, 5?10.sup.12, 10.sup.13, 5?10.sup.13, 10.sup.14, 5?10.sup.14 and 10.sup.15 copies per dose.
[0170] In certain embodiments, the isolated nucleic acid molecule, isolated polypeptide, vector, suspension, or pharmaceutical composition according to the instant invention is to be co-administered, or sequentially administered, with a drug suitable for preventing and/or treating an age-related disease, in particular a disease selected in the group consisting of progeria, Werner syndrome, neurodegenerative disease, Alzheimer's disease, cancer, cardiovascular disease, obesity, type 2 diabetes, hypercholesterolemia, hypertension, ocular disorders, cataracts, glaucoma, osteoporosis, blood clotting disorders, arthritis, hearing loss and stroke.
[0171] As used herein, the term co-administered refers to a simultaneous administration of the active principles. As used herein, the term sequentially administered refers to an administration of a first active principle before or after the administration of a second active principle.
[0172] Another aspect of the invention relates to a kit comprising (i) an isolated nucleic acid, an isolated polypeptide molecule, a vector, or a suspension according to the instant invention, and (ii) means to administer the isolated nucleic acid molecule, the isolated polypeptide, the vector, or the suspension.
[0173] In some embodiments, the means to administer the isolated nucleic acid molecule, the isolated polypeptide, the vector, or the suspension include a syringe or a catheter.
[0174] Another aspect of the invention relates to a method for increasing adipogenic differentiation in a subject, comprising administering an effective amount of a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the amino acid sequence selected from the group comprising or consisting of SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, or a nucleic acid molecule encoding thereof. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the nucleic acid sequence selected from the group comprising or consisting of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8.
[0175] Another aspect of the invention relates to an in vitro method for increasing adipogenic differentiation of a cell, or population of cells, comprising exposing the cell, or population of cells, to an effective amount of a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the amino acid sequence selected from the group comprising or consisting of SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, or a nucleic acid molecule encoding thereof. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the nucleic acid sequence selected from the group comprising or consisting of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8. In some embodiments, the cell, or population of cells, is a pre-adipocyte.
[0176] Another aspect of the invention relates to a method for decreasing ?-SMA expression in a subject, comprising administering an effective amount of a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the amino acid sequence selected from the group comprising or consisting of SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, or a nucleic acid molecule encoding thereof. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the nucleic acid sequence selected from the group comprising or consisting of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8.
[0177] Another aspect of the invention relates to an in vitro method for decreasing ?-SMA expression in a cell, or population of cells, comprising exposing the cell, or population of cells, to an effective amount of a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the amino acid sequence selected from the group comprising or consisting of SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, or a nucleic acid molecule encoding thereof. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the nucleic acid sequence selected from the group comprising or consisting of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8. In some embodiments, the cell, or population of cells, is a pre-adipocyte.
[0178] Another aspect of the invention relates to a method for decreasing collagen expression in a subject, comprising administering an effective amount of a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the amino acid sequence selected from the group comprising or consisting of SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, or a nucleic acid molecule encoding thereof. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the nucleic acid sequence selected from the group comprising or consisting of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8.
[0179] In some embodiments, collagen is selected from the group comprising or consisting of type I collagen, type II collagen, type III collagen, type V collagen and type IX collagen. In some embodiments, collagen is type I collagen. In some embodiments, the type I collagen is type I alpha 1 collagen or type I alpha 2 collagen. In some embodiments, the type I collagen is type I alpha 1 collagen, and is encoded by COL1A1 gene.
[0180] Another aspect of the invention relates to an in vitro method for decreasing collagen expression in a cell, or population of cells, comprising exposing the cell, or population of cells, to an effective amount of a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the amino acid sequence selected from the group comprising or consisting of SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4, or a nucleic acid molecule encoding thereof. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity with the nucleic acid sequence selected from the group comprising or consisting of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8. In some embodiments, the cell, or population of cells, is a pre-adipocyte.
[0181] In some embodiments, collagen is selected from the group comprising or consisting of type I collagen, type II collagen, type III collagen, type V collagen and type IX collagen. In some embodiments, collagen is type I collagen. In some embodiments, the type I collagen is type I alpha 1 collagen or type I alpha 2 collagen. In some embodiments, the type I collagen is type I alpha 1 collagen, and is encoded by COLIA1 gene.
EXAMPLES
[0182] The present invention and disclosure are further illustrated by the following examples.
Example 1
1. Materials and Methods
1.1. Study Subjects and Sample Collection
[0183] This study group consisted of 1,068 Ashkenazi Jewish (AJ) samples: 496 AJ centenarians and 572 AJ controls that were previously collected as part of longevity study at the Albert Einstein College of Medicine. A centenarian is defined as a healthy individual living independently at 95 years of age or older and a control is defined as an individual without a family history of unusual longevity; parents of controls survived to the age of 85 years or less. Informed written consent was obtained in accordance with the policy of the Committee on Clinical Investigations of the Albert Einstein College of Medicine. Genomic DNAs were extracted from blood samples and amplified using Illustra GenomiPhi V2 DNA Amplification kits (GE healthcare Life Sciences?).
1.2. Two Rounds of Targeted Sequencing
[0184] In stage 1, 301 candidate genes involved in genome maintenance were selected and sequenced in 51 centenarians and 51 controls. The complete list of 301 candidate genes is provided in Table 1.
TABLE-US-00001 TABLE 1 List of 301 genome maintenance genes sequenced in first round AATF AICDA ALKBH2 ANAPC10 ANAPC11 ANAPC13 ANAPC4 ANAPC5 ANAPC7 APC APC2 APEX1 APEX2 ATM ATMIN ATR ATRIP ATRX BARD1 BLM BRCA1 BRCA2 BRCC3 BRIP1 BTRC BUB1 C19orf40 CBL CDC16 CDC20 CDC23 ERCC8 EXO1 FAM175A FANCA FANCB FANCC FANCD2 FANCE FANCF FANCG FANCI FANCL FANCM FBXO4 FEN1 GABARAPL2 GADD45A GADD45B GTF2H1 GTF2H2 GTF2H3 GTF2H5 H2AFX HDAC9 HERC1 HERC2 HLTF HMGB1 HUS1 HUWE1 ITCH LIG1 LIG3 LIG4 LMNA MBD4 MDM2 MEN1 MGMT MGRN1 MID1 MLH1 MLH3 MNAT1 MPG MRE11A MSH2 MSH3 MSH4 MSH6 MUTYH NBN NEDD4 NEIL1 NEIL2 NEIL3 NHEJ1 NHLRC1 NTHL1 NUDT1 OGG1 PALB2 PAPD7 PARK2 PARP1 PARP2 PCNA PIAS1 PIAS4 PINX1 PML PMS1 PMS2 PNKP POLA1 POLB POLD1 POLD2 POLE POLE3 POLE4 POLG POLH POLI POLK POLL POLM POLN POLQ POT1 POU1F1 POU2F1 POU2F2 POU2F3 POU3F1 POU3F2 POU3F3 POU3F4 POU4F1 POU4F2 POU4F3 POU5F2 POU6F1 POU6F2 PPIL2 PRDX2 PRKDC PRPF19 RAD1 RAD17 RAD18 RAD21 RAD23A RAD23B RAD50 RAD51 RAD51B RAD51C RAD51D RAD52 RAD9A RAG1 RBX1 RCHY1 RECQL RECQL4 RECQL5 REV1 REV3L RFC1 RFC2 RFC3 RFC4 RFC5 RFWD2 RNF168 RNF7 RNF8 RPA1 RPA2 RPA3 RPA4 SAE1 SCARA3 SENP1 SENP2 SENP3 SENP5 SENP6 SENP7 SENP8 SIAH1 SIRT1 SIRT2 SIRT3 SIRT4 SIRT5 SIRT6 SIRT7 SKP1 SKP2 SLC25A24 SMEK1 SMUG1 STRAP STUB1 SUMO1 SUMO1P1 SUMO2 SUMO3 SUMO4 SYVN1 TBP TCEB1 TCEB2 TDG TDP1 TERF1 TERF2 TERF2IP TERT TNKS TP53 TP53BP1 TPP1 TREX1 TREX2 TRIM32 TRIP12 TXN UBA1 UBA2 UBA3 UBE2A UBE2B UBE2C UBE2D2 UBE2F UBE2G1 UBE2G2 UBE2H UBE2I UBE2J1 UBE2J2 UBE2K UBE2L3 UBE2L6 UBE2M UBE2N UBE2O UBE2Q1 UBE2S UBE2T UBE2U UBE2V2 UBE2W UBE2Z UBE3A UBE3B UBE3C UBE4A UBE4B UBOX5 UBR5 UIMC1 UNG URM1 WRN WWP1 WWP2 XAB2 XPA XPC XRCC1 XRCC2 XRCC3 XRCC4 XRCC5 XRCC6
[0185] SureSelectXT Target enrichment platform (Agilent?) was applied to design and capture genomic regions covering exons, exon-intron junctions, and 2 kb proximal promoter sequences of the candidate genome maintenance genes. Individually indexed libraries were sequenced by the Illumina? HiSeq2000. Sequencing reads were aligned using BWA and variants were called by GATK. All variants in the 102 samples were characterized and functionally annotated using ANNOVAR. To prioritize candidate genes, UMINP (Univariate minP) gene-based association with permutation (n=100) was performed, which considered the effect of at least one significant single variant and identified 122 genes showing a nominal p-value less than 0.05 (Table 2).
