Photosystem I-hydrogenase chimeras for hydrogen production
12065676 ยท 2024-08-20
Assignee
Inventors
Cpc classification
C12N9/0077
CHEMISTRY; METALLURGY
C12N15/8242
CHEMISTRY; METALLURGY
International classification
Abstract
Provided herein, in some embodiments, are engineered cells and use of the same for increased hydrogen production. In particular, provided herein are genetically engineered cells comprising a polynucleotide encoding a fusion protein comprising a photosystem I (PSI) protein and an algal hydrogenase, as well as methods for producing such genetically engineered cells. Also provided herein are methods for increasing hydrogen (H.sub.2) production in cells.
Claims
1. A genetically engineered cell comprising a polynucleotide encoding a fusion protein comprising photosystem I subunit (PsaC) and an algal hydrogenase, wherein the hydrogenase is inserted in frame in the hinge region of PsaC.
2. The cell of claim 1, wherein the algal hydrogenase is hydrogenase A.
3. The cell of claim 2, wherein the polynucleotide further comprises a nucleic acid linker encoding at least one amino acid at the junction between the N-terminal, the C-terminal or both ends of the hydrogenase.
4. The cell of claim 1, wherein the polynucleotide encodes the polypeptide of SEQ ID NO: 1, SEQ ID NO: 2 or a polypeptide having 95% identity to SEQ ID NO: 1 or SEQ ID NO: 2.
5. The cell of claim 1, wherein the cell is an algal cell.
6. The cell of claim 5, wherein the cell is a Chlamydomonas reinhardtii cell.
7. An algal biomass comprising the genetically engineered cell according to claim 1.
8. An expression cassette comprising a polynucleotide encoding a fusion protein comprising a photosystem I subunit (PsaC) and an algal hydrogenase, wherein the hydrogenase is inserted in frame into the ?-hairpin of PsaC.
9. The expression cassette of claim 8, wherein the polynucleotide is operably linked to a promoter that drives expression of the fusion protein.
10. The expression cassette of claim 1, wherein the algal hydrogenase is hydrogenase A.
11. The expression cassette of claim 10, wherein the polynucleotide further comprises a nucleic acid linker encoding at least one amino acid at the junction between the N-terminal, the C-terminal or both ends of the algal hydrogenase A protein.
12. The expression cassette of claim 10, wherein the polynucleotide encodes the polypeptide of SEQ ID NO: 1, SEQ ID NO: 2 or a polypeptide having 95% identity to SEQ ID NO: 1 or SEQ ID NO: 2.
13. A method of producing the cell of claim 1, the method comprising expressing in an algal cell a polynucleotide encoding a fusion protein comprising a PsaC and an algal hydrogenase.
14. The method of claim 13, wherein the polynucleotide is an expression cassette comprising a polynucleotide encoding a fusion protein comprising PsaC and an algal hydrogenase.
15. A method of increasing hydrogen (H.sub.2) production in a cell, the method comprising (a) introducing into the cell the expression cassette of claim 12 to produce a genetically engineered cell; (b) culturing the genetically engineered cell under saturating light conditions, wherein the genetically engineered cell exhibits at least a 5-fold increase in H.sub.2 production under such conditions relative to a control cell of the same species under the same conditions.
16. The method of claim 15, wherein the cultured genetically engineered cell produces H.sub.2 continuously for at least 5 days at an average rate of 14.0?1.7 ?mol H.sub.2h.sup.?1 (mg Chl).sup.?1.
17. The method of claim 14, wherein the polynucleotide is operably linked to a promoter that drives expression of the fusion protein.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
(1) The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
(2)
(3)
(4)
(5)
(6)
(7)
(8)
(9)
(10)
(11)
(12) FNR (0.2 ?M), and NADP.sup.+ (2.5 mM). Illumination (300 ?mol of red photons m.sup.?2 s.sup.?1) of cuvette commenced at t=0. Lines represent a linear fit of the data. Rates thus obtained are 1.57?0.01 and 0.77?0.04 NADPH s.sup.?1 per PSI for WT and PSI-HydA, respectively. (C) O.sub.2 reduction rates measured with a Clark-type electrode. The O.sub.2 uptake rates were normalized to the amount of P.sub.700. Maximal light-dependent rates were 12.7?1.6 and 26.4?4.8 O.sub.2 s .sup.?1 per PSI for WT and PSI-HydA, respectively. Error bars represent SE (n=3).
(13)
(14)
(15)
(16)
(17)
(18)
(19)
(20)
(21)
(22)
(23)
(24)
(25)
(26)
(27)
(28)
(29)
(30)
(31)
(32)
(33)
(34)
(35)
(36)
(37)
(38)
(39)
(40)
(41) While the present invention is susceptible to various modifications and alternative forms, exemplary embodiments thereof are shown by way of example in the drawings and are herein described in detail. It should be understood, however, that the description of exemplary embodiments is not intended to limit the invention to the particular forms disclosed, but on the contrary, the intention is to cover all modifications, equivalents and alternatives falling within the spirit and scope of the invention as defined by the appended claims.
