Extensive whey protein hydrolysate with tolerogenic peptides

Abstract

The invention concerns a process for preparing an ultrafiltered whey protein hydrolysate comprising tolerogenic peptides wherein an emulsifier and/or a chaotropic agent is added before ultrafiltration. The invention further concerns the product obtainable by the process.

Claims

1. A process for preparing an ultrafiltered whey protein hydrolysate, said process comprising: a) subjecting whey protein A to hydrolysis 1 with one or more proteolytic enzymes thereby obtaining a whey protein hydrolysate B, and b) subjecting the whey protein hydrolysate B to membrane ultrafiltration 2 thereby obtaining a permeate C1 and a retentate C2, wherein (i) an emulsifier E is added to the whey protein A prior to or during hydrolysis 1 or wherein an emulsifier and/or a chaotropic agent E is added to the whey protein hydrolysate B prior to the membrane ultrafiltration 2, wherein the ultrafiltered whey protein hydrolysate is in permeate C1, and/or wherein (ii) after step b) c) an emulsifier and/or a chaotropic agent E is added to retentate C2 thereby obtaining a retentate C3, d) subjecting the retentate C3 to membrane ultrafiltration 3 thereby obtaining a permeate D1 and a retentate D2, and e) adding at least part of the permeate D1 to the permeate C1 thereby obtaining permeate D3, wherein the ultrafiltered whey protein hydrolysate is in permeate D3.

2. The process according to claim 1, wherein said ultrafiltered whey protein hydrolysate comprises at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 2-70.

3. The process according to claim 1, wherein the ultrafiltered whey protein hydrolysate comprises less than 100 mg, p peptides with a size above 5 kDa per gram protein; and/or wherein the ultrafiltered whey protein hydrolysate comprises less than 30 mg per gram protein of peptides with a size above 10 kDa.

4. The process according to claim 1, wherein the ultrafiltered whey protein hydrolysate comprises at least 300 mg of peptides with a size of 1 kDa or below per gram protein, and/or wherein the ultrafiltered whey protein hydrolysate comprises at least 900 mg per gram protein of peptides with a size of 5 kDa or below.

5. The process according to claim 1, wherein the ultrafiltered whey protein hydrolysate has a degree of hydrolysis between 5 and 50%.

6. (canceled)

7. (canceled)

8. The process according to claim 1, wherein an emulsifier E is added, wherein the emulsifier is selected from the group consisting of citric acid esters of mono and diglycerides (Citrem), diacetyl tartaric acid esters of mono- and diglycerides (Datem), monoacylglycerols (MAG), diacylglycerols (DAG), sucrose esters (SE, E473) and soy lecithin, and combinations thereof.

9. The process according to claim 1, wherein the emulsifier E is added to the whey protein prior to or during hydrolysis, and/or in a concentration of at least 50 mg per gram protein to which it is added and/or in a concentration of at least 1 g per liter.

10. The process according to claim 1, wherein a chaotropic agent is added in a concentration of at least 1 gram per 100 ml and/or at least 25 mg per gram protein to which it is added

11. The process according to claim 10, wherein the chaotropic agent E is added to the whey protein hydrolysate B prior to membrane ultrafiltration.

12.-13. (canceled)

14. An ultrafiltered whey protein hydrolysate, wherein the ultrafiltered whey protein hydrolysate comprises peptides with the following size distribution: 60-90% with a size <1 kDa, 10-40% of peptides with a size of 1 to <5 kDa, 0-0.5% of peptides with a size of 5 to <10 kDa, and 0-0.2% of peptides with a size >10 kDa, based on the total protein of the hydrolysate, and wherein the ultrafiltered whey protein hydrolysate comprises: less than 6 microgram allergenic beta-lactoglobulin per gram protein; and/or less than 3% of peptides with a size of above 5 kDa based on total protein, and at least one, betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 66-70.

15. (canceled)

16. A whey protein hydrolysate composition comprising ultrafiltered whey protein hydrolysate, in a concentration of at least 0.8 gram of ultrafiltered whey protein hydrolysate per gram protein, wherein the ultrafiltered whey protein hydrolysate comprises: less than 6 microgram allergenic beta-lactoglobulin per gram protein; and/or less than 3% of peptides with a size of above 5 kDa based on total protein, and at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 2-70; and optionally, at least 50 mg urea per gram protein and/or at least 5 mg emulsifier per gram protein.

17. The ultrafiltered whey protein hydrolysate according to claim 14 wherein the at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 2-70, is present in amount of at least 10 microgram preferably 50 microgram per gram protein.

18. The ultrafiltered whey protein hydrolysate according to claim 14 wherein the ultrafiltered whey protein hydrolysate comprises peptides with the following size distribution: 60-90% with a size <1 kDa, 10-40% of peptides with a size of 1 to <5 kDa, 0-0.5% of peptides with a size of 5 to <10 kDa, and 0-0.2% of peptides with a size >10 kDa, based on the total protein of the hydrolysate.

19. A nutritional composition comprising the ultrafiltered whey protein hydrolysate according to claim 14, wherein said composition is an infant formula, a follow-on formula or a young child formula.

20. The nutritional composition according to claim 19, further comprising one or more non-digestible oligosaccharides and/or one or more lactic acid producing bacteria.

21.-25. (canceled)

Description

LIST OF FIGURES

[0041] FIG. 1 provides a schematic overview of the manufacturing process according to one embodiment of the invention. A whey protein A is provided that is first hydrolyzed in step 1, wherein whey protein hydrolysate B is obtained. Subsequently whey protein hydrolysate B is subjected to ultrafiltration 2 yielding permeate C1 and retentate C2. The ultrafiltered whey protein hydrolysate is in permeate C1. The chaotropic agent E and/or emulsifier E is added before, during and/or after step 1 but before step 2.

[0042] FIG. 2 provides a schematic overview of the manufacturing process according to another preferred embodiment of the invention. A whey protein A is provided that is first hydrolyzed in step 1, wherein whey protein hydrolysate B is obtained. Subsequently whey protein hydrolysate B is subjected to ultrafiltration 2 yielding permeate C1 and retentate C2. The chaotropic agent and/or emulsifier E is subsequently added to retentate C2 to obtain retentate C3. Retentate C3 is subjected to ultrafiltration 3 yielding permeate D1 and retentate D2. At least a part of permeate D1 is combined with retentate C1 to obtain permeate D3 wherein the ultrafiltered whey protein hydrolysate is in permeate D3. Additionally the chaotropic agent E and/or emulsifier E may be added before, during and/or after step 1 but before step 2.