TABLE-US-00002 TABLE 2 List of 122 genes showing significant association with longevity in gene-based UMINP analysis Gene p-value AATF <0.01 AICDA <0.01 ANAPC11 <0.01 ANAPC5 <0.01 APC2 <0.01 APEX2 <0.01 ATM <0.01 ATRX <0.01 BARD1 <0.01 BLM <0.01 BRCA1 <0.01 BUB1 <0.01 CDC26 <0.01 CDC34 <0.01 CUL7 <0.01 DCLRE1A <0.01 DCLRE1B <0.01 DCLRE1C <0.01 DDB1 <0.01 DMC1 <0.01 E2F1 <0.01 EXO1 <0.01 FAM175A <0.01 FANCB <0.01 FANCD2 <0.01 FANCF <0.01 FANCI <0.01 FANCM <0.01 FEN1 <0.01 GADD45B <0.01 HERC2 <0.01 HMGB1 <0.01 HUS1 <0.01 HUWE1 <0.01 ITCH <0.01 LIG1 <0.01 MBD4 <0.01 MDM2 <0.01 MEN1 <0.01 MGMT <0.01 MGRN1 <0.01 MNAT1 <0.01 MPG <0.01 MRE11A <0.01 MSH3 <0.01 NEIL3 <0.01 NTHL1 <0.01 OGG1 <0.01 PALB2 <0.01 PINX1 <0.01 PMS1 <0.01 POLA1 <0.01 POLD1 <0.01 POLE <0.01 POLH <0.01 POLM <0.01 POLN <0.01 POT1 <0.01 POU2F1 <0.01 POU2F3 <0.01 POU3F3 <0.01 POU3F4 <0.01 POU4F2 <0.01 POU4F3 <0.01 POU5F2 <0.01 PPIL2 <0.01 PRKDC <0.01 RAD17 <0.01 RAD23B <0.01 RAD50 <0.01 RAD51 <0.01 RAD51D <0.01 RAD52 <0.01 RAD9A <0.01 RAG1 <0.01 RBX1 <0.01 RECQL4 <0.01 RFC5 <0.01 RNF168 <0.01 RNF8 <0.01 SAE1 <0.01 SENP1 <0.01 SENP8 <0.01 SIRT1 <0.01 SIRT2 <0.01 SIRT4 <0.01 SIRT7 <0.01 SKP2 <0.01 STRAP <0.01 SUMO1 <0.01 SUMO2 <0.01 SYVN1 <0.01 TERF2 <0.01 TNKS <0.01 TP53BP1 <0.01 TREX1 <0.01 UBA3 <0.01 UBE2B <0.01 UBE2C <0.01 UBE2J2 <0.01 UBE2O <0.01 UBE2Q1 <0.01 UBE2U <0.01 UBE2V2 <0.01 UBE2W <0.01 UBOX5 <0.01 UIMC1 <0.01 UNG <0.01 URM1 <0.01 XPA <0.01 XPC <0.01 XRCC1 <0.01 CDH1 0.01 CREBBP 0.01 PIAS4 0.01 SIRT5 0.01 ATR 0.03 SENP3 0.03 SIRT6 0.03 NBN 0.04 POU3F2 0.04 RFC4 0.04
[0186] Gene ontology (GO) enrichment analysis was implemented using the clusterProfiler package and identified the enrichment of 122 UMINP-significant genes in DNA double-strand breaks repair functions.
[0187] In stage 2, 106 candidate genes involved in DNA double-strand breaks repair were selected and sequenced in 496 centenarians and 572 controls. The list of 106 DSB repair genes is provided in Table 3.
TABLE-US-00003 TABLE 3 List of 106 DSB repair genes sequenced in second round APLF APTX ATM BABAM1 BARD1 BLM BRCA1 BRCA2 CDC7 CHEK1 CHEK2 DCLRE1A DCLRE1B DCLRE1C DDX11 DNA2 EME1 ERCC1 ERCC4 ERCC6 ERCC8 FAN1 FANCB FANCD2 FANCM GEN1 GINS2 GINS4 HELB HELQ HUS1 INO80 KAT5 LIG3 LIG4 MEIOB MGMT MLH1 MMS19 MMS22L MSH2 MUS81 NHEJ1 NIPBL NSMCE1 NUCKS1 OGG1 OTUB1 PALB2 PARP1 PARP2 PARP3 PAXIP1 PNKP POLA1 POLB POLM POLQ POT1 PRDM9 PRKDC RAD50 RAD51 RAD51AP1 RAD51AP2 RAD51B RAD51C RAD51D RAD52 RAD54B RAD54L RBBP8 REC8 RECQL RECQL5 REV3L RMI1 RMI2 RNF168 RNF8 RPA3 RTEL1 SETD2 SETMAR SETX SFR1 SIRT6 SLX4 SMARCAL1 SMC5 SPIDR SPO11 SWI5 TDP1 TDP2 TERF2IP TP53 TP53BP1 UBE2N WRAP53 WRN XRCC1 XRCC2 XRCC4 XRCC5 XRCC6
[0188] A 25-sample pooling target capture sequencing was performed. Briefly, 25 samples from the same group were pooled together for equimolar concentration and totally 20 pools of centenarians and 23 pools of controls were used to generate indexed libraries according to the Illumina? TruSeq DNA sample preparation low-throughput (LT) protocol. Captured libraries were further generated using SeqCap EZ Choice Enrichment Kit (Roche?) which enriched genomic regions covering exons, exon-intron junctions, and 2 kb proximal promoter sequences of the candidate DSB genes and sequenced by Illumina? HiSeq2000. Sequencing reads were aligned using BWA and variants were called using the software CRISP (Comprehensive Read analysis for Identification of Single Nucleotide Polymorphisms), which was specifically developed to call variants in pooled DNA sequence data. All variants in the 1,068 samples were characterized and functionally annotated using ANNOVAR. To test for longevity associations, we performed different subtypes of SKAT (Sequencing Kernel Association Test) analyses, such as SKAT for rare variants, SKAT-C for all variants (common and rare), and SKAT-O for variants with directionality (enrichment only in centenarians or in controls) (Table 4).
TABLE-US-00004 TABLE 4 List of 10 longevity-associated DSB repair genes with their centenarian-enriched missense variants (part 1) Gene SKAT-C SKAT-O SKAT PARP2 0.00142 0.01563 0.01362 RAD51B 0.0041 0.04227 0.025 SIRT6 0.03423 0.33932 0.20718 TERF2IP 0.042 0.00703 0.02925 ATM 0.04499 0.05524 0.03293 MLH1 0.06486 0.07838 0.03947 BRCA2 0.07093 0.0099 0.03295 ERCC6 0.28236 0.01455 0.01379 MMS22L 0.39608 0.04202 0.36627 TP53 0.47502 0.00147 0.00488
1.3. Cell Lines
[0189] HEK293 SIRT6 overexpression lines were generated by transfecting HEK293 cells with linearized CMV-SIRT6 plasmids via jetPRIME transfection reagent and selecting stably integrated clones. To generate normal human fibroblasts expressing WT and centenarian alleles of SIRT6 under control of cumate-inducible promoter (cumate SIRT6 fibroblasts), constructs containing SIRT6 alleles under control of cumate promoter were integrated in the genome of telomerase immortalized SIRT6-KO human HCA2 foreskin fibroblasts via the PiggyBac Transposon Vector System. Endogenous SIRT6 was knocked out in these cells using CRISPR/Cas-9. NHEJ and HR reporter assays were conducted using telomerase-immortalized HCA2 human fibroblast cell lines containing integrated reporter constructs (19A and H15C). HT1080 and HeLa cell lines were used to assess anti-tumor activity.
1.4. Cell Culture
[0190] All cell lines were maintained in humidified incubators at 5% CO.sub.2, 5% O.sub.2, at 37? C. Cells were grown in Eagle's minimum essential medium with 15% fetal bovine serum and 1? penicillin/streptomycin, with the exception of the HEK293, HT1080 and HeLa cells, which were culture in DMEM with D-Glucose and L-Glutamine. The cell lines are routinely tested for mycoplasma contamination.
1.5. Western Blotting
[0191] Cells and reactions were collected using a 2? Laemmli solution and incubated on ice for 15 min, during which time the samples were passed through a large gauge needle several times and vortexed every 5 min. Samples were then spun at 14,000 RPM to remove debris and the supernatant transferred to a new tube. Samples were heated in boiling water for 20 min before being centrifuged at 14,000 RPM for 1 min and loaded into a BioRad? Criterion 4-20% gel. After transfer to PDVF membrane and blocked (5% dehydrated milk) for 2 h at RT (room temperature), membranes were incubated overnight antibodies in 2.5% blocking buffer at 4? C. Membranes were washed 3? with TBST for 10 min each before secondary antibody in 1?TBST was added for 2 h incubation at RT. Membranes were washed 3? with TBST for 10 min and then imaged.