DETAILED DESCRIPTION
(42) The compositions and methods described herein are based, at least in part, on the inventor's development of a fusion of photosystem I (PSI) and an iron-iron hydrogenase, created by insertion of an algal HydA sequence into a PsaC subunit and in vivo co-assembly of PSI and hydrogenase portions. As demonstrated herein, algal cells modified to express only the PSI-hydrogenase chimera make hydrogen at high rates in a light-dependent fashion for several days. In these engineered algal cells, photosynthetic electron flow is directed away from CO.sub.2 fixation and towards proton reduction, thus demonstrating the possibility of driving novel redox chemistries using electrons from water splitting and the photosynthetic electron transport chain (PETC). Without being bound to any particular theory or mode of action, it is believed that expression of fusion proteins of this disclosure positions redox enzymes to directly capture electrons from photosystem I (PSI) before they enter the general cellular pool. Consequently, the genetic modification constrains O.sub.2 evolution from PSII, preserves hydrogenase activity for sustained H.sub.2 production for several days, and removes the need for use of nutrient deprivation, PRI inhibitors or mutations. Accordingly, the embodiments of this disclosure provide a cheap and renewable platform for creating bio-factories capable of driving difficult redox transformations, powered only by the sun and using water as the electron source.
(43) Accordingly, this disclosure provides genetically engineered cells that generate hydrogen and offer an ecologically-friendly, inexpensive renewable energy source. The cells may be algal cells or any cell capable of photosynthesis having PSI and an algal iron-iron hydrogenase. The hydrogenase is inserted in frame into the hinge region ((?-hairpin region of
(44) In some embodiments, the genetically engineered cell comprises a nucleic acid sequence that encodes a fusion protein comprising a photosystem I (PSI) protein and an algal hydrogenase. In some embodiments, the engineered cells comprise a fusion protein comprising a photosystem I (PSI) protein, or a portion thereof, and an algal hydrogenase protein or a portion thereof. In some embodiments, the fusion protein comprises one or more subunits of PSI, and the hydrogenase is hydrogenase A (HydA), where the one or more PSI subunits are attached to HydA. As shown in
(45) A deletion in a fusion polypeptide refers to a change in the amino acid sequence resulting in the absence of one or more amino acid residues. A deletion may remove at least 1, 2, 3, 4, 5, 10, 20, or more amino acids residues. A deletion may include an internal deletion and/or a terminal deletion (e.g., an N-terminal truncation, a C-terminal truncation or both of a reference polypeptide).
(46) Insertions and additions in a fusion polypeptide refers to changes in an amino acid sequence resulting in the addition of one or more amino acid residues. An insertion or addition may refer to 1, 2, 3, 4, 5, 10, 20, 30, 40, or more amino acid residues. A variant of a polypeptide may have N-terminal insertions, C-terminal insertions, internal insertions, or any combination of N-terminal insertions, C-terminal insertions, and internal insertions.
(47) An engineered cell may be obtained by introducing a recombinant nucleic acid molecule that encodes a PSI-HydA fusion protein of this disclosure. As used herein, the term recombinant nucleic acid refers to a polynucleotide that is manipulated by human intervention. A recombinant nucleic acid molecule can contain two or more nucleotide sequences that are linked in a manner such that the product is not found in a cell in nature. In particular, the two or more nucleotide sequences can be operatively linked and, for example, can encode a fusion polypeptide. A recombinant nucleic acid molecule also can be based on, but manipulated so as to be different, from a naturally occurring polynucleotide, for example, a polynucleotide having one or more nucleotide changes such that a first codon, which normally is found in the polynucleotide, is biased for chloroplast codon usage, or such that a sequence of interest is introduced into the polynucleotide, for example, a restriction endonuclease recognition site or a splice site, a promoter, a DNA origin of replication, or the like.