LIST OF CLAUSES

[0043] 1) A process for preparing an ultrafiltered whey protein hydrolysate, said process comprising: [0044] a) Subjecting whey protein A to hydrolysis 1 with one or more proteolytic enzymes thereby obtaining a whey protein hydrolysate B, and [0045] b) subjecting the whey protein hydrolysate B to membrane ultrafiltration 2 thereby obtaining a permeate C1 and a retentate C2, wherein [0046] (i) an emulsifier E is added to the whey protein A prior to or during hydrolysis 1 or wherein an emulsifier and/or a chaotropic agent E is added to the whey protein hydrolysate B prior to the membrane ultrafiltration 2, [0047] wherein the ultrafiltered whey protein hydrolysate is in permeate C1, [0048] and/or wherein [0049] (ii) after step b) [0050] c) an emulsifier and/or a chaotropic agent E is added to retentate C2 thereby obtaining a retentate C3, [0051] d) subjecting the retentate C3 to membrane ultrafiltration 3 thereby obtaining a permeate D1 and a retentate D2, and [0052] e) adding at least part of the permeate D1 to the permeate C1 thereby obtaining permeate D3, [0053] wherein the ultrafiltered whey protein hydrolysate is in permeate D3. [0054] 2) The process according to clause 1, wherein said ultrafiltered whey protein hydrolysate comprises at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 2-70, preferably an amino acid sequence according to any one of SEQ ID No. 31-70. [0055] 3) The process according to clause 1 or 2, wherein the ultrafiltered whey protein hydrolysate comprises less than 100 mg, preferably less than 50 mg, more preferably less than 10 mg of peptides with a size above 5 kDa per gram protein; and/or wherein the ultrafiltered whey protein hydrolysate comprises less than 30 mg per gram protein, preferably less than 10 mg per gram protein, most preferably less than 5 mg per gram protein of peptides with a size above 10 kDa. [0056] 4) The process according to any one of the preceding clauses, wherein the ultrafiltered whey protein hydrolysate comprises at least 300 mg of peptides with a size of 1 kDa or below per gram protein, even more preferably at least 500 mg per gram protein; and/or wherein the ultrafiltered whey protein hydrolysate comprises at least 900 mg per gram protein of peptides with a size of 5 kDa or below, even more preferably at least 950 mg per gram protein, most preferably at least 990 mg per gram protein. [0057] 5) The process according to any one of the preceding clauses wherein the ultrafiltered whey protein hydrolysate has a degree of hydrolysis between 5 and 50%, preferably between 10 and 30%, more preferably between 15 and 25%. [0058] 6) The process according to any one of the preceding clauses wherein the ultrafiltered whey protein hydrolysate is derived from milk from a species of the genus Bos, Bison, Bubalus or Capra, more preferably of the genus Bos, preferably from cow's milk. [0059] 7) The process according to any one of the preceding clauses wherein the membrane used in membrane ultrafiltration 2 and/or membrane ultrafiltration 3 has a pore size with a cut-off in the range of 5-15 kDa, preferably 5-11 kDa, more preferably 9-11 kDa. [0060] 8) The process according to any one of the preceding clauses, wherein an emulsifier E is added, wherein the emulsifier preferably is selected from the group consisting of citric acid esters of mono and diglycerides (Citrem), diacetyl tartaric acid esters of mono- and diglycerides (Datem), monoacylglycerols (MAG), diacylglycerols (DAG), sucrose esters (SE, E473) and soy lecithin, and combinations thereof, more preferably is or comprises Citrem. [0061] 9) The process according to any one of the preceding clauses, wherein the emulsifier E is added to the whey protein prior to or during hydrolysis, preferably prior to hydrolysis; and preferably in a concentration of at least 50 mg per gram protein to which it is added and/or in a concentration of at least 1 g per liter. [0062] 10) The process according to any one of the preceding clauses, wherein a chaotropic agent is added, preferably in a concentration of at least 1 gram per 100 ml and/or at least 25 mg per gram protein to which it is added; and wherein the chaotropic agent preferably is or comprises urea. [0063] 11) The process according to clause 10, wherein the chaotropic agent E is added to the whey protein hydrolysate B prior to membrane ultrafiltration. [0064] 12) An ultrafiltered whey protein hydrolysate obtainable by the process according to any one of the preceding clauses. [0065] 13) The ultrafiltered whey protein hydrolysate according to clause 12, comprising: [0066] less than 6 microgram allergenic beta-lactoglobulin per gram protein; and/or less than 3%, preferably less than 1% of peptides with a size of 5 kDa based on total protein, and [0067] at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 2-30, preferably according to any one of SEQ ID No. 31-57, more preferably according to any one of SEQ ID No. 58-70; and [0068] preferably at least 50 mg chaotropic agent per gram protein and/or at least 5 mg emulsifier per gram protein. [0069] 14) An ultrafiltered whey protein hydrolysate, wherein the ultrafiltered whey protein hydrolysate comprises peptides with the following size distribution: [0070] 60-90% with a size <1 kDa, [0071] 10-40% of peptides with a size of 1 to <5 kDa, [0072] 0-0.5% of peptides with a size of 5 to <10 kDa, and [0073] 0-0.2% of peptides with a size >10 kDa, [0074] based on the total protein of the hydrolysate, and [0075] wherein the ultrafiltered whey protein hydrolysate comprises: [0076] less than 6 microgram allergenic beta-lactoglobulin per gram protein; and/or less than 3%, preferably less than 1% of peptides with a size of 5 kDa based on total protein, and [0077] at least one, preferably at least two, more preferably at least three of betalactoglobulin peptide(s) comprising an amino acid sequence according to any one of SEQ ID No. 66-70. [0078] 15) The ultrafiltered whey protein hydrolysate according to clause 14, obtainable by the process according to any one of clauses 1-11. [0079] 16) A whey protein hydrolysate composition comprising ultrafiltered whey protein hydrolysate, in a concentration of at least 0.8 gram of ultrafiltered whey protein hydrolysate per gram protein, wherein the ultrafiltered whey protein hydrolysate comprises: [0080] less than 6 microgram allergenic beta-lactoglobulin per gram protein; and/or less than 3%, preferably less than 1% of peptides with a size of 5 kDa based on total protein, and [0081] at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 2-70, preferably according to any one of SEQ ID No. 31-70; and [0082] preferably at least 50 mg urea per gram protein and/or at least 5 mg emulsifier per gram protein. [0083] 17) The ultrafiltered whey protein hydrolysate according to any one of clauses 13-15 or the whey protein hydrolysate composition according to clause 16 wherein the at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 2-70, preferably according to any one of SEQ ID No. 31-70, more preferably according to any one of SEQ ID No. 31-57, even more preferably according to any one of SEQ ID No. 58-70, most preferably according to any one of SEQ ID No. 66-70 is present in amount of at least microgram preferably 50 microgram per gram protein. [0084] 18) The ultrafiltered whey protein hydrolysate according to any one of clauses 13-15 or the whey protein hydrolysate composition according to clause 16 wherein the ultrafiltered whey protein hydrolysate comprises peptides with the following size distribution: [0085] 60-90% with a size <1 kDa, [0086] 10-40% of peptides with a size of 1 to <5 kDa, [0087] 0-0.5% of peptides with a size of 5 to <10 kDa, and [0088] 0-0.2% of peptides with a size >10 kDa, [0089] based on the total protein of the hydrolysate. [0090] 19) A nutritional composition comprising the ultrafiltered whey protein hydrolysate according to any of clauses 13-15 or the whey protein hydrolysate composition according to clause 16, wherein said composition is an infant formula, a follow-on formula or a young child formula, preferably an infant formula or a follow-on formula. [0091] 20) The nutritional composition according to clause 19, further comprising one or more non-digestible oligosaccharides and/or one or more lactic acid producing bacteria. [0092] 21) Use of the nutritional composition according to clause 19 or 20 in the manufacture of a product [0093] (i) for providing nutrition to; and/or [0094] (ii) for treating/preventing allergy in; and/or [0095] (iii) for inducing oral immune tolerance against an allergen, preferably a food allergen in subjects suffering from allergy, preferably suffering from food allergy, preferably bovine, ovine and/or caprine milk protein, preferably allergy allergy selected from the group consisting of cow's milk protein allergy, goat's milk protein allergy and sheep's milk protein allergy, wherein the subjects are preferably children up to 6 years of age, more preferably infants between 0 and 12 months of age. [0096] 22) The nutritional composition according to clause 19 or 20, for use in treating and/or preventing allergy, preferably treating allergy, and/or for inducing oral immune tolerance against an allergen, preferably a food allergen. [0097] 23) The nutritional composition for use according to clause 22, wherein the allergy is a food allergy, preferably bovine, ovine and/or caprine milk protein allergy, preferably allergy selected from the group consisting of cow's milk protein allergy, goat's milk protein allergy and sheep's milk allergy and/or the allergen is selected from the group consisting of cow's milk protein, goat's milk protein and sheep's milk protein, preferably wherein the allergy is cow's milk protein allergy and/or the allergen is cow's milk protein. [0098] 24) The use of clause 21 or the nutritional composition for use of clauses 22 or 23, wherein the milk protein is betalactoglobulin. [0099] 25) Use of the ultrafiltered whey protein hydrolysate according to any of clauses 13-15 or the whey protein hydrolysate composition according to clause 16 in the manufacture of a nutritional composition, wherein said composition is preferably an infant formula, a follow-on formula or a young child formula, preferably an infant formula or a follow-on formula.

DETAILED DESCRIPTION

[0100] The invention thus concerns a process for preparing an ultrafiltered whey protein hydrolysate, said process comprising: [0101] a) Subjecting whey protein A to hydrolysis 1 with one or more proteolytic enzymes thereby obtaining a whey protein hydrolysate B, and [0102] b) subjecting the whey protein hydrolysate B to membrane ultrafiltration 2 thereby obtaining a permeate C1 and a retentate C2, [0103] wherein [0104] (i) an emulsifier E is added to the whey protein A prior to or during hydrolysis 1 or wherein an emulsifier and/or a chaotropic agent E is added to the whey protein hydrolysate B prior to the membrane ultrafiltration 2, [0105] wherein the ultrafiltered whey protein hydrolysate is in permeate C1, [0106] and/or wherein [0107] (ii) after step b) [0108] c) an emulsifier and/or a chaotropic agent E is added to retentate C2 thereby obtaining a retentate C3, [0109] d) subjecting the retentate C3 to membrane ultrafiltration 3 thereby obtaining a permeate D1 and a retentate D2, and [0110] e) adding at least part of the permeate D1 to the permeate C1 thereby obtaining permeate D3, [0111] wherein the ultrafiltered whey protein hydrolysate is in permeate D3.

[0112] The invention also concerns an ultrafiltered whey protein hydrolysate obtainable by this process.

[0113] Furthermore the invention concerns an ultrafiltered whey protein hydrolysate, wherein the ultrafiltered whey protein hydrolysate comprises peptides with the following size distribution: [0114] 60-90% with a size <1 kDa, [0115] 10-40% of peptides with a size of 1 to <5 kDa, [0116] 0-0.5% of peptides with a size of 5 to <10 kDa, and [0117] 0-0.2% of peptides with a size >10 kDa, [0118] based on the total protein of the hydrolysate, and [0119] wherein the ultrafiltered whey protein hydrolysate comprises: [0120] less than 6 microgram allergenic beta-lactoglobulin per gram protein; and/or less than 3%, preferably less than 1% of peptides with a size of 5 kDa based on total protein, and [0121] at least one, preferably at least two, more preferably at least three of betalactoglobulin peptide(s) comprising an amino acid sequence according to any one of SEQ ID No. 66-70.

[0122] The invention also concerns a whey protein hydrolysate composition comprising ultrafiltered whey protein hydrolysate, in a concentration of at least 0.8 gram of ultrafiltered whey protein hydrolysate per gram protein, wherein the ultrafiltered whey protein hydrolysate comprises: [0123] less than 6 microgram allergenic beta-lactoglobulin per gram protein; and/or less than 3%, preferably less than 1% of peptides with a size of 5 kDa based on total protein, and [0124] at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 2-70, preferably according to any one of SEQ ID No. 31-70; and [0125] preferably at least 50 mg urea per gram protein and/or at least 5 mg emulsifier per gram protein.

[0126] Furthermore the invention concerns a nutritional composition comprising the ultrafiltered whey protein hydrolysate or the whey protein hydrolysate composition, wherein said composition is an infant formula, a follow-on formula or a young child formula, preferably an infant formula or a follow-on formula.

[0127] The invention also concerns the use of the nutritional composition in the manufacture of a product (i) for providing nutrition to; and/or [0128] (ii) for treating/preventing allergy in; and/or [0129] (iii) for inducing oral immune tolerance against an allergen, preferably a food allergen in subjects suffering from allergy, preferably suffering from food allergy, preferably bovine, ovine and/or caprine milk protein, preferably allergy allergy selected from the group consisting of cow's milk protein allergy, goat's milk protein allergy and sheep's milk protein allergy, [0130] wherein the subjects are preferably children up to 6 years of age, more preferably infants between 0 and 12 months of age.

[0131] Also the invention concerns the use of the ultrafiltered whey protein hydrolysate or the whey protein hydrolysate composition in the manufacture of a nutritional composition, wherein said composition is preferably an infant formula, a follow-on formula or a young child formula, preferably an infant formula or a follow-on formula.

Protein Levels

[0132] In the context of the present invention, protein is defined as the sum of protein, peptides and free amino acids. Protein according to the present invention can also be referred to as protein equivalent. Where numbers are presented based on protein, it thus means that it is based on the sum of all proteinaceous materials including protein, peptides and free amino acids. Amino acids are the 20 different natural amino acids that can be part of eukaryotic protein and peptides. In the context of the invention, amino acids are considered free amino acids, distinct from peptides. The level of total protein is derived from the commonly known Kjeldahl nitrogen analysis and multiplication by a factor of 6.25. This gives a level of total protein, sometimes also referred to as crude protein level. Hence total protein is the sum of protein equivalent as defined herein plus non-protein nitrogen (NPN). Methods to determine protein and peptides and free amino acids are known in the art. For example a method wherein first protein an peptides are precipitated followed by common protein determination and free amino acids can be determined in the non-precipitated fraction by HPLC with pre-column derivatization with fluorenylmethyl-chloroformate and UV and fluorescence detection is suitable.