[0192] The following antibodies were used: H3 (Abcam? ab500)-1:5,000, H3K9ac (Abcam? ab4441)-1:1,000, H3K18ac (Abcam? ab1191)-1:1,000, ?-tubulin (Abcam? ab6046)-1:10,000, SIRT6 (Cell Signaling? #12486)-1:1,000, AbD33204 (Rabbit, REF)-1:500, Lamin A/C-1:1,000 (Abcam? ab108595, Millipore? 05-714), ?H2AX (Millipore? 05-636), PARP1(Abcam? ab227244)-1:1,000, mADPr 1:500 (AbD33204 and AbD33205).
1.6. Immunoprecipitation (IP)
[0193] Cells were plated and grown with equivalent dosages of cumate for 48 h prior to IP. In brief, cells were collected via trypsin and centrifugation and then lysed on ice using IP Buffer (20 mM HEPES pH=8, 0.2 mM EDTA, 5% glycerol, 150 mM NaCl, 1% NP40)+COMplete? protease inhibitor for 10 min. Lysate was sonicated at 25% output for 10 pulses and then debris pelleted by centrifugation at 4? C. at 13,000 RPM for 10 min. Supernatant was transferred to a new tube and precleared with A/G Sepharose beads at 4? C. for 1 h on a rotator. Beads were removed by centrifugation and transfer of cleared sample to new tubes. 50 ?l of sample was reserved as input control. Samples were incubated overnight at 4? C. with 3 ?g of antibody (SIRT6; Cell Signaling?) #12486; PARP1-Abcam? ab227244; Lamin A/C-Millipore? 05-714; AbD33204, AbD33205, then with 30 ?l of 25% Sepharose for 2 h at 4? C. Samples were spun down and beads washed 5? with IP buffer. Final resuspension with 100 ?l IP buffer.
1.7. DNA Repair Assays
[0194] Both NHEJ and HR efficiency were assessed as previously described in Seluanov et al. (J Vis Exp, 2010; doi: 10.3791/2002). In brief, I-Scel, SIRT6 or HPRT control, and dsRED plasmid were transfected into telomerase-immortalized human foreskin fibroblasts containing chromosomally integrated NHEJ or HR reporter cassettes (19A or H15C) cells. Cells were allowed 3 days to recover prior to analysis by flow cytometry. Efficiency was calculated as the ratio of GFP events over dsRED events.
1.8. Transfections
[0195] Transfections were carried out by plating cells at a density of 500,000 cells/10 cm plate two days prior to transfection. Transfections were carried out using the Amaxa? Nucleofector with Normal Human Dermal Fibroblast transfection solution following manufacture's protocol. For cancer cell transfections, jetPRIME transfection reagent was used to deliver plasmids into cells.
1.9. Quantitative RT-PCR
[0196] Total RNA was isolated from cells at 80% confluence using Trizol Reagent and then treated with DNase. cDNA was synthesized using Superscript III (Life Technologies?) cDNA kit with the OligodT primer. qRT-PCR was performed on the BioRad? CFX Connect Real Time machine with SYBR? Green Master Mix (BioRad?) using 30 ng of cDNA per reaction with 3? reactions/sample. All primer sets (see Table 5 below) were tested for specificity and efficiency. Actin was assayed using Quantum mRNA Actin Universal primers (Thermo Fisher Scientific? AM1720).
TABLE-US-00005 TABLE5 PrimersusedfortheqRT-PCR Primername Sequence SEQIDNO: LINE1ORF1Fwd ATGGCGAAAGGCAAACGTAAG SEQIDNO:9 LINE1ORF1Rev ATTTTCGGTTGTGTTGGGGTG SEQIDNO:10 LINE1ORF2Fwd GCAGGGGTTGCAATCCTAGTC SEQIDNO:11 LINE1ORF2Rev CTGGGTGCTCCTGTATTGGGT SEQIDNO:12
1.10. Immunofluorescence and Apoptosis
[0197] ?H2AX immunostaining was carried out as previously described in Mao et al. (Science, 2011; Vol. 332:1443-1446). Anti-?H2AX antibody was purchased from Millipore? (05-636). Apoptosis in fibroblasts was measured using the Annexin V Staining Kit (Roche?).
1.11. Gamma Irradiation
[0198] Cells were grown to 75% confluency prior to treatment on coated slides. A Cs-137 irradiator was used to deliver 2 Gy of radiation to cells. Cells were transported in a 37? C. container and media were replaced post exposure.
1.12. Paraquat Treatment
[0199] Cells were maintained to 75% confluency, at which point fresh media lacking sodium pyruvate and containing paraquat was added. Cells were maintained for 24 h in treated media, followed by replacement with fresh media lacking sodium pyruvate. 48 h post treatment, the cells stained and evaluated for apoptosis.
1.13. SIRT6 Protein Purification
[0200] His-tagged SIRT6 cDNA was cloned into pET11a vectors and transformed into Rosetta-Gami E. coli cells. Cells were grown in presence of antibiotics and then protein production was induced with 0.5 mM IPTG 2 h before harvest. Cells were spun down and lysed on ice for 1 h using a in a solution of 50 mM Tris-HCl (pH=7.5), 300 mM NaCl, 10% glycerol, and 10 mM imidazole with EDTA-free protease inhibitor (Sigma Aldrich?, #P8849) and 1 mg/ml egg white lysozyme followed by sonication with a Branson instrument. After removal of cell debris by centrifugation, lysate was incubated with Ni2+-NTA agarose overnight. Solution with beads was placed in gravity column and washed with lysis solution, followed by 2 volumes of wash buffer (lysis buffer+30 mM imidazole). Finally, protein was eluted with elution buffer (lysis buffer+500 mM imidazole) and fractions were collected. Protein concentration was assessed by bicinchoninic acid (BCA) assay and run on an SDS-page gel. The 3-4 highest concentration fractions were pooled and dialyzed against storage buffer (50 mM Tris-HCl pH=7.5, 150 mM NaCl, 1 mM DTT, 5% glycerol).
1.14. Stable Isotope Labeling of Amino Acids in Cell Culture (SILAC)
[0201] Turnover experiments were performed using HEK293 cell lines stably expressing SIRT6 WT or centSIRT6. Cells were cultured for one week until confluent in MEM for SILAC (Thermo Fisher Scientific?) supplemented with 10% dialyzed FBS (Gibco?), L-glutamine, L-arginine .sup.13C.sub.6 .sup.15N.sub.4 (Cambridge Isotopes?), and L-lysine .sup.13C.sub.6 .sup.15 N.sub.2 (Cambridge Isotopes?). The media were changed to normal culture medium and cell pellets were harvested at 0, 2, 4, 6, 8, 12, and 24 h post-media change. Cell pellets were lysed in buffer containing 8 M urea, 75 mM NaCl, 50 mM Tris, pH 8.5, with protease inhibitor cocktail (Roche?). Pellets were vortexed for 30 s and sonicated 5?10 s with 1 min rest on ice in between sonication steps. Lysate was centrifuged at 15,000?g for 10 min and then supernatant was collected.
1.15. SIRT6 Deacylation Activity
[0202] The substrate for this reaction is a synthetic TNF-derived peptide first developed by Schuster et al. (Sci Rep, 2016; Vol. 6:22643) was synthesized by Genscript?. Reactions were performed with 150 mM NaCl, 20 mM Tris, 5% glycerol, 1 mM ?-mercaptoethanol, 2 ?M SIRT6, and substrate concentration ranges of 7-1000 ?M NAD+ and 2-88 UM peptide. Reactions were performed at 37? C. and fluorescence was measured using 310/405 nm excitation/emission spectra on a Tecan Spark 20M plate reader. Readings were taken every 30 s and initial rates were calculated from the relative fluorescence increase over a minimum of 6 min.
1.16. Histone Analysis
[0203] Histones were purified from cumate SIRT6 fibroblasts (SIRT6 KO primary human foreskin fibroblasts constitutively expressing the catalytic subunit of telomerase as well as various alleles of SIRT6 via a cumate-inducible promoter) using an established acid extraction method followed by propionylation of lysines prior to trypsin digestion to enhance coverage. A data independent analysis (DIA) mass spectrometry (MS) method was employed for quantitation of modified peptides after samples were separated by nano-LC using EpiProfile? or, alternatively, after direct infusion followed by a one-minute acquisition and analysis with EpiProfileLite?.