(48) In some embodiments, the amino acid sequence of the PsaC-HydA2 fusion polypeptide is: MAHIVKIYDTCIGCTQCVRACPLDVLEMVPWGGATATDAVPHWKLALEELDKPKDGG RKVLIAQVAPAVRVAIAESFGLAPGAVSPGKLATGLRALGFDQVFDTLFAADLTIMEEG TELLHRLKEHLEAHPHSDEPLPMF T S C CP GWVAMMEK S YPELIPF V S SCKSPQMMMGA MVKTYL SEKQ GIPAKDIVMV SVMP CVRKQ GEADREWF C V SEP GVRDVDHVIT TAEL GN IFKERGINLPELPD SDWD QPLGL GS GAGVLF GTT GGVMEAALRTAYEIVTKEPLPRLNL S EVRGLDGIKEASVTLVPAPGSKFAELVAERLAHKVEEAAAAEAAAAVEGAVKPPIAYD GGQGF STDDGKGGLKLRVAVANGLGNAKKLIGKMVSGEAKYDFVEIMACPAGCVGGG GQPRS TDKQIT QKRQ AALYDLDERNTLRRSHENEAVNQLYKEFLGEPL SHRAHELLHTH YVPGGASQMASAPRTEDCVGCKRCETACPTDFL SVRVYLGSESTRSMGL SY (SEQ ID NO:1). The singly underlined residues indicate the PsaC fragments; the doubly underlined residues are the N-terminal junction; and the bold Ala residue is shared between the HydA2 and PsaC sequences. In another embodiment the amino acid sequence of the PsaC-HydA1 fusion polypeptide is: MAHIVKIYDTCIGCTQCVRACPLDVLEMVPWGGA TA TDA VPHVQQALAELAKPKDDPT RKHVCVQVAPAVRVAIAETLGLAPGATTPKQLAEGLRRLGFDEVFDTLFGADLTIMEEG SELLHRLTEHLEAHPHSDEPLPMFT SC CP GWIAMLEK S YPDLIPYV S SCKSPQMMLAAM VKSYLAEKKGIAPKDMVMVS IlVIP C TRKQ SEADRDWFCVDADPTLRQLDHVITTVELGN IFKERGINLAELPEGEWDNPMGVGS GAGVLF GTT GGVMEAALRTAYELF T GTPLPRL SL SEVRGMD GIKETNITMVPAP GSKFEELLKHRAAARAEAAAHGTPGPLAWD GGAGF T SE DGRGGITLRVAVANGLGNAKKLITKMQAGEAKYDFVEIMACPAGCVGGGGQPRSTDK AITQKRQAALYNLDEKSTLRRSHENP SIRELYDTYLGEPLGHKAHELLHTHYVAGGA MASAPRTEDCVGCKRCETACPTDFL SVRVYLGSESTRSMGL SY (SEQ ID NO:2). The singly underlined residues indicate the PsaC fragments; the doubly underlined residues are the N-terminal junction; the bold Ala residue is shared between the HydA2 and PsaC sequences and the italicized residues are a borrowed linker sequence from the PsaC-HydA2 fusion protein. Sequences having 90, 92, 94, 95, 96, 97, 98, 99 percent identity to the fusion protein of SEQ ID NO: 1 and SEQ ID NO: 2 are also contemplated. In particular the amino acids in bold, italics or double underlined in SEQ ID NO: 1 or 2 may be altered to provide additional linking regions between the portions of the fusion protein.
(49) Regarding the fusion polypeptides disclosed herein, the phrases % sequence identity, percent identity, or % identity refer to the percentage of residue matches between at least two amino acid sequences aligned using a standardized algorithm. Methods of amino acid sequence alignment are well-known. Some alignment methods take into account conservative amino acid substitutions. Such conservative substitutions, explained in more detail below, generally preserve the charge and hydrophobicity at the site of substitution, thus preserving the structure (and therefore function) of the polypeptide. Percent identity for amino acid sequences may be determined as understood in the art. (See, e.g., U.S. Pat. No. 7,396,664, which is incorporated herein by reference in its entirety). A suite of commonly used and freely available sequence comparison algorithms is provided by the National Center for Biotechnology Information (NCBI) Basic Local Alignment Search Tool (BLAST), which is available from several sources, including the NCBI, Bethesda, Md., at its website. The BLAST software suite includes various sequence analysis programs including blastp, that is used to align a known amino acid sequence with other amino acids sequences from a variety of databases.
(50) Polypeptide sequence identity may be measured over the length of an entire defined polypeptide sequence, for example, as defined by a particular SEQ ID number, or may be measured over a shorter length, for example, over the length of a fragment taken from a larger, defined polypeptide sequence, for instance, a fragment of at least 15, at least 20, at least 30, at least 40, at least 50, at least 70 or at least 150 contiguous residues. Such lengths are exemplary only, and it is understood that any fragment length supported by the sequences shown herein, may be used to describe a length over which percentage identity may be measured.
(51) Any appropriate technique for introducing recombinant nucleic acid molecules into algal cells may be used. Techniques for nuclear and chloroplast transformation are known and include, without limitation, electroporation, biolistic transformation (also referred to as micro-projectile/particle bombardment), agitation in the presence of glass beads, and Agrobacterium-based transformation. Accordingly, a recombinant nucleic acid molecule encoding a PsaCHydA2 fusion protein may introduced into an algal cell by, for example, electroporation, by particle bombardment, by agitation in the presence of glass beads, or by Agrobacterium-based transformation. With chloroplast transformation, transgenes can be easily directed to integrate via homologous recombination. Nuclear transformation usually results in random integration events. In some embodiments the nativepsaC and hydA genes are mutated and/or replaced with the fusion protein in the cells such that all copies of PSI in the cell contain the fusion protein.