Whey Protein (A)

[0133] In the context of the current invention whey protein is derived from milk from mammals. The whey protein A is preferably derived from milk from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, preferably from cow's milk. The whey protein A may be derived from one or more different milk sources. In other words, the whey protein is preferably Bos, Bison, Bubalus or Capra whey protein, or combinations thereof, more preferably Bos whey protein, preferably cow's milk whey protein. Consequently the whey protein hydrolysate B or the ultrafiltered whey protein hydrolysate is preferably derived from milk from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, preferably from cow's milk. In other words, the whey protein hydrolysate B or the ultrafiltered whey protein hydrolysate is preferably Bos, Bison, Bubalus or Capra (ultrafiltered) whey protein hydrolysate, more preferably Bos (ultrafiltered) whey protein hydrolysate, preferably cow's milk (ultrafiltered) whey protein hydrolysate.

[0134] Preferably, the whey protein A is one or more of selected from the group consisting of acid whey protein, sweet whey protein, whey protein concentrate (WPC), whey protein isolate (WPI) or demineralized whey powder. These whey types are commercially available. A suitable source is a mixture of acid whey protein and demineralised sweet whey protein. Sweet whey is the by-product of rennet-coagulated cheese and comprises caseinoglycomacropeptide (CGMP), and acid whey (also called sour whey) is the by-product of acid-coagulated cheese, and does not contain CGMP. Suitable sources for the whey protein are demineralised whey (Deminal, Friesland Campina, the Netherlands) and/or whey protein concentrate (WPC80, Friesland Campina, the Netherlands). The whey protein to be hydrolyzed preferably comprises acid whey, more preferably at least 50 wt %, more preferably at least 70 wt % acid whey, based on total whey protein. Acid whey has an improved amino acid profile compared to sweet whey protein. The source of whey protein is not critical to the process of the invention.

[0135] Whey protein A comprises a considerable amount of betalactoglobulin (BLG). The amino acid sequence of BLG in species of Bos and Bison are similar. In species of Capra and Bubalus the amino acid at position 1 is different (an isoleucine instead of a leucine). The at least one betalactoglobulin peptide comprising or having an amino acid sequence according to any one of SEQ ID No. 2-70, preferably according to any one of SEQ ID No. 31-70, more preferably according to any one of SEQ ID no. 2-24, 31-51 and 66-70, even more preferably according to any one of SEQ ID no. 31-51 and 66-70, particularly preferably according to any one of SEQ ID no. 2-17, 31-44, 66 and 68-70, even more preferably according to any one of SEQ ID no. 31-44, 66 and 68-70, most preferably according to any of SEQ ID no. 66 and 68-70 have the same tolerogenic properties regardless the source of whey protein.

Hydrolysis (1)

[0136] Hydrolysis concerns protein hydrolysis and is performed with one or more proteolytic enzymes. The proteolytic enzymes used for the hydrolysis is from animal or vegetable origins (e.g. pepsin, chymotrypsin, trypsin, intestinal mucosa extract, pancreatic extracts, chymosin, papain, bromelain, ficin), bacterial or fungi origins (e.g. serine and metallo-5 proteases from Bacillus subtilis, Bacillus licheniformis, Bacillus amyloliquefaciens, Aspergillus orysae, Aspergillus wentii and acidic proteases from Aspergillus orizae, Aspergillus wentii, Mucor miehei, Mucor pusillus, Endothia parasitica) or a combination of these. By way of example, the proteolytic enzyme can be alcalase, acidic proteases from Aspergillus oryzae or trypsin

[0137] During hydrolysis, the concentration of the protein in solution or in suspension is preferably in the range of 2-20% by weight (wt %), and may be pasteurized before introducing proteases. The ratio enzyme/protein preferably is between 0.1-10% weight/weight, more preferably between 0.25 to 4% weight/weight. The skilled person has the skills and knowledge to carry out conventional enzymatic hydrolysis. Hydrolysis preferably is conducted at a temperature of about 35? C. to 65? C. Hydrolysis is preferably conducted between 30 minutes and 10 hours, more preferably between 30 min to 4 hours. The pH during hydrolysis is between 2.5 and 11, preferably between 5 and 9, more preferably between 6 and 8.5. If desired the pH of the solution can be adjusted and regulated with citric acid, food grade HCl or NaOH, NH4OH, KOH, Ca(OH)2 and/or Mg(OH)2, for instance at a concentration of 2N pure or in blend.

[0138] The enzymatic process of hydrolysis may be stopped by fast cooling. Preferably the whey protein hydrolysate obtained after hydrolysis (or obtained in step a) is cooled before any subsequent process step, such a membrane ultrafiltration. Preferably the whey protein hydrolysate is cooled below 30? C., more preferably below 20? C., most preferably below 10? C. Alternatively or additionally, the protein hydrolysate preferably is subjected to a heat treatment of about 0.01 to 10 min at a temperature of about 70 to 130? C. to inactivate residual enzymes, i.e. proteases. Cooling may precede and/or succeed the heat treatment. The whey protein hydrolysate B thus obtained may be clarified by centrifugation or filtration to remove insoluble proteins, and a clear solution is recovered.

[0139] The recovered (clear) hydrolysate solution can, if desired, be concentrated by evaporation to a dry solid content of for instance 10-50% (weight/weight) for a subsequent treatment or spray dried.

Membrane Ultrafiltration

[0140] The method of the current invention also involves membrane ultrafiltration (UF), after hydrolysis 1. That is, the whey protein hydrolysate obtained here above is subsequently subjected to UF. All mentioned with regard to UF here below applies to membrane ultrafiltration 2 and 3 as detailed in FIGS. 1 and 2.

[0141] The membrane ultrafiltration (or ultrafiltration) 2 and/or 3 can be carried out with any UF membrane known in the art, including flat sheet membranes, ceramic membranes, tubular and organic spiral wound membranes. Preferably the UF membrane is a spiral wound membrane. The UF membrane has a molecular weight cut-off of that enables intact proteins, preferably allergenic betalactoglobulin, to remain in the retentate, and allow peptides to permeate through the membrane. The skilled person is well capable of determining the appropriate cut-off. The membrane ultrafiltration 2 and/or 3 is preferably carried out with a membrane having a molecular weight cut-off of at most 15 kDa, more preferably 5-11 kDa, more preferably at least 9 kDa. The membrane ultrafiltration 2 and/or 3 are preferably carried out with a membrane having a pore size with a cut-off of 5-15 kDa, preferably 5-11 kDa, more preferably 9-11 kDa.

[0142] The membrane ultrafiltration 2 and/or 3 is preferably performed below 40? C., more preferably between 3? C. and 30? C., even more preferably between 5? C. and 20? C.

[0143] The membrane ultrafiltration 2 and/or 3 is preferably carried out with a volume concentration factor (VCF) in the range of 5-50, more preferably 10-25, which has been found to provide the most optimal results in terms of the composition of the UF permeate. In the context of the invention, the term volume concentration factor or VCF is the factor at which a liquid composition is concentrated upon filtration, i.e. the total volume of the incoming stream prior to filtration divided by the total volume of the retentate after filtration, irrespective of the total solid content. Thus, when 100 kg of a liquid composition is fractionated over an ultrafiltration membrane into a permeate of 93 kg and a retentate of 7 kg, this UF process operates with a VCF of 100/7 of about 15.

[0144] Using such processing parameters, the UF permeate stream C1 typically comprises at least 80% (w/w), preferably at least 80% (w/w) more preferably 90% (w/w) of the whey protein A. The ultrafiltration 3 will mainly deliver tolerogenic peptides from retentate C3.

The Ultrafiltered Whey Protein Hydrolysate

[0145] In the context of the current inventionand in accordance with the artthe term peptide size and peptide weight may be used interchangeably. Both peptide size and peptide weight are expressed in Dalton (Da) or kiloDalton (kDa).

[0146] Other weights are expressed in kilogram (kg), gram (g), milligram (mg) and microgram (mcg or ?g); the abbreviation of these units are between brackets.

[0147] The hydrolysis 1 will mainly deliver peptides. Subsequently ultrafiltration 2 will further reduce the amount of any intact protein in the permeate. The peptides mix may be characterized by its size distribution or degree of hydrolysis. Consequently the ultrafiltered whey protein hydrolysate according to the present invention may be characterized by a peptide size distribution or degree of hydrolysis. The size distribution does not need to encompass a full distribution. The presence of specific amounts of peptides of one or more specific size ranges may be sufficient for characterization.

[0148] In the art sometimes whey protein hydrolysate is further characterized in partial whey protein hydrolysate or partially hydrolyzed whey protein or PHP, and extensively whey protein hydrolysate or extensively hydrolyzed whey protein or eHP. If such protein is taken up in a formula, common naming is pHF for formula comprising partially hydrolyzed whey protein and eHF for formula comprising extensively hydrolyzed whey protein. The skilled person understands the overall peptide size in eHP will be smaller compared to pHP. In the context of the current invention eHP is characterized as being a whey protein hydrolysate with less than 1% of peptides with a size of 5 kDa based on total protein and pHP less than 3% of peptides with a size of 5 kDa based on total protein.

[0149] Preferably the ultrafiltered whey protein hydrolysate B is extensively hydrolyzed whey protein. eHP can be obtained by hydrolysis of whey proteins to a high degree of hydrolysis (substantial hydrolysis) or by removing the larger peptides of hydrolyzed whey protein by ultrafiltration. Disadvantage of substantial hydrolysis is that on one side in the context of allergy still significant amounts of intact allergic protein such as allergic betalactoglobulin may be present and that on the other side the protein is hydrolyzed to such extend that no or only a small amount of tolerogenic peptides will be present as for peptides to be tolerogenic they need a minimum size. Although ultrafiltration of a whey protein hydrolysate resolves the issue of remnant intact allergic protein, an additional problem appears, as the tolerogenic peptides do not permeate the ultrafiltration membrane. Therefore the beneficial tolerogenic properties will be lost.

[0150] The ultrafiltered whey protein hydrolysate or the whey protein hydrolysate preferably has a degree of hydrolysis (of the protein) between 5 and 50%, more preferably between 10 and 30%, even more preferably between 15 and 25%. The degree of hydrolysis is defined as the percentage of peptide bonds which have been broken down by enzymatic hydrolysis, with 100% being the total potential peptide bonds present. A too high degree of hydrolysis will result in an undesirable low level or even absence of tolerogenic peptides, whilst a too low degree of hydrolysis will deliver an undesirable high level of intact allergic protein. When not filtered out the intact protein may induce an allergic reaction. At the same time, filtration would result in unattractively low yields in case of an ultrafiltered whey protein hydrolysate with too low degree of hydrolysis (as too much protein remains in the retentate). Proteins with the abovementioned degree of hydrolysis provide sufficient peptides with a chain length of 2 to 30.