1.17. Analysis of SIRT6 and LMNA Protein-Protein Interactions by Mass Spec
[0204] Cumate SIRT6 fibroblasts were used to compare interactomes for centSIRT6 and the wild type SIRT6. Nuclear extracts were prepared using hypotonic lysis buffer. Nuclei isolated from approximately 2.5?10.sup.7 cells were resuspended in 1 ml of extraction buffer (50 mM TrisHCl pH 7.5, 150 mM NaCl, 10% glycerol, 5 mM DTT, 0.25% NP-40, 1? Roche? Complete protease inhibitors, as well as kinase/phosphatase inhibitors-1 mM NaVO.sub.4, 10 mM beta-glycerophosphate, 1 mM sodium pyrophosphate, 1 mM NaF) and nuclei were disrupted by passage through a 27-gauge needle followed by sonication (3 pulses at constant 20% power) with a Branson? Sonifier on ice. Next, samples were filtered through 0.2 ?m MWCO filter to remove any insoluble material (and reduce non-specific binding). Proteins were quantified using the BCA assay and equal amount of wild type SIRT6 and centSIRT6 derived extract were divided into 5 replicates each. Three replicates of extract received 4 ?g of anti-SIRT6 antibody (Cell Signaling? #1248) or anti-LaminA (Lamin A/C-Millipore? 05-714) and 75 ?l of Miltenyi? protein G uMACS magnetic particles. Two of the replicates were mixed with normal rabbit IgG (Cell Signaling? #2729) as controls for non-specific binding to the particles. Samples were rotated at 4? C. for 6 h followed by separation by the magnet. Samples were washed with 3 additional ml of extraction buffer and eluted with 100 ?l of boiling elution buffer (5% SDS with 50 mM Tris-HCl pH 7.5). After removal of SDS with S-columns (Protifi?; Huntington, NY) and trypsin digestion, peptides were resuspended in MS-grade water and labeled with tandem mass tags (TMT 10-plex; Thermo Fisher Scientific?). Samples were resolved by nano-electrospray ionization on an Orbitrap Fusion Lumos MS instrument (Thermo Fisher Scientific?) in positive ion mode using a 30 cm home-made column packed with 1.8 ?m C-18 beads to resolve the peptides. Solvent A was 0.1% formic acid and solvent B was 100% acetonitrile (CAN) with 0.1% formic acid. The length of the run was 2 h with a 90 min gradient. CID (35% collision energy) was used for MS2 fragmentation. HCD (60% collision energy) was used for MS3 detection of TMT groups. Other details of the run parameters may be found in the embedded run report of the RAW data file uploaded to the ProteomeXchange database. Peptide assignments were made using Proteome Discoverer and Sequest and MS3 ions were used for quantitation. False discovery rates (FDR) were estimated using a Decoy Database Search with Target FDR (strict) set to 0.01 and Target FDR (relaxed) set to 0.05. Validation was based on q-value. In the consensus step, ions with a co-isolation threshold above 30% were excluded. Normalization between replicates was achieved using the total protein approach where peptide counts for a single protein were divided by the sum of all proteins in the lane. Proteins appearing in specific antibodies (either anti-SIRT6 or anti-Lamin A) compared to normal IgG serum with Student t-test p<0.05) were considered as interactions. Similarly, proteins showing higher levels in centSIRT6 versus wild type SIRT6 were based upon p<0.05.
1.18. SIRT6-NAD+ Binding by Tryptophan Fluorescence
[0205] 1 ?M of SIRT6 protein in 50 ?l of buffer (50 mM Tris-HCl pH=7.5 and 150 mM NaCl) was combined with a range of NAD+(0-2 mM). Samples were then placed in a 384 Corning? Flat Black plate and analyzed in a Tecan Spark? 20M plate reader. Fluorescence was measured across 300-400 nm range in 2 nm steps using a 280 nm excitation. Background quenching by NAD+ of SIRT6 denatured by 7 M urea was subtracted from the spectra as described previously in Pan et al. (J Phys Chem B, 2011; Vol. 115:3245-3253).
1.19. Deacetylase Assay
[0206] 3 ?g of SIRT6 protein was combined with 0.5 ?g histones, 1 or 5 mM NAD+, 30 mM Tris-HCl pH=8, 4 mM MgCl.sub.2, 1 mM DTT and ddH.sub.2O up to 50 ?l. All reagents were prepared on ice and moved to 37? C. for the duration of the incubation. Reaction was quenched with direct application of 1 volume of 2? Laemmli buffer with BME. Samples were boiled for 15 min before being run in Western analysis using anti-H3K9ac and anti-H3K18ac antibodies.
1.20. PARP1 Ribosylase Assay
[0207] 5 ?g of SIRT6 protein was combined with 100 fm PARP1, 20 mM Tris-HCl pH=8, 10 ?M ZnCl.sub.2, 10 ?M MgCl.sub.2, 10% glycerol, 300 ?M NAD+, 1 mM DTT, 0.1 ?g/ml salmon sperm DNA and ddH.sub.2O up to 50 ?l. All reagents were prepared on ice and moved to 30? C. for 30 min. Reaction was quenched with direct application of 1 volume of 2? Laemmli buffer with BME. Samples were boiled for 15 min before being run in Western analysis using anti-PADPR antibody.
1.21. Self-Ribosylation Assay
[0208] Three ?g of SIRT6 was combined with 50 mM Tris-HCl pH=7.5, 1 mM DTT, 10 ?M ZnCl.sub.2, 150 mM NaCl, 25 ?M NAD+, 1 ?l [32P]-NAD+(800 Ci/mmol, 5m Ci/ml; Perkin Elmer? BLU023x250UC) and ddH.sub.2O up to 20 ?l. All reagents were combined on ice in a master mix except for SIRT6. Master mix was aliquoted into reaction tubes and SIRT6 was added and incubated at 37? C. for 3 h. Reaction were quenched with 1 volume of 2? Laemmli buffer with BME. Samples were boiled and then run on SDS-PAGE gel and then transferred to PDPF membrane. Self-ribosylation was assayed using phosphoimager.
1.22. Thermostability
[0209] 4 ?M SIRT6 protein was combined with 1? SYPRO? Orange dye in storage buffer (50 mM Tris-HCl pH=7.5, 150 mM NaCl, 1 mM DTT, 5% glycerol) to 50 ?l. Samples were placed in qRT-PCR plate and run on a BioRad? CFX Connect Real Time machine using a Melt Curve protocol (30? C.-75? C., 0.5? C. steps in 10 s intervals).
1.23. FRET
[0210] Mutagenesis to generate the centenarian mutant (N308K/A313S) was performed using NEB Q5 site-directed mutagenesis kit, following protocols for primer design.
[0211] HEK293-6E cells were transfected using 293fectin? reagent according to the manufacturer's instructions (Thermo Fisher Scientific?). The SIRT6 biosensors were expressed using mammalian expression vector pTT5 (National Research Council, Canada). After two days in culture, approximately 30 million were produced, generating transiently transfected cell lines expressing the biosensor at high levels. The cell line was maintained using F17 medium (Sigma Aldrich?)+(200 nM/mL) GlutaMAX?.
[0212] On each day of FRET assays, approximately 30 million cells from each transfection were harvested, washed three times in PBS with no Mg or Ca (Thermo Fischer Scientific?; Waltham, MA) by centrifugation at 300?g, filtered using 70-?m cell strainers (Corning?; Corning, NY), and diluted to 1-2 million cells/mL using a Countess? Automated cell counter (Invitrogen?; Carlsbad, CA). On each day of experiments, cell viability was assessed using the trypan blue assay. After resuspension and dilution in PBS, the cells were continuously and gently stirred with a magnetic bar at room temperature to keep the cells in suspension and prevent clumping.
[0213] An in-depth description of the fluorescence instrumentation has been published previously in Schaaf et al. (SLAS Discov, 2017; Vol. 22:262-273). For FLT measurements, the observed fluorescence waveform was convolved with the instrument response function to determine F(t) (Equation 1), the average energy transfer efficiency E was calculated from the average FLTs of donor ID and donor-acceptor, IDA, using Equation 2, and the donor-acceptor distance R was calculated using Equation 3.
1.24. Quantification and Statistical Analysis
[0214] Unless otherwise noted, the Student's t-test was used to determine statistical significance between groups. All tests were two-tailed and p-values were considered significant below a 0.05 threshold. Cell culture experiments utilized at least two separately derived cell lines for each genotype and were performed in triplicate unless noted otherwise. In vitro assays were done in triplicate using two or more separate protein isolation preps.
Results
[0215] While there is evidence that genome maintenance (GM) is a major longevity assurance system, with genetic defects in GM genes leading to reduced life span and premature ageing in humans and mice and a correlation of more efficient DNA repair with longer maximum lifespan across animal species, the role of GM in human extreme longevity has never been systematically studied.
[0216] To investigate whether GM plays a role in human extreme longevity, a panel of 301 genome maintenance genes (Table 1) in pathways including nucleotide excision repair (NER), base excision repair (BER), mismatch repair (MMR), homologous recombination (HR), non-homologous end-joining (NHEJ), telomere maintenance, and genes involved in the regulation of these pathways, was assembled.
[0217] Two rounds of targeted sequencing were then performed to identify rare variants in these genes in DNA from peripheral blood of Ashkenazi Jewish (AJ) centenarians and AJ individuals between 60 and 70, unrelated to the probands and without centenarian relatives (
[0218] SIRT6, a gene functionally related not only to DSB repair but also to longevity in model organisms was especially interesting. SIRT6 knockout mice show premature ageing and genomic instability whereas mice overexpressing SIRT6 display an extended lifespan (see Mostoslavsky et al.; Cell, 2006; Vol. 124:315-329). Higher SIRT6 activity is associated with more efficient DSB repair and longer maximum lifespan across mammalian species. At the molecular level, SIRT6 is involved in DNA repair, telomere maintenance, silencing of the repetitive elements including LINE1 retrotransposons, regulation of glucose homeostasis, inflammation and pluripotency, and tumor suppression.