(52) By way of example, described herein is introduction of a nucleic acid encoding apsaC hydA fusion protein into an algal cell's chloroplast genome by particle-mediated gene transfer. In this example, flanking sequences were used to direct homologous recombination such that the recombinant nucleic acid replaces the endogenous psaC gene.
(53) Any appropriate method can be performed to confirm introduction and expression of recombinant nucleic acids in the modified cell. For instance, polymerase chain reaction (PCR) or PCR-based methods can be used to verify replacement of psaC by psaChydA2 or psaC-hydA1. In some embodiments, amplified PCR products may be sequenced to ensure that no mutations are found in the recombinant nucleic acid as a result of the cloning process. The Example section demonstrates introduction of psaChydA2 and psaC-hydAl into two strains: a hydA1-1 hydA2-1 mutant lacking endogenous hydrogenases, as well as a strain expressing a hexahistidine-tagged (H6) version of PsaA, a core subunit of PSI. In the hydAl-1 hydA2-1 mutant strain lacking endogenous hydrogenases, PSI-HydA serves as the only significant contributor to hydrogen production. In each of these strains, WT PSI would be replaced by PSI-HydA.
(54) In some embodiments, it will be advantageous to measure hydrogenase activity. Any appropriate means of measuring hydrogenase activity may be used. In some embodiments, samples are collected for analysis of hydrogenase activity by gas chromatography (GC). Those of skill in the art are aware of methods to measure hydrogenase activity and such methods are provided in the Examples.
(55) Any type of cell comprising a chloroplast or using photosystem I for photosynthesis may be used. For example, plant cells, algal cells, or cyanobacteria may be used. The cell must also have or be engineered to have the maturase proteins, hydEFG. The Fe-Fe hydrogenases for use in the methods suitably have a structure similar to algal hydrogenase A, in which the N-terminal and C-terminal ends of the protein are in proximity to each other or the hydrogenase protein is modified via truncation such that the N-terminal and C-terminal ends of the protein are in proximity to each other. Those of skill in the art can use protein modeling programs or crystal structures of hydrogenases to determine appropriate hydrogenases for use in the methods, cells and constructs provided herein. Several of these are provided in
(56) The terms algal cell or algae as used herein refer to plants or cells belonging to the subphylum Algae of the phylum Thallophyta. The algae are unicellular, photosynthetic, oxygenic algae and are non-parasitic plants without roots, stems or leaves; they contain chlorophyll and have a great variety in size, from microscopic to large seaweeds. Green algae, belonging to Eukaryota-Viridiplantae-Chlorophyta-Chlorophyceae, can be used. Blue-green, red, or brown algae may also be used. Exemplary algae for which the compositions and methods described herein includes those of the genus Chlamydomonas. In some embodiments, the engineered algal cells are unicellular green alga of the species Chlamydomonas reinhardtii, for which the sequence of all three genomes (nuclear, chloroplast and mitochondria) has been determined. Algal cells of the genus Chlorella may be used in other embodiments. For example, the PsaC of Chlorella vulgaris, or Picochlorum soloecismus may be used. The sequences and an alignment are provided in
(57) In some embodiments, genetically engineered cells comprising the fusion proteins described herein exhibit at least a 5-fold increase in H.sub.2 production with respect to a control cells of the same species under the same conditions. Advantageously, proton pumping and ATP production carried out by PETC is preserved in the genetically engineered cells. When cultures are maintained at high density (?30 mg Chl L.sup.?1) under continuous illumination (approximately 600 mmol photons m.sup.?2s.sup.?1), production rate from the genetically engineered cells was 86.6?2.4 mL H.sub.2 d.sup.?1 per liter of culture. In some embodiments, the genetically engineered cells produce H.sub.2 continuously for at least 5 days at an average rate of 14.0?1.7 mmol H.sub.2h.sup.?1 (mg Chl).sup.?1. The results of the experiments completed in the Examples below showing the increase in hydrogen production can be summarized as follows:
(58) TABLE-US-00001 TABLE 1 Maximum measured H.sub.2 production rates in ?moles H.sub.2 h.sup.?1 (g dry weight cells).sup.?1 N/A (not measured) Condition Time frame (?light, ?acetate) Short (s-min) Intermediate (min-h) Long (h-d) Dark + acetate N/A 7.50 ? 0.002 N/A Light + acetate 1727 ? 250 568 ? 136 267 ? 8 Light + bicarbonate 1114 ? 136 N/A N/A
(59) Any appropriate growth conditions can be used to maintain cultures of genetically engineered cells of this disclosure. In some embodiments, engineered algae are cultured in a liquid medium (e.g., Trisacetate-phosphate (TAP) that comprises mineral nutrients. In some embodiments, cultures are maintained in cell culture flasks under low ambient light conditions (B5 mmol photons m2 s1 PAR) with agitation (150 rpm). Larger cultures (1 L and greater) may be grown with continuous stirring and sparging with sterile filtered air. In some embodiments, cultures are maintained under autotrophic growth conditions. In such cases, a liquid Tris-bicarbonate phosphate (TBP) medium comprising 25 mM sodium bicarbonate (pH 7.0) in place of acetate can be used. In some embodiments, a photobioreactor vessel is used for growth of engineered algae.