[0151] The peptide size and molecular weight distribution can be determined by routine methods known to the skilled person such as HPLC or size exclusion chromatography (SEC), in particular high performance size exclusion chromatography. Saint-Sauveur et al. Immunomodulating properties of a whey protein isolate, its enzymatic digest and peptide fractions Int. Dairy Journal (2008) vol. 18(3) pages 260-270 describes an example thereof. In short, the total surface area of the chromatograms is integrated and separated into mass ranges expressed as percentage of the total surface area. The mass ranges are calibrated using peptides/proteins with a known molecular mass. The protein hydrolysate comprising said peptides is preferably characterised in that it comprises between 55 and 85% peptides with a molecular weight below 1000 Da, between 15-45% peptides with a molecular weight between 1000 and below 5000 Da and between 0 and 1% of peptides or proteins with a molecular weight of 5000 Da and above, all based on total protein of the hydrolysate.

[0152] In a preferred embodiment the ultrafiltered whey protein hydrolysate is characterized in that the hydrolysate comprises peptides with the following size distribution: [0153] 60-90% with a size <1 kDa, [0154] 10-40% of peptides with a size of 1 to <5 kDa, [0155] 0-0.5% of peptides with a size of 5 to <10 kDa, and [0156] 0-0.2% of peptides with a size >10 kDa, [0157] based on the total protein of the hydrolysate.

[0158] In a preferred embodiment of the present invention the ultrafiltered whey protein hydrolysate is characterized in that it comprises less than 100 mg per gram protein, preferably less than 50 mg per gram protein, more preferably less than 10 mg per gram protein of peptides with a size above 5 kDa. Preferably the ultrafiltered whey protein hydrolysate comprises less than 30 mg per gram protein, preferably less than 10 mg per gram protein, most preferably less than 5 mg per gram protein of peptides with a size above 10 kDa.

[0159] Preferably, the ultrafiltered whey protein hydrolysate comprises at least 300 mg of peptides with a size of 1 kDa or below per gram protein, even more preferably at least 500 mg per gram protein. Preferably the ultrafiltered whey protein hydrolysate comprises at least 900 mg per gram protein of peptides with a size of 5 kDa or below, even more preferably at least 950 mg per gram protein, most preferably at least 990 mg per gram protein.

[0160] The ultrafiltered whey protein hydrolysate comprises no synthetic peptides, more preferably no synthetic tolerogenic peptides. The ultrafiltered whey protein hydrolysate does not comprise purified tolerogenic peptides. Purification of tolerogenic peptides and purified tolerogenic peptides are known in the art; a purification method and purified tolerogenic peptides is for example described in WO 00/42863.

Tolerogenic Peptides

[0161] The ultrafiltered whey protein hydrolysate comprises tolerogenic peptides. Tolerogenic peptides are peptides that induce immune tolerance towards undesirable activation of the immune response towards the protein of which the peptide is a fragment of. Betalactoglobulin is a known allergen. The amino acid 13-48 region of betalactoglobulin is known for its tolerogenic potential (Gouw et al., 2018, Clin. Exp. Allergy 48:1345-1253). In this study of Gouw et al. peptides having a sequence of in the 13-48 region of betalactoglobulin were found tolerogenic. WO 00/42863 A1 discloses betalactoglobulin peptides having a sequence of 8 overlapping amino acids with betalactoglobulin to be tolerogenic. WO 2011/151059 A1 discloses betalactoglobulin peptides having a sequence of 17 amino acids overlapping with the 13-48 region of betalactoglobulin to be tolerogenic. JP 2010/105915 A1 discloses betalactoglobulin peptides having a sequence of 19 amino acids having 8 AA overlap with the 13-48 region of betalactoglobulin to be tolerogenic. WO 2015/090347 A1 discloses betalactoglobulin peptides having a sequence of 6-9 amino acids having at least 7 AA overlap with the 13-48 region of betalactoglobulin to be tolerogenic. WO 2016/148572 A1 discloses betalactoglobulin peptides having at least 8 AA overlap with the 13-48 region of betalactoglobulin to be tolerogenic. In general the tolerogenic effect is related to that tolerogenic peptides are T-cell epitopes and bind to T-cells, for example on HLA-DR alleles. In this way oral tolerance is induced. For the tolerogenic peptides to efficiently act as T-cell epitope a minimum size of 8 AA is generally assumed.

[0162] Determination of amino acid sequence of betalactoglobulin peptides including tolerogenic peptides in the ultrafiltered whey protein hydrolysate can for example be determined according to Gouw et al., 2018, Clin. Exp. Allergy 48:1345-1253, optionally modified that instead of nanoLC-ESI MS2, micro LC-MS ESI MS2 is used.

[0163] In a preferred embodiment the ultrafiltered whey protein hydrolysate comprises at least one betalactoglobulin peptide comprising an amino acid sequence with a length of 8 amino acids according to any one SEQ ID no. 2-30, more preferably the ultrafiltered whey protein hydrolysate comprises at least one betalactoglobulin peptide comprising an amino acid sequence with a length of 10 amino acids according to any one SEQ ID no. 31-57. Preferably the ultrafiltered whey protein hydrolysate comprises at least two, even more preferably at least three peptides comprising an amino acid sequence according to any one of SEQ ID no. 2-30. More preferably the ultrafiltered whey protein hydrolysate comprises at least two, even more preferably at least three peptides comprising an amino acid sequence according to any one of SEQ ID no. 31-57.

[0164] In a further preferred embodiment, the ultrafiltered whey protein hydrolysate comprises at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 58-70, more preferably the ultrafiltered whey protein hydrolysate comprises at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 66-70, most preferably the ultrafiltered whey protein hydrolysate comprises at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 66 and 68-70. In a most preferred embodiment, the ultrafiltered whey protein hydrolysate comprises at least two, preferably at least three, more preferably at least four, even more preferably at least five of the betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No 58-70.

[0165] In a further preferred embodiment, the ultrafiltered whey protein hydrolysate comprises at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 2-24, 31-51 and 66-70, even more preferably according to any one of SEQ ID no. 31-51 and 66-70, particularly preferably according to any one of SEQ ID no. 2-17, 31-44, 66 and 68-70, even more preferably according to any one of SEQ ID no. 31-44, 66 and 68-70.

[0166] More preferably, the ultrafiltered whey protein hydrolysate comprises at least two, even more preferably at least three peptides comprising an amino acid sequence according to any one of SEQ ID No. 2-70, preferably according to any one of SEQ ID No. 31-70. More preferably, the ultrafiltered whey protein hydrolysate comprises at least two, even more preferably at least three peptides comprising an amino acid sequence according to any one of SEQ ID no. 2-24, 31-51 and 66-70. Even more preferably, the ultrafiltered whey protein hydrolysate comprises at least two, even more preferably at least three peptides comprising an amino acid sequence according to any one of SEQ ID no. 31-51 and 66-70. More preferably, the ultrafiltered whey protein hydrolysate comprises at least two, even more preferably at least three peptides comprising an amino acid sequence according to any one of SEQ ID no. 2-17, 31-44, 66 and 68-70. More preferably, the ultrafiltered whey protein hydrolysate comprises at least two, even more preferably at least three peptides comprising an amino acid sequence according to any one of SEQ ID no. 31-44, 66 and 68-70, most preferably according to any of SEQ ID no. 66 and 68-70.

[0167] In a preferred embodiment, the ultrafiltered whey protein hydrolysate comprises at least one betalactoglobulin peptide comprising an amino acid sequence according to any one of SEQ ID No. 2-57 and 66-70, preferably according to any one of SEQ ID No. 31-57 and 66-70, even more preferably according to any one of SEQ ID no. 31-51 and 66-70. More preferably, the ultrafiltered whey protein hydrolysate comprises at least two, even more preferably at least three peptides comprising an amino acid sequence according to any one of SEQ ID No. 2-57 and 66-70. More preferably, the ultrafiltered whey protein hydrolysate comprises at least two, even more preferably at least three peptides comprising an amino acid sequence according to any one of SEQ ID No. 31-57 and 66-70. More preferably, the ultrafiltered whey protein hydrolysate comprises at least two, even more preferably at least three peptides comprising an amino acid sequence according to any one of SEQ ID no. 31-51 and 66-70.

[0168] The at least one specific betalactoglobulin peptide is preferably a natural peptide. A natural peptide is defined as being obtained from hydrolysis of naturally occurring protein. A synthetic peptide is defined as being chemically synthesized.

[0169] Throughout the specification and claims, the amino acid sequences of the BLG-peptides with SEQ ID NO: 1-70 are identified here below:

TABLE-US-00001 SEQIDNO:1 AA1-48 XIVTQTMKGLDIQKVAGTWY SLAMAASDISLLDAQSAPLR VYVEELKP SEQIDNO:2 AA13-20 QKVAGTWY SEQIDNO:3 AA14-21 KVAGTWYS SEQIDNO:4 AA15-22 VAGTWYSL SEQIDNO:5 AA16-23 AGTWYSLA SEQIDNO:6 AA17-24 GTWYSLAM SEQIDNO:7 AA18-25 TWYSLAMA SEQIDNO:8 AA19-26 WYSLAMAA SEQIDNO:9 AA20-27 YSLAMAAS SEQIDNO:10 AA21-28 SLAMAASD SEQIDNO:11 AA22-29 LAMAASDI SEQIDNO:12 AA23-30 AMAASDIS SEQIDNO:13 AA24-31 MAASDISL SEQIDNO:14 AA25-32 AASDISLL SEQIDNO:15 AA26-33 ASDISLLD SEQIDNO:16 AA27-34 SDISLLDA SEQIDNO:17 AA28-35 DISLLDAQ SEQIDNO:18 AA29-36 ISLLDAQS SEQIDNO:19 AA30-37 SLLDAQSA SEQIDNO:20 AA31-38 LLDAQSAP SEQIDNO:21 AA32-39 LDAQSAPL SEQIDNO:22 AA33-40 DAQSAPLR SEQIDNO:23 AA34-41 AQSAPLRV SEQIDNO:24 AA35-42 QSAPLRVY SEQIDNO:25 AA36-43 SAPLRVYV SEQIDNO:26 AA37-44 APLRVYVE SEQIDNO:27 AA38-45 PLRVYVEE SEQIDNO:28 AA39-46 LRVYVEEL SEQIDNO:29 AA40-47 RVYVEELK SEQIDNO:30 AA41-48 VYVEELKP SEQIDNO:31 AA13-22 QKVAGTWYSL SEQIDNO:32 AA14-23 KVAGTWYSLA SEQIDNO:33 AA15-24 VAGTWYSLAM SEQIDNO:34 AA16-25 AGTWYSLAMA SEQIDNO:35 AA17-26 GTWYSLAMAA SEQIDNO:36 AA18-27 TWYSLAMAAS SEQIDNO:37 AA19-28 WYSLAMAASD SEQIDNO:38 AA20-29 YSLAMAASDI SEQIDNO:39 AA21-30 SLAMAASDIS SEQIDNO:40 AA22-31 LAMAASDISL SEQIDNO:41 AA23-32 AMAASDISLL SEQIDNO:42 AA24-33 MAASDISLLD SEQIDNO:43 AA25-34 AASDISLLDA SEQIDNO:44 AA26-35 ASDISLLDAQ SEQIDNO:45 AA27-36 SDISLLDAQS SEQIDNO:46 AA28-37 DISLLDAQSA SEQIDNO:47 AA29-38 ISLLDAQSAP SEQIDNO:48 AA30-39 SLLDAQSAPL SEQIDNO:49 AA31-40 LLDAQSAPLR SEQIDNO:50 AA32-41 LDAQSAPLRV SEQIDNO:51 AA33-42 DAQSAPLRVY SEQIDNO:52 AA34-43 AQSAPLRVYV SEQIDNO:53 AA35-44 QSAPLRVYVE SEQIDNO:54 AA36-45 SAPLRVYVEE SEQIDNO:55 AA37-46 APLRVYVEEL SEQIDNO:56 AA38-47 PLRVYVEELK SEQIDNO:57 AA39-48 LRVYVEELKP SEQIDNO:58 AA1-22 XIVTQTMKGL DIQKVAGTWY SL SEQIDNO:59 AA1-25 XIVTQTMKGL DIQKVAGTWY SLAMA SEQIDNO:60 AA1-26 XIVTQTMKGL DIQKVAGTWY SLAMAA SEQIDNO:61 AA1-30 XIVTQTMKGL DIQKVAGTWY SLAMAASDIS SEQIDNO:62 AA1-35 XIVTQTMKGL DIQKVAGTWY SLAMAASDIS LLDAQ SEQIDNO:63 AA1-39 XIVTQTMKGL DIQKVAGTWY SLAMAASDIS LLDAQSAPL SEQIDNO:64 AA1-42 XIVTQTMKGL DIQKVAGTWY SLAMAASDIS LLDAQSAPLR VY SEQIDNO:65 AA5-35 QTMKGLDIQK VAGTWYSLAM AASDISLLDA Q SEQIDNO:66 AA1-27 XIVTQTMKGL DIQKVAGTWY SLAMAAS SEQIDNO:67 AA11-42 DIQKVAGTWY SLAMAASDIS LLDAQSAPLR VY SEQIDNO:68 AA6-35 TMKGLDIQKV AGTWYSLAMA ASDISLLDAQ SEQIDNO:69 AA6-32 TMKGLDIQKV AGTWYSLAMA ASDISLL SEQIDNO:70 AA1-32 XIVTQTMKGL DIQKVAGTWY SLAMAASDIS LL SEQIDNO:71 AA13-30 QKVAGTWYSL AMAASDIS SEQIDNO:72 AA19-36 WYSLAMAASD ISLLDAQS SEQIDNO:73 AA25-42 AASDISLLDA QSAPLRVY SEQIDNO:74 AA31-48 LLDAQSAPLR VYVEELKP

[0170] Herein, X defines an amino acid selected from leucine (L) or isoleucine (I), preferably X is leucine. The choice for X being either leucine or isoleucine is a direct consequence of the source of mammalian milk. Leucine is preferred, since mammalian milk from the genus Bos, preferably cow's milk, is most preferred.

[0171] In a preferred embodiment of the present invention, the ultrafiltered whey protein hydrolysate comprises, at least 10 microgram per gram of protein, more preferably at least 50 microgram per gram protein, even more preferably at least 100 microgram per gram protein of the sum of betalactoglobulin peptides comprising an amino acid sequence according to any one of SEQ ID No. 2-70, preferably according to any one of SEQ ID No. 31-70. Preferably the ultrafiltered whey protein hydrolysate comprises 10 to 50,000 microgram per gram protein, more preferably 20 to 20000 microgram per gram protein, more suitable 30 to 10,000 microgram per gram protein and particularly preferably 50 to 5,000 microgram per gram protein of the sum of betalactoglobulin peptides comprising an amino acid sequence according to any one of SEQ ID No. 2-70, preferably according to any one of SEQ ID No. 31-70. The betalactoglobulin derived peptides are preferably present in therapeutically effective amounts.

[0172] In a preferred embodiment of the present invention, the ultrafiltered whey protein hydrolysate comprises, at least 10 microgram per gram of protein, more preferably at least 50 microgram per gram protein, even more preferably at least 100 microgram per gram protein of the sum of betalactoglobulin peptides comprising an amino acid sequence with a length of 8 amino acids according to any one SEQ ID no. 2-30, more preferably an amino acid sequence with a length of 10 amino acids according to any one SEQ ID no. 31-57.

Allergic Betalactoglobulin

[0173] Preferably the ultrafiltered whey protein hydrolysate comprises less than 6 microgram allergenic betalactoglobulin per g protein, more preferably less than 0.8 microgram allergenic betalactoglobulin per g protein, most preferably less than 0.2 microgram per g protein. In the context of the invention, the expression allergenic betalactoglobulin refers to intact or immunogenic betalactoglobulin, and does not account for the hydrolyzed betalactoglobulin. For sake of comparison, an ultrafiltered hydrolyzed whey protein exhibits less than 0.2 microgram allergenic betalactoglobulin per g protein. Allergenic betalactoglobulin can be determined by methods as known in the art, such as Elisa.

Emulsifier

[0174] Food emulsifiers act as an interface between the conflicting components of food like water and oil. To make the two components compatible, emulsifiers are used. Not bound by the theory, the inventors speculate emulsifiers may prevent clustering of tolerogenic peptides or break up clusters of tolerogenic peptides, enabling these peptides to permeate the ultrafiltration membrane. Examples of emulsifiers are phospholipids, magnesium stearate and sodium, potassium and calcium salts of fatty acids. Further examples are lecithin's such as soy lecithin, calcium stearoyl-2-lactylate (CSL), polyglycerol esters (PGE), sorbitan esters (SOE) such as sorbitan monostearate, propylene glycol monoesters (PGME), sucrose esters (SE/E473), monoglycerides/monoacylglycerols (MAG), diglycerides/diacylglycerols (DAG), phosphated monoglycerides, acetylated monoglycerides (AMG), lactylated monoglycerides (LMG), diacetyl tartaric acid esters of mono- and diglycerides (Datem), citric acid esters of mono and diglycerides (Citrem). A criterion is that the food emulsifier should be suited for use in infant and follow-on formula. In the context of the current invention preferably the emulsifier is selected from the group consisting of Citrem, Datem, MAG, DAG, SE (E473) and soy lecithin, and combinations thereof, more preferably is or comprises Citrem. Preferably the ultrafiltered whey protein hydrolysate comprises an emulsifier selected from the group consisting of Citrem, Datem, MAG, DAG SE (E473) and soy lecithin, and combinations thereof, more preferably is or comprises Citrem.

[0175] Preferably the emulsifier is added in the process for preparing an ultrafiltered whey protein hydrolysate in a concentration of at least 50 mg per gram protein to which it is added, more preferably at least 100 mg per gram protein, most preferably 150-500 mg per gram protein. Preferably the emulsifier is added in the process for preparing an ultrafiltered whey protein hydrolysate in a concentration of at least 1 g per liter, more preferably at least 2 g per liter, most preferably 2-20 g per liter, particularly 5-15 g per liter.

[0176] Preferably the emulsifier is added in the process for preparing an ultrafiltered whey protein hydrolysate prior to hydrolysis and/or during hydrolysis, more preferably prior to hydrolysis.

Chaotropic Agent

[0177] In one embodiment a chaotropic agent is used as a component to ensure the tolerogenic betalactoglobuline peptides pass the membrane filter. A chaotropic agent is a substance which disrupts the structure of and denatures, macromolecules such as proteins. Common chaotropic agents suitable in the manufacturing process of the invention include n-butanol, ethanol, guanidinium chloride, lithium perchlorate, lithium acetate, magnesium chloride, phenol, 2-propanol, thiourea, SDS and urea. For the current invention, preferably the chaotropic agent is or comprises urea. Chaotropic agents may solubilize the peptide aggregates after the hydrolysis and/or prevent the formation of peptide aggregates.

[0178] As chaotropic agents may have a denaturing effect on all proteins (including proteolytic enzymes), the chaotropic agent is preferably added only after hydrolysis 1.

[0179] The ultrafiltered whey protein hydrolysate and/or the process for preparing an ultrafiltered whey protein hydrolysate according to the present invention preferably comprises urea as chaotropic agent, marking the use of urea in the manufacturing process. Urea is also known as carbamide, CO(NH2)2. Urea is commercially available from various sources in food-grade quality, for example from NuGenTec, CA USA, Spectrum chemical, USA, or it can be enriched from cow's milk as disclosed in U.S. Pat. No. 6,506,305.

[0180] According to the present invention, in one embodiment the chaotropic agent is used in the process of the invention in an amount of at least 10 g chaotropic agent per 100 ml, more preferably 20-100 g chaotropic agent per 100 ml, preferably urea. Preferably, the chaotropic agent is provided in the process of the invention in an amount of at least 5 g chaotropic agent per gram protein to which it is added, preferably 5-20 g per gram protein. The ultrafiltered whey protein hydrolysate preferably comprises 1 to 25 g chaotropic agent (preferably urea) per gram protein, more preferably 5 to 20 g per gram protein, more preferably 7 to 15 g per gram protein. Preferably, the ultrafiltered whey protein hydrolysate comprises at least 1 g per 100 ml, more preferably 5 to 80 g chaotropic agent per 100 ml, most preferably to 60 g chaotropic agent per 100 ml.

[0181] According to the present invention, in another preferred embodiment the chaotropic agent is used in the process of the invention in an amount of at least 1 g chaotropic agent (preferably urea) per 100 ml, more preferably of at least 3 g chaotropic agent per 100 ml, even more preferably 1-10 g chaotropic agent per 100 ml, preferably urea. Preferably, the chaotropic agent is provided in the process of the invention in an amount of at least 25 mg chaotropic agent per gram protein to which it is added, preferably 50-200 mg per gram protein. Preferably the ultrafiltered whey protein hydrolysate comprises 10 to 250 mg chaotropic agent (preferably urea) per gram protein, more preferably 20 to 200 mg per gram protein, more preferably 50 to 150 mg per gram protein. Alternatively or additionally, the ultrafiltered whey protein hydrolysate comprises at least 10 mg chaotropic agent (preferably urea) per gram dry weight, preferably at least 50 mg per gram dry weight, more preferably at least 100 mg per gram dry weight. In a further embodiment according to the present invention, the ultrafiltered whey protein hydrolysate comprises at least 15 mg per 100 ml, more preferably 15 to 75 mg chaotropic agent per 100 ml.