[0219] The SIRT6 allele found enriched in centenarians contained two missense mutations within the highly flexible C-terminus, converting a polar asparagine 308 to a charged lysine (N308K) and a hydrophobic alanine 313 to a polar serine (A313S). Genotyping in centenarian carriers confirmed that these two SIRT6 variants occurred as linked double variants, which we named centSIRT6. This allele was very rare (minor allele frequency of 0.001%) in the whole exome sequence data of 50,726 adult participants of predominantly European ancestry in the Geisinger Health System. It was next tested whether centenarian SIRT6 allele alters the biological activities of SIRT6 protein.
[0220] SILAC analysis of HEK293 cells expressing different SIRT6 alleles showed no difference in the protein turnover rates between the WT and centSIRT6 (
[0221] SIRT6 deacylase activity was tested on a myristolated peptide to determine Km for NAD+ and peptide for wild type and centSIRT6. While the centenarian allele displayed a slight reduction in activity (Vmax) compared to the wild type (p=0.02) (
TABLE-US-00006 TABLE 6 Kinetic parameters Km and Vmax Km.sub.NAD (?M) Km.sub.PEP (?M) Vmax (RFU/S Vmax/Km.sub.PEP WT 55.5 ? 5.4 61.1 ? 12.4 37.2 ? 4.1 0.61 Cent 48.4 ? 3.7 46.0 ? 11.3 24.3 ? 2.9 0.53
[0222] Quenching of SIRT6 intrinsic Trp fluorescence by NAD+ binding also showed that centSIRT6 has similar affinity for NAD+ to the wild type allele (
[0223] The centSIRT6 displayed significantly lower deacetylase activity on recombinant nucleosomes with saturated H3K9ac and H3K18ac modifications (
[0224] To test the effect of the centSIRT6 allele on histone deacetylation activity in vivo, telomerase-immortalized human HCA2 fibroblast cell lines were generated in a SIRT6 KO background containing a cumate switch promoter driving expression of SIRT6 WT, N308K, A313S, and the centSIRT6 alleles (cumate SIRT6 fibroblasts). Each cell line was induced with cumate to drive equal levels of SIRT6 expression (
[0225] In addition to its deacetylase activity, SIRT6 has mono-ADP ribosylation (mADPr) activity, able to mono-ADP ribosylate itself and other proteins. mADPr activity is critical to SIRT6 role in DNA damage response and LINE1 repression. To assess the mADPr activity, two known SIRT6 substrates were used: PARP1 and SIRT6, itself. The centSIRT6 demonstrated a significantly higher auto-ribosylation rate with radio labeled NAD+ than the wild type SIRT6 (
[0226] The loss of silencing of these elements contributes to age-related sterile inflammation and drives progeroid phenotypes in SIRT6 KO mice. To assess the capacity of the centSIRT6 allele to silence LINE1 transposons, the cumate-inducible fibroblasts expressing alleles of SIRT6 were used. qRT-PCR analysis of both 5-and 3-biased regions of an evolutionarily active family of LINEIs both showed that the centSIRT6 allele enhances LINE1 suppression compared to the wild type SIRT6, as did the N308K allele (
[0227] To quantify the differences between the SIRT6 alleles at promoting DSB repair, in vivo GFP-based assays that measure nonhomologous end joining (NHEJ) and homologous recombination (HR) repair of a chromosomal DSB induced by I-Scel enzyme were employed. Different alleles of SIRT6 were transiently expressed in the NHEJ and HR reporter telomerase-immortalized human foreskin fibroblast cell lines. It was found that equivalent amounts of the centSIRT6 stimulated NHEJ and HR 2.5-fold and 2-fold greater respectively, than the wild type SIRT6 (
[0228] It was next compared whether different SIRT6 alleles have different effects upon stress. Using the cumate SIRT6 fibroblasts, the cells were exposed to ?-radiation and the resolution of DSBs was assessed over time via ?H2AX immunostaining. It was observed that, while both wild type and centSIRT6-expressing cell lines had similar levels of ?H2AX foci immediately after exposure, the centSIRT6-expressing cells showed an improved recovery rate (
[0229] To further confirm that centSIRT6 enhances genome maintenance, a knock-in human embryonic stem cells carrying centSIRT6 allele was generated. The two centenarian mutations were introduced using CRISPR CAS9, and confirmed by sequencing. Two independent knock-in clones were generated and differentiated into MSCs. The MSCs were then transfected with linearized NHEJ and HR GFP reporters. Cells harboring centSIRT6 allele showed higher efficiency of repair (
[0230] In order to assess the tumor cell killing capacity of the centSIRT6 allele, SIRT6 alleles were transfected into two common tumor cell lines, HT1080 fibrosarcoma cells and HeLa cells. The centSIRT6 showed ?2-fold fewer adherent surviving cells in both cancer cell lines (
[0231] Since the centSIRT6 mutations are located in the flexible C-terminus of SIRT6 and may influence protein-protein interactions, the interactomes of the centSIRT6 and the wild type alleles were compared. Antibodies against SIRT6 were used to immuno-precipitate SIRT6-interacting proteins from cumate SIRT6 fibroblasts and to analyze them by mass spectrometry with tandem-mass tags (TMT) to permit accurate quantitation. Several interacting proteins were enriched by the centSIRT6 allele (Table 7).
TABLE-US-00007 TABLE 7 Proteins showing stronger interaction with centSIRT6 compared to the wild type SIRT6. Name Description Peptides p value RBP56 TATA-binding protein-associated 5 0.0002 factor 2N LMNA Prelamin-A/C 38 0.0025 RL35 60S ribosomal protein L35 4 0.0056 CEBPB CCAAT/enhancer-binding protein 1 0.0119 beta VIME Vimentin 40 0.0188 NUMA1 Nuclear mitotic apparatus protein 1 2 0.0227 NOL6 Nucleolar protein 6 2 0.0250 FRG1 Protein FRG1 2 0.0336 A0A0B4J2E5 Uncharacterized protein 3 0.0354 PHRF1 PHD/RING finger domain-containing 3 0.0445 protein 1 H15 Histone H1.5 11 0.0516 H31 Histone H3.1 3 0.0534 NOL10 Nucleolar protein 10 1 0.0581
[0232] Proteins were prepared from cumate-induced SIRT6 cell lines and immuno-precipitated with SIRT6 antibody; rabbit pre-immune serum was used as a control. Prior to analysis by mass spectrometry, samples were labeled with tandem-mass tags.
[0233] Most notable proteins showing stronger interaction with centSIRT6 than the wild type SIRT6 were LMNA and vimentin (VIME), which showed 38 and 40 peptides respectively. Both of these proteins are known to interact with SIRT6, and LMNA was shown to stimulate SIRT6 activity. No loss or gain of interactions was apparent in the centSIRT6 set, indicating that the effect of the novel allele could be in enhancing existing SIRT6 functions.
[0234] LMNA is a nuclear scaffold protein playing a central role in nuclear organization and is also implicated in ageing. Aberrant processing of LMNA results in human premature ageing syndrome, Hutchison Gilford Progeria, while LMNA SNPs have been identified in human centenarians. Fibroblasts isolated from centenarians were also shown to have increased levels of pre-LMNA, suggesting that modulated functions of LMNA are associated with both premature ageing and exceptional longevity. To confirm the mass spec data on SIRT6 and LMNA interactions, co-IP were performed with SIRT6 antibodies followed by Western blot with LMNA antibodies using cumate SIRT6 fibroblasts. It was found that centSIRT6, indeed, associates more strongly with LMNA than the wild type SIRT6 allele (
[0235] Given the enhanced mADPr activity of the centSIRT6 allele, it was next assessed the ribosylation status of LMNA using the mADPr antibodies. SIRT6 IPs performed on the cumate SIRT6 fibroblasts, using the mADPr specific antibody, showed that centSIRT6 was more ribosylated in vivo (
[0236] It was hypothesized that the centSIRT6 allele may influence the interaction of LMNA with other proteins. To test this, LMNA from the cumate fibroblasts expressing either the wild type SIRT6 or centSIRT6 alleles were immuno-precipitated and quantitative protein interaction analysis using TMT labeling followed by mass spectrometry were performed. While many proteins showed similar interaction with LMNA, regardless of the SIRT6 allele present, a large group of proteins showed enhanced interaction with LMNA in the presence of centSIRT6 (
DISCUSSION
[0237] The discovery of beneficial SIRT6 mutations associated with enhanced mADPr activity in a centenarian cohort suggests that increased SIRT6 activity benefits human longevity. While increased SIRT6 activity correlates with longer lifespan in model organisms, it has not been clear which of SIRT6's enzymatic activities are central to longevity. Interestingly, loss of SIRT6 deacetylation activity in humans or SIRT6 knockout in monkeys lead to severe developmental phenotypes rather than premature ageing, suggesting that, at least in primates, deacetylation activity of SIRT6 is required for development but not necessarily for adult longevity. The change in the balance of deacetylation and mADPr enzymatic activities leads to enhanced function of SIRT6 in DNA repair, LINE1 suppression and cancer cell killing, which require mADPr activity. The centSIRT6 variant also shows enhanced binding to LMNA which may further promote its function in DNA repair and chromatin organization via direct stimulation of SIRT6 enzymatic activity, and by coordinating interactions of LMNA with other components of the LMNA complex.