(60) In the Examples, the polynucleotide encoding the fusion protein was integrated into the native PsaC gene within the chloroplast genome via homologous recombination. A similar fusion protein can be recombined into the chloroplast genome of any cell containing a chloroplast, such as algal cell or plant cells. A similar fusion protein and polynucleotide encoding the same may be used in the cyanobacteria to engineer cyanobacteria cells capable of generating increased hydrogen. In another aspect, provided herein is a cell, suitably an algal cell, that has been modified to contain an expression cassette that drives expression of a fusion protein comprising a PSI protein and an Fe-Fe hydrogenase. For instance, provided herein are algae that have been modified relative to a naturally occurring algal cell, where the modified algal cell comprises an expression cassette that comprises a promoter operably linked to a nucleic acid sequence that encodes a fusion protein comprising a PSI protein and an algal hydrogenase. In preferred embodiments, the nucleic acid is a recombinant nucleic acid that encodes a PSI-HydA fusion protein, suitably the fusion protein includes the sequence of SEQ ID NO: 1 or SEQ ID NO: 2. In one embodiment, the fusion protein is expressed from an expression cassette including a promoter operably connected to the polynucleotide encoding the fusion proteins described herein. While PSI is encoded in the chloroplast, the gene and thus the fusion protein may be encoded in the nucleus, added as an additional copy in the chloroplast or even encoded on an extra chromosomal expression cassette such as a plasmid or artificial chromosome. In these alternative expression cassettes, the promoters may be selected based on the expression system being contemplated by those of skill in the art. For example as demonstrated in Reifschneider-Wegner et al. (Hydrogen Energy 39: 3657-3665 2014) the hydrogenase can be expressed in chloroplasts using the psbD promoter/5UTR to drive expression of the chloroplast-optimized hydA gene. A similar system could be used for expression of the fusion protein described herein.
(61) In another aspect, provided herein is algal biomass comprising genetically engineered algal cells of the disclosure. In particular, provided herein is algal biomass that contains genetically engineered algal cells that exhibit increased hydrogen production on particular growth (e.g., light) conditions relative to genetically unmodified algal cells or other controls when cultured under the same conditions. As used herein, the term algal biomass refers to the amount or density of algae in a given area or volume (e.g., of water or other liquid) at a given time. Algal biomass encompasses algae grown in various cultivation systems such as photoreactors and open ponds, but also algal material obtained from different types of waste from industry and sewage plants.
(62) Expression cassettes and constructs comprising a polynucleotide encoding the fusion proteins comprising a PSI protein and an algal hydrogenase as described above are also provided here. The polynucleotide is optionally operably linked to a promoter that drives expression of the fusion protein in the cell. As used herein, the terms polynucleotide, polynucleotide sequence, nucleic acid and nucleic acid sequence refer to a nucleotide, oligonucleotide, polynucleotide (which terms may be used interchangeably), or any fragment thereof. These phrases also refer to DNA or RNA of natural or synthetic origin (which may be single-stranded or double-stranded and may represent the sense or the antisense strand). The polynucleotides may be cDNA or genomic DNA.
(63) Polynucleotides homologous to the polynucleotides described herein are also provided. Those of skill in the art understand the degeneracy of the genetic code and that a variety of polynucleotides can encode the same polypeptide. In some embodiments, the polynucleotides (i.e., polynucleotides encoding the fusion polypeptides) may be codon-optimized for expression in a particular cell including, without limitation, a plant cell, bacterial cell, or algal cell. While particular polynucleotide sequences which are found in particular algae are disclosed herein any polynucleotide sequences may be used which encode a desired form of the polypeptides described herein. The particular polynucleotide sequences of the fusion polypeptides are provided as SEQ ID NOs: 1 and 2. These represent non-naturally occurring sequences. Computer programs for generating degenerate coding sequences are available and can be used for this purpose. Pencil, paper, the genetic code, and a human hand can also be used to generate degenerate coding sequences.
(64) In another aspect of the present invention, constructs are provided. As used herein, the term construct refers to recombinant polynucleotides including, without limitation, DNA and RNA, which may be single-stranded or double-stranded and may represent the sense or the antisense strand. Recombinant polynucleotides are polynucleotides formed by laboratory methods that include polynucleotide sequences derived from at least two different natural sources or they may be synthetic. Constructs thus may include new modifications to endogenous genes introduced by, for example, genome editing technologies. Constructs may also include recombinant polynucleotides created using, for example, recombinant DNA methodologies.