Lactic Acid Producing Bacteria

[0182] The nutritional composition according to the invention preferably comprises a strain of lactic acid producing bacterium species, which enhances the oral immune tolerogenic capacity of the betalactoglobulin peptides of the invention. The bacterium strain is preferably a probiotic. Evidence of synergy is attached in the examples. The presence of lactic acid producing bacteria was found to increase the expression of HLA-DR molecules on the surface of the dendritic cells. An increased expression of HLA-DR is also indicative for an improved presentation of peptides to T cells, and hence oral immune tolerance induction and is indicative for treatment and/or prevention of allergy as defined herein. Suitable lactic acid producing bacteria include strains of the genus Bifidobacteria (e.g. B. breve, B. longum, B. infantis, B. bifidum), Lactobacillus (e.g. L. acidophilus, L. paracasei, L. johnsonii, L. plantarum, L. reuteri, L. rhamnosus, L. casei, L. lactis), and Streptococcus (e.g. S. thermophilus). Bifidobacterium breve and Bifidobacterium longum are especially suitable lactic acid producing bacteria.

[0183] The nutritional composition according to the invention preferably comprises a strain of lactic acid-producing bacterium belonging to the genus Bifidobacterium, preferably to the species Bifidobacterium breve. The B. breve preferably has at least 95% identity of the 16 S rRNA sequence when compared to the type strain of B. breve ATCC 15700, more preferably at least 97% identity (Stackebrandt & Goebel, 1994, Int. J. Syst. Bacteriol. 44:846-849). Suitable B. breve strains may be isolated from the faeces of healthy human milk-fed infants. Typically, these are commercially available from producers of lactic acid bacteria, but they can also be directly isolated from faeces, identified, characterised and produced. According to one embodiment, the nutritional composition contains a B. breve selected from the group consisting of B. breve Bb-03 (Rhodia/Danisco), B. breve M-16V (Morinaga), B. breve R0070 (Institute Rosell, Lallemand), B. breve BR03 (Probiotical), B. breve BR92) (Cell Biotech), DSM 20091, LMG 11613, YIT4065, FERM BP-6223 and CNCM I-2219. B. breve can be B. breve M-16V and B. breve CNCM I-2219, most preferably B. breve M-16V. B. breve I-2219 was published in WO 2004/093899 and was deposited at the Collection Nationale de Cultures de Microorganisms, Institute Pasteur, Paris, France on 31 May 1999 by Compagnie Gervais Danone. B. breve M-16V was deposited as BCCM/LMG23729 and is commercially available from Morinaga Milk Industry Co., Ltd.

[0184] The lactic acid producing bacterium may be present in the nutritional composition at any suitable concentration, preferably in a therapeutically effective amount or amount effective for treating/prevention in the context of the invention. Preferably, the lactic acid producing bacterium strain is included in the nutritional composition in an amount of 104-1013 cfu per g dry weight of the nutritional composition, preferably 105-1011 cfu/g, most preferably 106-1010 cfu/g.

Non-Digestible Oligosaccharides

[0185] In a preferred embodiment, the nutritional composition of the invention additionally comprises one or more non-digestible oligosaccharides [NDO]. Like the lactic acid-producing bacteria, these further increase the oral immune tolerance inducing properties of peptides of the betalactoglobulin protein and improve treatment and/or prevention of allergy as defined herein. Evidence of an enhanced effect is given in PCT/NL2019/050237 and in the experimental section.

[0186] Advantageously and most preferred, the non-digestible oligosaccharide is water-soluble (according to the method disclosed in L. Prosky et al, J. Assoc. Anal. Chem 71: 1017-1023, 1988) and is preferably an oligosaccharide with a degree of polymerisation (DP) of 2 to 200. The average DP of the non-digestible oligosaccharide is preferably below 200, more preferably below 100, even more preferably below 60, most preferably below 40.

[0187] The non-digestible oligosaccharide is preferably a prebiotic. It is not digested in the intestine by the action of digestive enzymes present in the human upper digestive tract (small intestine and stomach). The non-digestible oligosaccharide is fermented by the human intestinal microbiota. For example, glucose, fructose, galactose, sucrose, lactose, maltose and the maltodextrins are considered digestible. The oligosaccharide raw materials may comprise monosaccharides such as glucose, fructose, fucose, galactose, rhamnose, xylose, glucuronic acid, GalNac etc., but these are not part of the oligosaccharides. The non-digestible oligosaccharide is preferably selected from the group consisting of fructooligosaccharide, non-digestible dextrin, galactooligosaccharide, xylooligosaccharide, arabino-oligosaccharide, arabinogalacto-oligosaccharide, gluco-oligosaccharide, glucomanno-oligosaccharide, galactomanno-oligosaccharide, mannan-oligosaccharide, chito-oligosaccharide, uronic acid oligosaccharide, sialyloligosaccharide and fucooligosaccharide, and mixtures thereof, preferably fructo-oligosaccharides. Examples of sialyloligosaccharide are 3-sialyllactose, 6 sialyllactose, sialyllacto-N-tetraoses, disialyllactoNtertraoses. Examples of fucooligosaccharides are (un)sulphated fucoidan oligosaccharides, 2fucosyllactose, 3 fucosyllactose, lacto-N-fucopentaose I, II, III, LNDH, lactodifucotetraose, lacto-N difucohexaose I and II.

[0188] One suitable type of oligosaccharide is a short-chain oligosaccharide which has an average degree of polymerisation of less than 10, preferably at most 8, preferably in the range of 2-7. The short-chain oligosaccharide preferably comprises galacto-oligosaccharides and/or fructo-oligosaccharides (i.e. scGOS and/or scFOS). In one embodiment, the nutritional composition comprises galacto-oligosaccharides, preferably beta-galacto-oligosaccharides, preferably trans-galacto-oligosaccharides. The galacto-oligosaccharides preferably have an average degree of polymerisation in the range of 2-8, preferably 3-7, i.e. are short-chain oligosaccharides in the context of the invention. (Trans)galactooligosaccharides are for example available under the trade name Vivinal?GOS (Friesland Campina Domo Ingredients, Netherlands), Bimuno (Clasado), Cup-oligo (Nissin Sugar) and Oligomate55 (Yakult). The nutritional composition preferably comprises short-chain fructo-oligosaccharides and/or short-chain galacto-oligosaccharides, preferably at least short-chain fructo-oligosaccharides. Fructooligosaccharides may be inulin hydrolysate products having an average DP within the aforementioned (sub-) ranges; such FOS products are for instance commercially available as Raftilose P95 (Orafti) or with Cosucra.

[0189] Another suitable type of oligosaccharide is long-chain fructo-oligosaccharides (IcFOS) which has an average degree of polymerisation above 10, typically in the range of 10-100, preferably 15-50, most preferably above 20. A particular type of long-chain fructo-oligosaccharides is inulin, such as Raftilin HP.

[0190] The nutritional composition may contain a mixture of two or more types of non-digestible oligosaccharides, most preferably a mixture of two non-digestible oligosaccharides. In case the NDO comprises or consists of a mixture of two distinct oligosaccharides, one oligosaccharide may be short-chain as defined above and one oligosaccharide may be long-chain as defined above. Most preferably, short-chain oligosaccharides and long-chain oligosaccharides are present in a weight ratio short-chain to long-chain in the range of 1:99-99:1, more preferably 1:1-99:1, more preferably 4:1-97:3, even more preferably 5:1-95:5, even more preferably 7:1-95:5, even more preferably 8:1-10:1, most preferably about 9:1.

[0191] In one embodiment, the nutritional composition comprises at least two of fructo-oligosaccharides and/or galacto-oligosaccharides. Suitable mixtures include mixtures of long-chain fructo-oligosaccharides with short-chain fructo-oligosaccharides or with short-chain galacto-oligosaccharides, most preferably long-chain fructo-oligosaccharides with short-chain fructo-oligosaccharides.

[0192] The nutritional composition preferably comprises 0.05 to 20 wt % of said non-digestible oligosaccharides, more preferably 0.5 to 15 wt %, even more preferably 1 to 10 wt %, most preferably 2 to 10 wt %, based on dry weight of the nutritional composition. When in liquid form, the nutritional composition preferably comprises 0.01 to 2.5 wt % non-digestible oligosaccharide, more preferably 0.05 to 1.5 wt %, even more preferably 0.25 to 1.5 wt %, most preferably 0.5-1.25 wt %, based on 100 ml.

[0193] In one embodiment, the NDO mixture does not comprises any detectable amounts of acid oligosaccharides.

[0194] When the non-digestible oligosaccharide is a mixture, the averages of the respective parameters are used for defining the present invention.

[0195] The combination of a NDO and a lactic acid producing bacterium as defined here above is also referred to as a synbiotic. The presence of therapeutically effective amounts of the NDO together with the lactic acid-producing bacterium are believed to further improve the oral immune tolerance inducing properties and the effect on treatment and/or prevention of allergy of a strain of Bifidobacterium, preferably B. breve, together with fructo-oligosaccharides.

Other Components

[0196] The nutritional composition of the current invention may further comprise long chain polyunsaturated fatty acids (LC-PUFA). LC-PUFA are fatty acids wherein the acyl chain has a length of 20 to 24 carbon atoms (preferably 20 or 22 carbon atoms) and wherein the acyl chain comprises at least two unsaturated bonds between said carbon atoms in the acyl chain. More preferably the nutritional composition comprises at least one LC-PUFA selected from the group consisting of eicosapentaenoic acid (EPA, 20:5 n3), docosahexaenoic acid (DHA, 22:6 n3), arachidonic acid (ARA, 20:4 n6) and docosapentaenoic acid (DPA, 22:5 n3), preferably DHA, EPA and/or ARA. Such LC-PUFAs have a further beneficial effect on reducing the risk for allergy.

[0197] The preferred content of LC-PUFA in the nutritional composition does not exceed 15 wt. % of total fatty acids, preferably does not exceed 10 wt. %, even more preferably does not exceed 5 wt. %. Preferably the nutritional composition comprises at least 0.2 wt. %, preferably at least 0.25 wt. %, more preferably at least 0.35 wt. %, even more preferably at least 0.5 wt. % LC-PUFA of total fatty acids, more preferably DHA. The nutritional composition preferably comprises ARA and DHA, wherein the weight ratio ARA/DHA preferably is above 0.25, preferably above 0.5, more preferably 0.75-2, even more preferably 0.75-1.25. The weight ratio is preferably below 20, more preferably between 0.5 and 5. The amount of DHA is preferably above 0.2 wt %, more preferably above 0.3 wt %, more preferably at least 0.35 wt %, even more preferably 0.35-0.6 wt % on total fatty acids.