Example 2
Materials and Methods
Cell Culture
[0238] 3T3-L1, LX2, HepG2, Hep3B (all purchased from American Type Culture Collection-ATCC, Manassas) and WSF (purchased from The Coriell Institute for Medical Research, NJ) cells were grown in basal media cosnsisting of high glucose (4.5 g/l) DMEM (LM-D1108/500, Biosera) supplemented with 10% bovine fetal calf serum (F9665, Sigma-Aldrich), 15 mM hepes buffer (L0180, Biowest), GlutaMAX? Supplement (100x, 35050-038, Gibco), 100 U/ml penicillin and 100 mg/ml streptomycin solution (L0022, Biowest), 100 nM sodium pyruvate (11360, Gibco) and non-essential amino acids (NEAA 11140, 100x, Gibco) in 5% CO2/humidified atmosphere at 37? C. The medium was routinely changed every 2 days and the cells were sub-cultured using TrypLE Express (1x, Gibco) when reaching 90% confluence.
[0239] IHH cells were purchased from American Type Culture Collection (ATCC, Manassas, VA) and cultured in Williams E medium (12551032, Gibco) containing 2 g/l glucose and supplemented with 10% fetal calf serum, 100 U/ml penicillin and 100 ?g/ml streptomycin solution, 20 mU/ml insulin and 50 nM dexamethasone in 5% CO2/humidified atmosphere at 37? C. The cell culture medium was changed every 2 days and the cells were sub-cultured using TrypLE Express when reaching 90% confluence.
[0240] For the purpose of microscopy analyses, all appropriate cell lines were seeded on glass coverslips coated with 0.2% gelatin with no further modification of standard cultivation protocols. For the evaluation of the effect of SIRT6 variants and their overexpression on tissue fibrosis, appropriate cell lines were treated or not with recombinant TGF-?1 protein (100-21C, Peprotech, US), as a potent inductor of fibrotic process, at concentration of 10 and 20 ng/ml.
Lentivirus Infection and Establishing SIRT6 Cell Lines
[0241] The cells, after reaching confluence, were split and seeded into 24-well plate with growth surface area of 2 cm.sup.2, where 50?10.sup.4 cells per well were seeded. Immediately after seeding, cells were infected with Lentivirus containing SIRT6 constructs: LV2-EMPTY-IresKat2S, LV2-SIRT6(wt)-IresKat2S, LV2-SIRT6(N308K)-IresKat2S and LV2-SIRT6(centSIRT6)-IresKat2S, in basal DMEM media supplemented with 4 ?g/mL polybrene transfection reagent (TR-1003, Sigma-Aldrich) with MOI of 1-2. Cells were cultivated with Lentivaral constructs for the period of 24 hours, then the fresh medium was added and cells were cultivated for another 48 hours. Then the cells were treated with selection media comprising of basal DMEM media with 500 ?g/mL of hygromycin (H3274, Merck) for the period of 5 days (every other day the media was changed for the fresh one). After selection, remaining cells were expanded and checked for the presence of fluorescent Kat2S signal by fluorescence microscope ex/em 588/635. SIRT6 overexpression was confirmed by western-blotting.
3T3-L1 Differentiation to Adipocytes
[0242] Differentiation of 3T3-L1 adipocytes was induced 2 days post-seeding at 100% confluence by incubating cells for the period of 72 hours in differentiation media consisting of standard basal high-glucose DMEM media additionally supplemented with 500 ?M IBMX (15879, Sigma-Aldrich), 1 ?M rosiglitazone (15879, Sigma-Aldrich), 250 nM dexamethasone (D4902, Sigma-Aldrich), 10 nM 3,3,5-Triiodo-L-thyronine (T6397, Sigma-Aldrich), 17 ?M D-Pantothenic acid (21210, Sigma-Aldrich), 10 ?g/ml human transferrin (T8158, Sigma-Aldrich) and 1 ?g/ml insulin (19278, Sigma-Aldrich). Then the cells are kept in the maintenance media consisting of basal high-glucose DMEM media supplemented only with 25 nM dexamethasone and 0.1 ?g/ml insulin for the period of at least 4 days. Adipogenic differentiation and/or accumulation of intracellular lipids was evaluated using fluorescence labeling by BODIPY dye (1 ?g/ml) for 30 minutes (ex/em 493/503) and DAPI counterstain 1 ?g/mL for 30 min. Fluorescence was then captured by Agilent BioTek FLx800 Microplate Fluorescence Reader equipped with appropriate excitation/emission filters.
Cell Viability Assay
[0243] Cells were seeded into 96-well plates at 2000 viable cells per well and after 24, 48 and 72 hours, the culture media was removed and replace with medium containing Hoechst dyes at 1 ?g/mL for nuclear staining. After 20 minutes of incubation at 37? C., the cells were twice washed with PBS and the fluorescence signal was measured with Agilent BioTek FLx800 Microplate Fluorescence Reader at ex/em 355/488 nm. The ratio between the signal at different time points and TO was used as relative percentage of viable cells.
Gene Expression Measurement
[0244] Genomic RNA was isolated by column separation techniques using an RNeasy mini Kit (74106, Qiagen, Germany), according to manufacturer's instructions. At least 4 biological replicates were prepared for each treatment group. After quantification of isolated total RNA on NanoDrop 1000 spectrophotometer (ThermoFisher Scientific), 1 ?g of total isolated RNA was used to prepare cDNA using a High-Capacity cDNA Reverse Transcription Kit (4368814, ThermoFisher Scientific). Real Time-PCR was performed in at least two technical replicates using a StepOnePlus? Real-Time PCR System (Applied Biosystems) and SYBR? Select Master Mix (4472908, ThermoFisher Scientific). The PCR reaction was held in 10 ?l volume and 250 ng cDNA per well was used as the input quantity. The primer sequences used in this study are listed in Table 8.
TABLE-US-00008 TABLE8 Primersequencesusedinthestudy Gene Sequence(5-3) SEQIDNO: ?SMA F AAAAGACAGCTACGTGGGTGA 13 R GCCATGTTCTATCGGGTACTTC 14 COL1A1 F GTGCGATGACGTGATCTGTGA 15 R CGGTGGTTTCTTGGTCGGT 16 TIMP1 F ACCACCTTATACCAGCGTTATGA 17 R GGTGTAGACGAACCGGATGTC 18 VIMENTIN F AGTCCACTGAGTACCGGAGAC 19 R CATTTCACGCATCTGGCGTTC 20 MMP2 F TACAGGATCATTGGCTACACACC 21 R GGTCACATCGCTCCAGACT 22 GAPDH F GGTGCGTGCCCAGTTGA 23 R TACTTTCTCCCCGCTTTTT 24 Actin? F CATGTACGTTGCTATCCAGGC 25 R CTCCTTAATGTCACGCACGAT 26
Telomere Length
[0245] Quantitative RT-PCR was used to determine changes in average telomere length of LV transfected WSF cells and untreated WSF based on ScienCell's Relative Human Telomere Length Quantification qPCR Assay Kit (#8909). The kit directly compares the average telomere length of the samples. The telomere primer set recognizes and amplifies telomere sequences. The single copy reference (SCR) primer set recognizes and amplifies a 100 bp-long region on human chromosome 17, and serves as reference for data normalization. The carefully designed primers ensure: (i) high efficiency for trustworthy quantification; and (ii) no non-specific amplification. Each primer set has been validated by qPCR with melt curve analysis and gel electrophoresis for amplification specificity and by template serial dilution for amplification efficiency. Genomic DNA (gDNA) was isolated from using the Qiagen DNA Isolation Kit (Qiagen, Hilden, Germany). Each PCR reaction contained genomic DNA sample (0.01 ?g/?L), telomere primer, 2? qPCR master mix, and nuclease-free water. Primer-probe real-time PCR was performed using StepOnePlus? Real-Time PCR System (Applied Biosystems). All reactions were performed in duplicate, and template controls were included in each run. Amplification was performed under the following conditions: denaturation for 10 min at 95? C. followed by 32 cycles of denaturation for 20 sec at 95? C., annealing for 20 sec at 52? C., and extension for 45 sec at 72? C. The average telomere length was calculated by following the manufacturer's instructions.
Quantification of Telomerase Activity
[0246] Relative telomerase activity of LV WSF transfected cell lines and normal WSF cells was assessed by qPCR in StepOnePlus? Real-Time PCR System (Applied Biosystems) using SYBR? Green assay kits (ScienCell's Telomerase Activity Quantification qPCR Assay Kit [TAQ], Carlsbad, CA, USA) following the recommendations of the manufacturers. Three million cells were harvested for each sample. For each experiment, two controls were used: a negative telomerase and positive cell lysates (Cat #8928e). PCR was performed in a final volume of 20 ?L using 1 ?L of post-telomerase reaction sample, 2 ?L of TPS, 10 ?L of 2? qPCR FastStart Essential Green Master Mix (Roche Diagnostics International) and 7 ?L of nuclease-free water. The PCR conditions were as follows: 95? C. for 10 min followed by 36 cycles of: 95? C. for 20 sec, 52? C. for 20 sec and 72? C. for 45 sec. All reactions were run in three replicates. Data analysis was conducted according to manufacturer's instructions.