(65) The constructs provided herein may be prepared by methods available to those of skill in the art. Notably each of the constructs or expression cassettes claimed are recombinant molecules and as such do not occur in nature. Generally, the nomenclature used herein and the laboratory procedures utilized in the present invention include molecular, biochemical, and recombinant DNA techniques that are well known and commonly employed in the art. Standard techniques available to those skilled in the art may be used for cloning, DNA and RNA isolation, amplification and purification. Such techniques are thoroughly explained in the literature.
(66) The constructs and expression cassettes provided herein may include a promoter operably linked to any one of the polynucleotides described herein but need not have a promoter and may be used for homologous recombination into the native site of psaC in the algae. Alternatively, the constructs may include a promoter and the promoter may be a heterologous promoter or an endogenous promoter associated with the PsaC polypeptide.
(67) As used herein, the terms heterologous promoter, promoter, promoter region, or promoter sequence refer generally to transcriptional regulatory regions of a gene, which may be found at the 5 or 3 side of the polynucleotides described herein, or within the coding region of the polynucleotides, or within introns in the polynucleotides. Typically, a promoter is a DNA regulatory region capable of binding RNA polymerase in a cell and initiating transcription of a downstream (3 direction) coding sequence. The typical 5 promoter sequence is bounded at its 3 terminus by the transcription initiation site and extends upstream (5 direction) to include the minimum number of bases or elements necessary to initiate transcription at levels detectable above background. Within the promoter sequence is a transcription initiation site (conveniently defined by mapping with nuclease S1), as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase.
(68) In some embodiments, the disclosed polynucleotides are operably connected to the promoter. As used herein, a polynucleotide is operably connected or operably linked when it is placed into a functional relationship with a second polynucleotide sequence. For instance, a promoter is operably linked to a polynucleotide if the promoter is connected to the polynucleotide such that it may affect transcription of the polynucleotides. In various embodiments, the polynucleotides may be operably linked to at least 1, at least 2, at least 3, at least 4, at least 5, or at least 10 promoters.
(69) Heterologous promoters useful in the practice of the present invention include, but are not limited to, constitutive, inducible, temporally-regulated, developmentally regulated, chemically regulated, tissue-preferred and tissue-specific promoters. The heterologous promoter may be a plant, animal, bacterial, fungal, or synthetic promoter.
(70) In another aspect, provided herein are methods for producing hydrogen. To produce hydrogen, the genetically engineered cells described herein can be cultured in a bioreactor growth system and the gas released during growth can be collected, removed from the bioreactor, and the hydrogen can be separated and collected from the remaining air in the bioreactor after growth of the cells. In one embodiment, the cells are algal cells. As noted in the Examples, the cells expressing the fusion protein described herein may be cultured under conditions and in media to increase H.sub.2 production. For example, the cells may be cultured under saturating light conditions to induce increased H.sub.2 production.
(71) Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the invention pertains. All definitions, as defined and used herein, should be understood to control over dictionary definitions, definitions in documents incorporated by reference, and/or ordinary meanings of the defined terms.
(72) All references, patents and patent applications disclosed herein are incorporated by reference with respect to the subject matter for which each is cited, which in some cases may encompass the entirety of the document.
(73) The indefinite articles a and an, as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean at least one.
(74) The phrase and/or, as used herein in the specification and in the claims, should be understood to mean either or both of the elements so conjoined, i.e., elements that are conjunctively present in some cases and disjunctively present in other cases. Multiple elements listed with and/or should be construed in the same fashion, i.e., one or more of the elements so conjoined. Other elements may optionally be present other than the elements specifically identified by the and/or clause, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, a reference to A and/or B, when used in conjunction with open-ended language such as comprising can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc.
(75) As used herein in the specification and in the claims, or should be understood to have the same meaning as and/or as defined above. For example, when separating items in a list, or or and/or shall be interpreted as being inclusive, i.e., the inclusion of at least one, but also including more than one, of a number or list of elements, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as only one of or exactly one of, or, when used in the claims, consisting of, will refer to the inclusion of exactly one element of a number or list of elements. In general, the term or as used herein shall only be interpreted as indicating exclusive alternatives (i.e. one or the other but not both) when preceded by terms of exclusivity, such as either, one of only one of or exactly one of Consisting essentially of when used in the claims, shall have its ordinary meaning as used in the field of patent law.
(76) As used herein, the terms approximately or about in reference to a number are generally taken to include numbers that fall within a range of 5% in either direction (greater than or less than) the number unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value). Where ranges are stated, the endpoints are included within the range unless otherwise stated or otherwise evident from the context.
(77) As used herein, the terms optional or optionally mean that the subsequently described event or circumstance may or may not occur, and that the description includes instances where said event or circumstance occurs and instances where it does not.