Nutritional Composition

[0198] The nutritional composition according to the invention can be used as a nutritional therapy, nutritional support, as a medical food, as a food for special medical purposes or as a nutritional supplement. The nutritional composition is preferably an enteral (oral) composition. The nutritional composition is administered orally to, or intended to be administered orally to, a subject in need thereof, in particular to children and infants, including toddlers, preferably children up to 6 years of age, preferably infants or young children typically with an age of 0-36 months, more preferably infants 0-12 months of age, most preferably 0-6 months of age. Thus, in some embodiments, the nutritional composition is an infant formula, follow-on formula or young child formula (also referred to as growing-up milk), preferably it is an infant formula or follow-on formula, most preferably an infant formula. The terms infant formula and follow-on formula are well-defined and controlled internationally and consistently by regulatory bodies. In particular, CODEX STAN 73-1981 Standard For Infant Formula and Formulas For Special Medical Purposes Intended for Infants is widely accepted. It recommends for nutritional value and formula composition, which require the prepared milk to contain per 100 ml not less than 60 kcal (250 kJ) and no more than 70 kcal (295 kJ) of energy. FDA and other regulatory bodies have set nutrient requirements in accordance therewith.

[0199] Preferably, the nutritional composition of the invention is for providing the daily nutritional requirements to a human, in particular for administration to, in particular for feeding, humans, in particular infants including toddlers, preferably at risk for developing bovine, ovine and/or caprine milk protein allergy, preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein allergy. In one embodiment, the milk protein allergy concerns milk from a particular mammalian species and the ultrafiltered whey protein hydrolysate comprised in the nutritional composition is from the same mammalian species, preferably both are from the genus Bos.

[0200] In order to meet the caloric requirements of the infant, the nutritional composition of the invention preferably comprises 50 to 200 kcal/100 ml liquid, more preferably 60 to 90 kcal/100 ml liquid, even more preferably 60 to 75 kcal/100 ml liquid. This caloric density ensures an optimal ratio between water and calorie consumption. The osmolarity of the nutritional composition is preferably between 150 and 420 mOsmol/l, more preferably 260 to 320 mOsmol/l. The low osmolarity aims to reduce the gastrointestinal stress.

[0201] Preferably, the nutritional composition of the invention is in a liquid form, preferably with a viscosity below 35 mPa.Math.s, more preferably below 6 mPa.Math.s as measured in a Brookfield viscometer at 20? C. at a shear rate of 100 s-1. Suitably, the nutritional composition is in a powdered form, which preferably can be reconstituted with water to form a liquid, or in a liquid concentrate form, which should be diluted with water. When the nutritional composition is in a liquid form, the preferred volume administered on a daily basis is in the range of about 80 to 2500 ml, more preferably about 450 to 1000 ml per day.

[0202] The nutritional composition according to the invention comprises a lipid component, preferably a lipid component suitable for infant nutrition as known in the art. The lipid component of the nutritional composition preferably provides 2.9 to 6.0 g, more preferably 4 to 6 g per 100 kcal of the nutritional composition. When in liquid form, the nutritional composition preferably comprises 2.1 to 6.5 g lipid per 100 ml, more preferably 3.0 to 4.0 g per 100 ml. Based on dry weight the present infant or follow-on formula preferably comprises 12.5 to 40 wt % lipid, more preferably 19 to 30 wt %.

[0203] The nutritional composition according to the invention may comprise further proteinaceous material, in addition to the beta-lactoglobulin-derived peptide(s) according to the invention. In the context of the present invention the additional protein or proteinaceous material or protein equivalents encompasses proteins, peptides, free amino acids and partially or extensively hydrolysed proteins. Preferably, the further proteinaceous material-additional to the ultrafiltered whey protein hydrolysatedoes not evoke an allergic reaction or is hypoallergenic, such as free amino acids, and hydrolysed protein. As a further protein component, i.e. apart from the ultrafiltered whey protein hydrolysate, the nutritional composition according to the present invention may comprise free amino acids. The nutritional composition according to the present invention preferably contains less than 1 wt % intact mammalian (cow)'s milk protein. The nutritional composition may comprise an additional protein component selected from the group consisting of free amino acids and proteins from other sources such as soy, pea, rice, collagen or the like, in intact form, in partially hydrolysed form, and/or in extensively hydrolysed form. In a most preferred embodiment, the composition is free from protein component other than the ultrafiltered whey protein hydrolysate. That is, it is preferred that the ultrafiltered whey protein hydrolysate is the sole source of proteinaceous material in the composition.

[0204] The nutritional composition preferably contains 4 to 25%, more preferably 5 to 20%, more preferably 7 to 16%, most preferably 7 to 12% protein, based on total calories. The nutritional composition, when in liquid form, preferably contains 0.5 to 6.0 g, more preferably 0.8 to 3.0 g, even more preferably 1.0 to 2.5 g of protein per 100 ml. The nutritional composition preferably comprises at least 7.0 wt %, more preferably at least 8.0 wt %, most preferably at least 9 or at least 10 wt % protein based on dry weight of the total composition. Preferably, the nutritional composition comprises at most 40 wt %, more preferably at most 15 wt %, preferably at most 20 wt % of protein based on dry weight of the total composition.

[0205] The nutritional composition comprises digestible carbohydrate(s). Typically, digestible carbohydrates that are known in the art to be suitable for use in infant nutritional compositions are used, for example selected from digestible polysaccharides (e.g. starch, maltodextrin), digestible monosaccharides (e.g. glucose, fructose), and digestible disaccharides (e.g. lactose, sucrose). Particularly suitable is lactose and/or maltodextrin. In one embodiment, the nutritional composition does not comprise lactose. The digestible carbohydrate component preferably comprises at least 60 wt % lactose based on total digestible carbohydrate, more preferably at least 75 wt %, even more preferably at least 90 wt % lactose based on total digestible carbohydrate.

Human Subjects

[0206] The human subjects or population targeted is children and infants, including toddlers, preferably children up to 6 years of age, preferably infants or young children typically with an age of 0-36 months, more preferably infants 0-12 months of age, most preferably 0-6 months of age. In one preferred embodiment, the subject is at risk of developing allergy, preferably food allergy, preferably bovine, ovine and/or caprine milk protein allergy, preferably milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein allergy, preferably infants suffering from milk protein allergy preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein allergy. Infants at risk are preferably determined by the family history, preferably at least one parent being or having a history of being allergic. In one aspect, the invention thus relates to the primary prevention of allergy as defined here above.

[0207] In a more preferred embodiment, the invention relates to the secondary prevention of allergy as defined here above.

[0208] In one aspect, the subject suffers from allergy, preferably food allergy, preferably bovine, ovine and/or caprine milk protein allergy, preferably milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein allergy, preferably infants suffering from milk protein allergy preferably against milk protein from a species of the genus Bos, Bison, Bubalus or Capra, more preferably from genus Bos, most preferably cow's milk protein allergy.

[0209] The invention pertains to the use of the ultrafiltered whey protein hydrolysate or a composition comprising said ultrafiltered whey protein hydrolysate according to the invention in the manufacture of a product for: [0210] (i) providing nutrition to; and/or [0211] (ii) treating/preventing allergy as defined here above in; and/or [0212] (iii) inducing oral immune tolerance against an allergen, preferably a food allergen, in subjects as defined here above. The use is preferably directed to (ii) and/or (iii).

[0213] The invention also pertains to ultrafiltered whey protein hydrolysate or a composition comprising said ultrafiltered whey protein hydrolysate as defined here above, for use in: [0214] (i) providing nutrition to; and/or [0215] (ii) treating/preventing allergy as defined here above in; and/or [0216] (iii) inducing oral immune tolerance against an allergen, preferably a food allergen, in subjects as defined here above. The use is preferably directed to (ii) and/or (iii).

[0217] Worded differently, the invention also pertains to a method for: [0218] (i) providing nutrition to; and/or [0219] (ii) treating/preventing allergy as defined here above in; and/or [0220] (iii) inducing oral immune tolerance against an allergen, preferably a food allergen, in subjects as defined here above, wherein said subject is administered ultrafiltered whey protein hydrolysate or a composition comprising said ultrafiltered whey protein hydrolysate. The method is preferably directed to (ii) and/or (iii). In case of a method for (i) providing nutrition, the method is preferably a non-therapeutic method.

EXAMPLES

Example 1: A Membrane Filtration Step of Hydrolysed Whey Protein Results in Retention of Tolerogenic Betalactoglobulin Peptides

[0221] In a Multifors reactor (Infors HT) 500 gram of whey protein powder (WPC83, Arla Foods, with about 80% whey protein) was dissolved in water at a final concentration of about 4 wt % at a temperature of about 75? C., giving a protein concentration of about 3.2 wt %. After dissolving the mixture was cooled to 58? C. and the pH was adjusted to neutral (pH 7-8). Proteolytic enzymes were added (Trypsin, Neova Technologies Inc) to a concentration of 33 mg/100 g solution and hydrolysis took place for about 105 min under continuous stirring. During hydrolysis the pH was kept constant. After hydrolysis the mixture was quickly cooled to 4? C.

[0222] Next the mixture of whey protein hydrolysate and proteolytic enzymes was filtrated. 200 ml of the mixture (the feed) was filtrated for 20 minutes on a MMS Triple System membrane filtration unit (MMS AG Membrane Systems) provided with an ultrafiltration membrane from Koch (Koch: HFK-131, a flat sheet polyethersulfone ultrafiltration membrane with a molecular weight cut off of 10 kDa) under a pressure of 8 bars. A one-layer filtration setup was used and the retentate was circulated during filtration. Each membrane was used only once to promote reproducibility. The filtration cooling system was set to 15? C. The permeate was weighted, MMS filtration software was used for the registering of the permeate throughput. Samples were taken of the mixture before membrane filtration (the feed), and of the permeate and retentate after the membrane filtration step. About 93% of permeate (wt % of total feed) was produced comprising about 85 wt % of peptides (wt % of the peptides in the feed). Samples were stored at ?50? C. for further analysis.

[0223] The presence of tolerogenic betalactoglobulin peptides in the samples was analyzed according to Gouw et al., 2018, Clin. Exp. Allergy 48:1345-1253, with the modification that instead of nanoLC-ESI MS2, micro LC-MS ESI MS2 was used. The presence of 5 specific peptides was tested (region overlapping with the 13-48 AA acid region of betalactoglobulin in bold):

TABLE-US-00002 Peptide1:AA1-27; LIVTQTMKGLDIQKVAGTWYSLAMAAS Peptide2:AA11-42; DIQKVAGTWYSLAMAASDISLLDAQSAPLRVY Peptide3:AA6-35; TMKGLDIQKVAGTWYSLAMAASDISLLDAQ Peptide4:AA6-32; TMKGLDIQKVAGTWYSLAMAASDISLL Peptide5:AA1-32; LIVTQTMKGLDIQKVAGTWYSLAMAASDISLL ThesepeptidescorrespondtoSEQIDNOs 66-70,respectively,withXbeingL.