Immunoblotting Analyses
[0247] Cells were harvested from cultivation plates using TrypLE Express, washed with 1?PBS and centrifuged at 300 g. After discarding supernatant, obtained pellet was resuspended 1? Rippa lysis buffer (20-188, Millipore, USA) supplemented with Halt? Protease and Phosphatase Inhibitor Cocktail (100X, Thermo Fisher) and lysed on ice (4? C.) for 30 minutes with vigorous vertexing every 10 min. After spinning at 10 000 g for 10 min, supernatant was moved to new vial and concentration of protein was measured by Pierce? BCA Protein Assay Kit (23225, Thermo Fisher) according to manufacturer's instruction. Equal amount of protein sample (at least 20 ?g) was mixed with 1? Laemmli Sample buffer (1610747, 4x, Bio-Rad) and after boiling at 95? C. for 5 min and cooling on ice, equal volume of proteins (40 ?l) was loaded on 10% Mini-PROTEAN? TGX Stain-Free? Protein Gels (4568034, Bio-Rad) and separated by electrophoresis running at 120 volts for 45 minutes. Protein transfer was performed on PVDF membranes using Trans-Blot Turbo RTA Mini 0.45 ?m LF PVDF Transfer Kit (1704274, Bio-Rad) and Bio-Rad Trans-Blot Turbo Transfer System at 1.3 A and 25 V for 10 min. Membranes were then blocked with 5% bovine serum albumin (BSA, P6154, BioWest) dissolved in TBST buffer (20 mM Tris-HCl, pH 7.6, 140 mM NaCl, 0.1% Tween 20) for at least 30 minutes and incubated with the specific primary antibodies (see below) diluted in TBST blocking solution, at appropriate dilutions. Following three washes in TBST buffer, membranes were incubated with a secondary antibody conjugated with horseradish peroxidase diluted in TBST blocking buffer. After three further washes with TBST, proteins were revealed by Clarity Western ECL Substrate (1705061, Bio-Rad) and the signal detected on Bio-Rad ChemiDoc XRS+ imaging systems. For quantitative measurement, the scanned membranes were analyzed using the Image Lab? Software (Bio-Rad).
[0248] Antibodies used in this study: Cell Signaling Technology (MA, USA)-rabbit anti-Akt (1:1000), rabbit anti-Phospho-Akt (Ser473) (1:1000), rabbit anti Vimentin (1:1000), rabbit anti Histone H3 (D1H2, 1:1000), Abcam (UK)-mouse anti-?-actin HRP conjugated antibody (AC-15; 1:2000), mouse anti-GAPDH monoclonal HRP conjugated antibody (1:2000), rabbit anti Collagen I (1:1000), rabbit anti aSMA (1:1000), rabbit anti SIRT6 antibody (1:1000, EPR18463), ThermoFischer Scientific (CA, USA)-mouse IgG1 GAPDH monoclonal HRP conjugated antibody (1:2000), secondary goat Anti-rabbit IgG HRP-linked (1:2000);
3D Spheroid Culture
[0249] For the generation of the cell spheroids, cells were seeded into BIOFLOAT? 96-well round bottom ultra-low attachment plates for cell culture at 10000 viable cells per well. Each IHH LV transfect cell line (CTL/EMPTY, WT, N308K and centSIRT6) was co-cultured with either normal LX2 or overexpressing centSirt6 LX2 cells with 20:1 ratio, to reproduce the physiological proportion in the liver parenchyma, where hepatocytes are major cell type with only ?5% hepatic stellate cells. The spheroids were grown in basal high glucose DMEM media supplemented as described above. The plates were incubated for 3 days at 37? C. in a humidified atmosphere at 5% CO2, after which spheroids were treated or not with free fatty acid solution (FFA, L9655, Sigma-Aldrich) and kept in cultivation for 48 hours. Spheroids were then collected, washed twice with PBS, fixed in 4% paraformaldehyde+Eosin solution for 20 minutes, incubated in 10% sucrose for 20 minutes and incorporated into tissue freezing media (14020108926, Leica Biosystems, USA) for cutting and subsequent immuno-histological analysis.
Histological Immuno-Staining
[0250] Samples of embedded and snap frozen spheroids in tissue freezing media were cut to 7 ?m at ?20? C. with a cryotome (Leica Microsystems) and stored at ?80? C. for further use. To evaluate the effect of SIRT6 variants and their overexpression on liver tissue fibrosis, spheroid histological sections were immunolabeled to detect Collagen 1A. Slides were washed once in 1xPBS to dissolve tissue freezing media and blocked in 1xPBS supplemented with 0.2% Tween-20 and 5% BSA. Primary antibody rabbit anti-Collagen I (1:500, ab34710, Abcam) was diluted in DAKO antibody diluent (S202230-2, Agilent technologies) and incubated overnight in humid chamber at lab temperature. After three consecutive washes with 1xPBS, mix of secondary antibody (1:500) donkey anti-rabbit IgG coupled with Alexa Fluor? 647 was applied and incubated for at least 1 h. After washing three times with 1xPBS, slides were counterstained with DAPI (1 ?g/ml) solution for 15 minutes and mounted in Mowiol hardening media. After hardening (overnigth at 4? C.), images were captured using an Axio scan Z.1 (ZEISS) equipped with a Hamamatsu ORCA-Flash 4.0 camera and ImageJ software (NIH, USA) analysis program was used to evaluate all immunofluorescence images. Fibrosis, i.e., collagene 1A abundance in spheroid samples, was evaluated as the % of the total spheroid area delineated by DAPI fluorescence at 100? magnification, when at least 5 spheroids per each condition/cell line were used in three consecutive and independent experiments.
Results
[0251] SIRT6 wild type or SIRT6 carrying one or two mutations associated with human exceptional longevity (SIRT6 N308K, centSIRT6) were overexpressed in a variety of cell lines, and assessed how this affected their specific cellular functions.
Werner Syndrome Model
[0252] In human Werner Syndrome immortalized fibroblasts, SIRT6 WT/SIRT6 N308K/centSIRT6 did not affect cell viability, proliferation or telomere length (
[0253] Although it may seem counter-beneficial, Werner Syndrome immortalized fibroblasts are poorly characterized immortalized lines that might have carcinogenic properties. Therefore, without being bound by any theory, and in the event that this is the case, decreasing telomerase activity would be a beneficial effect.
Human Hepatocellular Carcinoma Model
[0254] In human hepatocellular carcinoma (HCC) cells, SIRT6 WT/SIRT6 N308K/centSIRT6 overexpression was lethal, with a larger effect observed for SIRT6 N308K/centSIRT6 (
Adipogenic Differentiation
[0255] It has been reported that SIRT6 deficiency results in hypoglycemia and impairment of energy homeostasis, suggesting that SIRT6 could play an important role in regulating adipocyte differentiation. Aged adipocytes become hypertrophic, in particular under a high fat diet intake, becoming insulin resistant and producing a wide pattern of pro-inflammatory cytokines, contributing to the increase of circulating triglycerides and free fatty acids, which together affects other organs and results in the comorbidities typically associated with obesity. On the other hand, the increase of adipogenesis allows the formation of new adipocytes that are more sensitive to insulin, showing increased capacity of fatty storage and enhanced levels of adipokines, that contribute to metabolic homeostasis and lowering of inflammation levels.
[0256] Here, the results demonstrate that SIRT6 plays a role in the increase of adipogenic differentiation (
Hepatic Stellate Cells Model
[0257] ?-SMA expression is considered a reliable marker of hepatic stellate cell (HSC) activation and a key biomarker for liver fibrosis. In the liver, HSCs play a central role in physiological tissue repair as well as in the development of fibrosis, transdifferentiating from quiescent HSC to a myofibroblastic phenotype in response to Transforming Growth Factor beta (TGF-?), inflammatory processes and ROS.
[0258] SIRT6 WT/SIRT6 N308K/centSIRT6 overexpression did not affect cell viability or proliferation (
[0259] The lower gene expression levels of ?-SMA in centSIRT6 LX2 compared to control suggests a potential anti-fibrotic effect of centSIRT6 in preventing liver fibrosis and/or promoting its resolution.
Hepatic Spheroids Model
[0260] Together with ?-SMA, Collagen (COL1A1) represent one of the key fibrosis markers. Its production in liver is increased mainly by activated hepatic stellate cells.