(78) The present invention has been described in terms of one or more preferred embodiments, and it should be appreciated that many equivalents, alternatives, variations, and modifications, aside from those expressly stated, are possible and within the scope of the invention.
EXAMPLES
Example 1In vivo Fusion of Photosystem I (PSI) and Algal Hydrogenase
(79) Using a unicellular green alga (Chlamydomonas reinhardtii) as an experimental system, an in vivo fusion of PSI and the [FeFe] hydrogenase expressed by the organism was created (see
Experimental Design
(80) Chimeric protein design and homology modeling: The site of insertion of the hydrogenase domain corresponds to residues 32-36 (DGCKA; SEQ ID NO: 14) of C. reinhardtii PsaC. Residue Asp32 was replaced with Gly for additional flexibility, and residues Cys34 and Lys35 were replaced with trimmed HydA2 sequence, such that PsaC-Gly33 was connected directly to the N-terminus of mature HydA2 (Ala63) and the C-terminus of HydA2 (Gly500) was connected to PsaC-Ala36 (see
(81) To model the structure of PSI-HydA, the protein structure prediction webtool Phyre.sup.22 (intensive algorithm) was used to model individual subunits of C. reinhardtii PSI (PsaA, PsaB, PsaC, PsaD, PsaE and PsaF) and HydA2, based on the sequences of the polypeptides from protein data bank. Following removal of residues D32K35 of PsaC in Pymol, the docking of HydA2 was performed using the ClusPro.sup.23 server with distance restraints of 10 ?, corresponding to the amino acid residues involved in the junctions in the chimeric protein (Trp31 of PsaC to the N-terminal Gly of the modified HydA2 and the C-terminal Gly of the modified HydA2 to Ala36 of PsaC). The most plausible model based on ClusPro2's energy minimization algorithm was chosen and, after formation of two peptide bonds between PsaC and HydA2, the connecting loops were allowed to relax, using the ModLoop server.sup.24. PsaD and then PsaE were then docked to the PsaCHydA2 chimera with ClusPro2 as well.
(82) Generation of cells expressing PSI-hydrogenase: The psaC-hydA2 fusion sequence (see
(83) PCR analysis of algal transformants: PsaCHydA2 detection PCR was performed with flanking primers (PsaC5: TAATATGGAGATGACATATTTAG (SEQ ID NO: 10) and PsaC3: GATCTCACCAAGATACTCCC (SEQ ID NO: 11)) as well as with gene-specific primers (PsaC5int: TCAATGTGTACGTGCTTGTCC (SEQ ID NO: 12) and PsaC3int: ACAACGTTTGCAACCTACACA (SEQ ID NO: 13)) on 100 ng of genomic DNA using MeanGreen 2.sup.? Taq DNA polymerase master mix (Syzygy Biotech). Reactions (50 ?L) were cycled 35 times (95? C. for 15 seconds (s), 51? C. for 15 s, 72? C. for 90 s) using initial primer concentrations of 0.5 ?M. To determine the limits of detection of the PCR for the psaC gene, test PCR templates were generated by diluting genomic DNA from the hydA strain (containing psaC) into genomic DNA from the psaC? mutant (lacking psaC).sup.27 at the same concentration, in order to emulate conditions of heteroplasmy (10%, 1% psaC) and homoplasmy (100%, 0% psaC).
(84) Growth conditions: Unless otherwise specified, algae were grown in liquid Trisacetate-phosphate (TAP) medium with revised mineral nutrient supplement.sup.30 in Erlenmeyer baffled cell-culture flasks under low ambient light conditions (approximately 5 ?mol photons m .sup.?2 s.sup.?1 PAR) with agitation (150 rpm). Larger cultures (1 L and greater) were grown with continuous stirring and sparging with sterile filtered air. For autotrophic growth, Tris-bicarbonate phosphate
(85) (TBP) medium was prepared by substituting 25 mM sodium bicarbonate (pH 7.0) for acetate (?16.6 mM) in the medium.
(86) An FMT-150 (Photon Systems International, Brno, Czech Republic) photobioreactor (PBR) system equipped with pH and Clark-type O.sub.2 electrodes was used to obtain growth curves at constant temperature (24? C.). Starter cultures were pre-grown in TAP and washed twice with TBP. Cells were resuspended in TBP to a final OD.sub.680 of 0.1. At the beginning of each run, the photobioreactor vessel was sparged with N.sub.2 for ?1 hour. Afterwards, the cultures were sealed and stirred for the duration of the experiment.