[0224] It was found that these betalactoglobulin peptides were detected in the hydrolysate mixture before the membrane filtration step and in the retentate, but not in the permeate. As a result of the membrane filtration step, the amount of allergic beta-lactoglobulin in the permeate was lower than 0.2 microgram/gram protein and the amount of peptides larger than 10 kDa in the permeate was lower than 1 mg/gram protein. Both parameters can be determined by methods known in the art (ELISA and size exclusion high pressure liquid chromatography).

Example 2a: Presence of Emulsifier During Hydrolysis Results in the Presence of Betalactoglobulin Peptides in the Permeate after the Membrane Filtration Step

[0225] The process of example 1 was repeated. The only difference was that Citrem (Grinsted? Citrem, DuPont) was added at an amount of about 3.6 gram before the pH adjustment and the addition of the proteolytic enzymes. Citrem is not retained by the UF-membrane and therefore the Citrem concentration in permetate and retentate will be similar. Moreover, Citrem addition was found not to have an effect on retention of peptides larger than 10 kDa and of allergic beta-lactoglobulin. As for example 1, the feed, retentate and permeate was tested for tolerogenic peptides. Surprisingly and contrary to example 1, all of the 5 tolerogenic peptides (peptides 1-5 of example 1 (i.e. SEQ ID NO 66-70 with X=L) were detected in the permeate, in an amount of about 1-10 wt. % of the concentration of these peptides in the feed.

Example 2b: The Experiment of Example 2a was Repeated but the Citrem was Added in the Middle of the Hydrolysis Step Instead, and Again the Specific Peptides were Now Found in the Permeate

Example 3: Presence of Chaotropic Agent During Hydrolysis Results in the Presence of Betalactoglobulin Peptides in the Permeate after the Membrane Filtration Step

[0226] The process of example 2a was repeated, the only difference being that instead of the emulsifier, 51 gram of urea (source Merck) was dissolved per 100 g water (8 M) and added after the hydrolysis step and before ultrafiltration. Urea is not retained by the UF-membrane and therefore the urea concentration in permeate and retentate will be similar. Moreover, urea addition was not found to have an effect on retention of peptides larger than 10 kDa and of allergic beta-lactoglobulin. The urea was dissolved just before the membrane filtration step and allowed to cool. The cooling time before filtration was found sufficient time. The tolerogenic betalactoglobulin peptides were found to be present in the feed and retentate but surprisingly also in the permeate. All peptides were detected in the retentate and feed, and peptides 1, 3, 4 and 5 of example 1 (i.e. SEQ ID NOs 66, 68, 69 and 70 with X=L) were detected in the permeate, in an amount of about 1-10 wt. % of the concentration of these peptides in the feed.

Example 3: Presence of Chaotropic Agent During Hydrolysis Results in the Presence of Betalactoglobulin Peptides in the Permeate after the Membrane Filtration Step

[0227] The process of example 2a was repeated, the only difference being that instead of the emulsifier, 51 gram of urea (source Merck) was dissolved in 100 g water (8 M) and added after the hydrolysis step and before ultrafiltration. Urea is not retained by the UF-membrane and therefore the urea concentration in permeate and retentate will be similar. Moreover, urea addition was not found to have an effect on retention of peptides larger than 10 kDa and of allergic beta-lactoglobulin. The tolerogenic betalactoglobulin peptides were found to be present in the feed and retentate but surprisingly also in the permeate. All peptides were detected in the retentate and feed, and peptides 1, 3, 4 and 5 of example 1 (i.e. SEQ ID NOs 66, 68, 69 and 70 with X=L) were detected in the permeate, in an amount of about 1-10 wt. % of the concentration of these peptides in the feed.

Example 4: Infant Formula

[0228] A powdered Infant Formula intended for infants of 0-6 months of age that suffer from food allergy, comprising 66 kcal per 100 ml when reconstituted with water to ready-to-drink liquid, [0229] comprising about 2.4 g protein per 100 kcal, [0230] the protein being an ultrafiltered, hydrolyzed whey protein obtainable by the process described in example 2, comprising at least 3 of the betalactoglobulin peptides selected from the group consisting of

TABLE-US-00003 LIVTQTMKGLDIQKVAGTWYSLAMAAS, DIQKVAGTWYSLAMAASDISLLDAQSAPLRVY, TMKGLDIQKVAGTWYSLAMAASDISLLDAQ, TMKGLDIQKVAGTWYSLAMAASDISLL, and LIVTQTMKGLDIQKVAGTWYSLAMAASDISLL, [0231] and with a MW distribution pattern of the peptides in the whey protein hydrolysate of

TABLE-US-00004 <1 kDa 72.5-88.7% 1-5 kDa 15.5-22.9% 5-10 kDa 0-0.1% >10 kDa 0-0.1%

[0232] The infant formula further comprises 10.7 g digestible carbohydrates (mainly lactose) per 100 kcal, 5.1 g fat per 100 kcal, 0.8 g non-digestible oligosaccharides per 100 ml (scGOS/IcFOS in a 9:1 ratio), citrem, vitamins, minerals and trace elements as known in the art.

Example 5: Infant Formula

[0233] A powdered Infant Formula intended for infants of 0-12 month that suffer from food allergy, comprising 66 kcal per 100 ml when reconstituted with water to ready to drink liquid, [0234] comprising about 2.7 g protein per 100 kcal, [0235] the protein being an ultrafiltered, hydrolyzed whey protein obtainable by the process described in example 3, comprising at least 3 of the betalactoglobulin peptides selected from the group consisting of

TABLE-US-00005 LIVTQTMKGLDIQKVAGTWYSLAMAAS, DIQKVAGTWYSLAMAASDISLLDAQSAPLRVY, TMKGLDIQKVAGTWYSLAMAASDISLLDAQ, TMKGLDIQKVAGTWYSLAMAASDISLL, and LIVTQTMKGLDIQKVAGTWYSLAMAASDISLL, [0236] and with a MW distribution pattern of the peptides in the whey protein hydrolysate of

TABLE-US-00006 <1 kDa 62.8-74.6% 1-5 kDa 27.9-34.8% 5-10 kDa 0-0.3% >10 kDa 0-0.1% [0237] The infant formula further comprises 10.9 g digestible carbohydrates (mainly lactose), 5.1 g fat per 100 kcal, 0.8 g non digestible oligosaccharides per 100 ml (scGOS/IcFOS in a 9:1 ratio), urea, vitamins, minerals and trace elements as known in the art.

Example 6: Synbiotic Mixture Shows a Further Improved Effect of Tolerance Induction Compared to Probiotics or Prebiotics Alone

[0238] Several published studies support a notion that dietary antigens (including peptides) within the intestinal lumen can be absorbed and subsequently captured and presented by intestinal antigen-presenting cells, i.e., antigen sampling mechanisms, without the need of a disrupted intestinal barrier. There are at least two distinct mechanisms that continuously work to sample dietary antigens at the healthy state, i.e., microfold/M cell-mediated transcytosis and goblet-cell-associated antigen passage. Both pathways provide dietary antigens to intestinal lamina propria CD103+ DCs, which in return could imprint gut-homing molecules on T and B cells, could promote differentiation of intestinal IgA-producing plasma cells as well as could generate intestinal Tregs, a key player in the state of hyporesponsiveness to fed antigen known as oral tolerance. This suggests that peptides within the tested HP can be orally absorbed, followed by antigen capture and presentation by intestinal CD103+ DCs and subsequently culminated in generation of functional Tregs.

[0239] For the development of oral tolerance, T-cell epitopes within the tested HP need to be presented under the right circumstances. In addition to TCR activation, co-stimulation and cytokine signalling play an important role in the generation of Tregs. Pro- or prebiotics play an important role in creating the right environment for this predisposition towards Tregs. The preventive effect of synthetic BLG peptides was strengthened in combination with a probiotic or prebiotic diet.

[0240] To demonstrate the effect of pro-, pre- and synbiotics an experiment was performed similar as described in example 4 of WO 2016/148572, with the same protocol, and the same concentration and mixture of synthetic peptides (Pepmix), the pepmix identified in Table 8.

TABLE-US-00007 TABLE8 pepmixaccordingtoWO2016/148572 Peptide Sequence 1(18AA) SEQIDNO:71 QKVAGTWYSLAMAASDIS 2(18AA) SEQIDNO:72 WYSLAMAASDISLLDAQS 3(18AA) SEQIDNO:73 AASDISLLDAQSAPLRVY 4(18AA) SEQIDNO:74 LLDAQSAPLRVYVEELKP

[0241] A number of diets were compared: [0242] (a) synbiotic diet of example 1 of WO 2016/14472 (1 wt % scFOS/IcFOS in a wt ratio 9:1+2 wt % 2?10.sup.9 cfu/g Bifidobacterium breve M-16V, [0243] (b) probiotic diet of example 4 of WO 2016/148572 with 2 wt %2?10.sup.9 cfu/g Bifidobacterium breve M-16V, and [0244] (c) prebiotic diet containing 1 wt % of scFOS/IcFOS wt ratio 9/1.

[0245] The short-chain (sc-) and long-chain (lc-) fructo-oligosaccharides (FOS) were commercially available as Raftilose P95 (Orafti) and Raftiline HP, respectively.

[0246] All groups were pretreated with the pepmix and one of the above diets, were sensitized with whey+cholera toxin and challenged with whey.

[0247] After challenge with whey, the delta ear swelling of the mice having consumed (c) scFOS/IcFOS diet was about 174 ?m, of the mice having consumed (b) the probiotic diet was about 158 ?m, and of the mice having consumed (a) the synbiotic diet was about 112 ?m. The ear swelling in the synbiotic group (a) was statistically significantly lower than in the corresponding scFOS/IcFOS group (c), and there was a trend of a lower response when compared with probiotic group (b) (p=0.08). These results are indicative for a further improved effect on oral immunotolerance induction: [0248] when using a lactic acid-producing bacterium, in particular a Bifidobacterium strain from the species B. breve, and [0249] particularly when using a lactic-acid producing bacterium in combination with NDOs.

[0250] Based on these experiments, it is credible that a further improved effect would be achieved if these components are combined with the ultrafiltered whey protein hydrolysate of the invention.