[0261] Spheroids formed from IHH cells and with 5% the total cell mass of LX2 (human hepatic stellate cells) were generated. Spheroids were treated or not with free fatty acids (FFA), and assessed collagen production by immunofluorescence (
[0262] In IHH/LX2 spheroids with IHH transfected with centSIRT6, a decrease of internal collagen content compared to control (Empty group) was observed, suggesting that at the basal levels, in absence of stressor factors, IHH centSIRT6 inhibit the collagen production (
[0263] It is known that exposure to free fatty acids (FFAs) promotes oxidant stress and indirect activates LX2 increasing collagen biosynthesis. Surprisingly, in presence of FFAs, increased levels of internal collagen in IHH centSIRT6 spheroids compared to control were observed (
TABLE-US-00009 SEQUENCESUSEDHEREIN SEQIDNO:1-WildtypeSIRT6aminoacidsequence MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVV FHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLE RVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVV GTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRN ADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEV MTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPK QEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS SEQIDNO:2-SIRT6N308Kvariantaminoacidsequence MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVV FHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLE RVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVV GTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRN ADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEV MTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRIKGSIPAGPK QEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS SEQIDNO:3-SIRT6A313Svariantaminoacidsequence MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVV FHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLE RVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVV GTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRN ADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEV MTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPSGPKQ EPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS SEQIDNO:4-SIRT6N308KA313Svariant(centSIRT6)aminoacidsequence MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVV FHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLE RVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVV GTMGLKATGRLCTVAKARGLRACRGELRDTILDWEDSLPDRDLALADEASRN ADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEV MTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRIKGSIPSGPKQ EPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS SEQIDNO:5-WildtypeSIRT6nucleicacidsequence atgtcggtgaattacgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctcccggagatcttcg accccccggaggagctggagcggaaggtgtgggaactggcgaggctggtctggcagtcttccagtgtggtgttccacacgg gtgccggcatcagcactgcctctggcatccccgacttcaggggtccccacggagtctggaccatggaggagcgaggtctgg cccccaagttcgacaccacctttgagagcgcgcggcccacgcagacccacatggcgctggtgcagctggagcgcgtgggc ctcctccgcttcctggtcagccagaacgtggacgggctccatgtgcgctcaggcttccccagggacaaactggcagagctcc acgggaacatgtttgtggaagaatgtgccaagtgtaagacgcagtacgtccgagacacagtcgtgggcaccatgggcctgaa ggccacgggccggctctgcaccgtggctaaggcaagggggctgcgagcctgcaggggagagctgagggacaccatccta gactgggaggactccctgcccgaccgggacctggcactcgccgatgaggccagcaggaacgccgacctgtccatcacgct gggtacatcgctgcagatccggcccagcgggaacctgccgctggctaccaagcgccggggaggccgcctggtcatcgtca acctgcagcccaccaagcacgaccgccatgctgacctccgcatccatggctacgttgacgaggtcatgacccggctcatgaa gcacctggggctggagatccccgcctgggacggcccccgtgtgctggagagggcgctgccacccctgccccgcccgccc acccccaagctggagcccaaggaggaatctcccacccggatcaacggctctatccccgccggccccaagcaggagccctg cgcccagcacaacggctcagagcccgccagccccaaacgggageggcccaccagccctgccccccacagaccccccaa aagggtgaaggccaaggcggtccccagctga SEQIDNO:6-SIRT6N308Kvariantnucleicacidsequence atgtcggtgaattacgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctcccggagatcttcg accccccggaggagctggagcggaaggtgtgggaactggcgaggctggtctggcagtcttccagtgtggtgttccacacgg gtgccggcatcagcactgcctctggcatccccgacttcaggggtccccacggagtctggaccatggaggagcgaggtctgg cccccaagttcgacaccacctttgagagcgcgcggcccacgcagacccacatggcgctggtgcagctggagcgcgtgggc ctcctccgcttcctggtcagccagaacgtggacgggctccatgtgcgctcaggcttccccagggacaaactggcagagctcc acgggaacatgtttgtggaagaatgtgccaagtgtaagacgcagtacgtccgagacacagtcgtgggcaccatgggcctgaa ggccacgggccggctctgcaccgtggctaaggcaagggggctgcgagcctgcaggggagagctgagggacaccatccta gactgggaggactccctgcccgaccgggacctggcactcgccgatgaggccagcaggaacgccgacctgtccatcacgct gggtacatcgctgcagatccggcccagcgggaacctgccgctggctaccaagcgccggggaggccgcctggtcatcgtca acctgcagcccaccaagcacgaccgccatgctgacctccgcatccatggctacgttgacgaggtcatgacccggctcatgaa gcacctggggctggagatccccgcctgggacggcccccgtgtgctggagagggcgctgccacccctgccccgcccgccc acccccaagctggagcccaaggaggaatctcccacccggatcaagggctctatccccgccggccccaagcaggagccctg cgcccagcacaacggctcagagcccgccagccccaaacgggagcggcccaccagccctgccccccacagaccccccaa aagggtgaaggccaaggcggtccccagctga SEQIDNO:7-SIRT6A313Svariantnucleicacidsequence atgtcggtgaattacgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctcccggagatcttcg accccccggaggagctggagcggaaggtgtgggaactggcgaggctggtctggcagtcttccagtgtggtgttccacacgg gtgccggcatcagcactgcctctggcatccccgacttcaggggtccccacggagtctggaccatggaggagcgaggtctgg cccccaagttcgacaccacctttgagagcgcgcggcccacgcagacccacatggcgctggtgcagctggagcgcgtgggc ctcctccgcttcctggtcagccagaacgtggacgggctccatgtgcgctcaggcttccccagggacaaactggcagagctcc acgggaacatgtttgtggaagaatgtgccaagtgtaagacgcagtacgtccgagacacagtcgtgggcaccatgggcctgaa ggccacgggccggctctgcaccgtggctaaggcaagggggctgcgagcctgcaggggagagctgagggacaccatccta gactgggaggactccctgcccgaccgggacctggcactcgccgatgaggccagcaggaacgccgacctgtccatcacgct gggtacatcgctgcagatccggcccagcgggaacctgccgctggctaccaagcgccggggaggccgcctggtcatcgtca acctgcagcccaccaagcacgaccgccatgctgacctccgcatccatggctacgttgacgaggtcatgacccggctcatgaa gcacctggggctggagatccccgcctgggacggcccccgtgtgctggagagggcgctgccacccctgccccgcccgccc acccccaagctggagcccaaggaggaatctcccacccggatcaacggctctatcccctccggccccaagcaggagccctg cgcccagcacaacggctcagagcccgccagccccaaacgggagcggcccaccagccctgccccccacagaccccccaa aagggtgaaggccaaggcggtccccagctga SEQIDNO:8-SIRT6N308KA313Svariant(centSIRT6)nucleicacidsequence atgtcggtgaattacgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctcccggagatcttcg accccccggaggagctggagcggaaggtgtgggaactggcgaggctggtctggcagtcttccagtgtggtgttccacacgg gtgccggcatcagcactgcctctggcatccccgacttcaggggtccccacggagtctggaccatggaggagcgaggtctgg cccccaagttcgacaccacctttgagagcgcgcggcccacgcagacccacatggcgctggtgcagctggagcgcgtgggc ctcctccgcttcctggtcagccagaacgtggacgggctccatgtgcgctcaggcttccccagggacaaactggcagagctcc acgggaacatgtttgtggaagaatgtgccaagtgtaagacgcagtacgtccgagacacagtcgtgggcaccatgggcctgaa ggccacgggccggctctgcaccgtggctaaggcaagggggctgcgagcctgcaggggagagctgagggacaccatccta gactgggaggactccctgcccgaccgggacctggcactcgccgatgaggccagcaggaacgccgacctgtccatcacgct gggtacatcgctgcagatccggcccagcgggaacctgccgctggctaccaagcgccggggaggccgcctggtcatcgtca acctgcagcccaccaagcacgaccgccatgctgacctccgcatccatggctacgttgacgaggtcatgacccggctcatgaa gcacctggggctggagatccccgcctgggacggcccccgtgtgctggagagggcgctgccacccctgccccgcccgccc acccccaagctggagcccaaggaggaatctcccacccggatcaagggctctatcccctccggccccaagcaggagccctg cgcccagcacaacggctcagagcccgccagccccaaacgggageggcccaccagccctgccccccacagaccccccaa aagggtgaaggccaaggcggtccccagctga SEQIDNO:9-LINE1ORF1Forward-primer atggcgaaaggcaaacgtaag SEQIDNO:10-LINE1ORF1Reverse-primer attttcggttgtgttggggtg SEQIDNO:11-LINE1ORF2Forward-primer gcaggggttgcaatcctagtc SEQIDNO:12-LINE1ORF2Reverse-primer ctgggtgctcctgtattgggt SEQIDNO:13-?SMAForward-primer aaaagacagctacgtgggtga SEQIDNO:14-?SMAReverse-primer gccatgttctatcgggtacttc SEQIDNO:15-COL1A1Forward-primer gtgcgatgacgtgatctgtga SEQIDNO:16-COL1A1Reverse-primer cggtggtttcttggtcggt SEQIDNO:17-TIMP1Forward-primer accaccttataccagcgttatga SEQIDNO:18-TIMP1Reverse-primer ggtgtagacgaaccggatgtc SEQIDNO:19-VIMENTINForward-primer agtccactgagtaccggagac SEQIDNO:20-VIMENTINReverse-primer catttcacgcatctggcgttc SEQIDNO:21-MMP2Forward-primer tacaggatcattggctacacacc SEQIDNO:22-MMP2Reverse-primer ggtcacatcgctccagact SEQIDNO:23-GAPDHForward-primer ggtgcgtgcccagttga SEQIDNO:24-GAPDHReverse-primer tactttctccccgcttttt SEQIDNO:25-Actin?Forward-primer catgtacgttgctatccaggc SEQIDNO:26-Actin?Reverse-primer ctccttaatgtcacgcacgat