(87) Chlorophyll (Chl) measurement: Concentrations of Chl a and b were determined as described in Porra et al..sup.31
(88) Thylakoid and PSI preparation: Thylakoid membranes were prepared as previously described.sup.25, with minor modifications outlined below. Cells were grown in 4 L flasks and centrifuged at 3500?g at 4? C. for 10 min. The pellet was washed with H1 buffer (25 mM HEPES-KOH, 5 mM MgCl.sub.2, 0.3 M sucrose, pH 7.5), flash-frozen in liquid nitrogen, and stored at ?80? C. Subsequent steps were performed in the dark and samples were kept at 4? C. Cells were resuspended at 2-4?10.sup.8 cells mL.sup.?1 in H1 containing 1 mM phenylmethane sulfonyl fluoride to inhibit proteolysis. Cell breakage was accomplished with a French Press (Aminco) at ?1.7 tons pressure. Unbroken cells were pelleted by centrifugation at 2000?g for 1 min, and the supernatant was centrifuged at 20,000?g for 10 min. The pelleted membranes were washed in 50 mL of H2 buffer (5 mM HEPES-KOH, 10 mM EDTA, 0.3 M sucrose pH 7.5) and resuspended in H3 buffer (5 mM HEPES-KOH, 10 mM EDTA, 1.8 M sucrose, pH 7.5). A discontinuous sucrose gradient was prepared using H3 buffer containing suspended thylakoid membranes, which was in turn overlaid with 1.3 M sucrose and 0.5 M sucrose solutions. After 1 hour of centrifugation in an SW-28 rotor at 25 000 rpm, the upper green band (0.5/1.3 M interface) was collected and washed with 3? volume of H6 buffer (5 mM HEPES-KOH, 10 mM EDTA pH 7.5). Purified thylakoids were concentrated by centrifugation (90 000?g for 30 min) and resuspended in H6+20% glycerol and were either stored at 200 K after flash-freezing in liquid N.sub.2 or solubilized for PSI purification.
(89) PSI particles were purified from thylakoid membranes on sucrose gradients after solubilization with ?-dodecyl maltoside (?-DDM), as described in Li et al..sup.29 Purification of hexahistidine-tagged PSI was performed as described previously,.sup.28 except that a Ni(.sub.II)-iminodiacetic acid (IDA) resin (G-biosciences, St. Louis, MO U.S.A.) was used.
(90) Anoxic PSI-HydA2 isolation: Twelve liters of cells grown aerobically in TAP to mid-log phase were harvested and resuspended in fresh TAP to ?200-300 ?mL .sup.?1 of total Chl and sparged with Ar for ?4 h. After this point, all preparation steps were done in an anaerobic glovebox (Coy) filled with a 5% H.sub.2/95% N.sub.2 gas mixture. Sodium dithionite was added to 2 mM final concentration and 5 mL aliquots were pelleted and stored in liquid nitrogen. Once thawed, each pellet was resuspended in breaking buffer (0.1 M TrisHC1, pH 8.0), (10 mM EDTAKOH, 1 mM PMSF and 2 mM Na.sub.2S.sub.2O.sub.4) in a total volume of 30 mL. Cell lysis was accomplished using a Branson sonifier S-450 operated at amplitude 3, 50% duty cycle for a total of 6 min (2 minutes sonication followed by 2 min waiting) on chilled beads (?20 to ?10? C.) to achieve complete cell lysis. Crude thylakoids were pelleted (208 000?g, 15 min, 4? C.), and resuspended in solubilization buffer (25 mM Tricine-KOH, pH 8.0, 300 mM KCl, 10% glycerol) containing 2 mM sodium dithionite. Solubilization and IMAC purification steps were done as described above with the exception of using Ni-Pentat? resin (Marvelgent Biosciences), TricineKOH buffer (pH 8.1) and 200 mM imidazole for elution. Purified PSI was stored in 25 mM TricineKOH (pH 8.1), 300 mM KCl, 10% glycerol, 0.03% ?-DM. Aliquots were flash frozen and stored in liquid nitrogen.
(91) Laser-flash spectroscopy: Samples of thylakoid membranes (60 ?g Chl mL .sup.?1 in 5 mM HEPES-KOH, pH 7.5) or PSI particles (6 ?g Chl mL .sup.?1 in 5 mM Tricine-KOH pH 8.0, 0.03% (?-DDM) were diluted with the same buffer containing 10 mM sodium ascorbate in the dark. A JTS-10 (Bio-Logic) kinetic spectrophotometer was used to monitor absorbance changes at 696 nm. Excitation was provided by a frequency-doubled Nd/YAG laser (532 nm) generating ?6 ns pulses (?25 mJ per pulse).
(92) A saturating laser flash was used to create the P.sub.700.sup.+ (F.sub.A/F.sub.B).sup.? charge-separated state, which occurs in <1 ?s..sup.32 Absorbance changes at 696 nm were monitored with dim 10 ?s flashes before and after the laser flash (starting 250 ?s after the flash) to monitor creation and decay of P.sub.700.sup.+. To eliminate actinic effects of the probing light and electronic artifact due to changing data collection rates, a background transient (with the laser shutter closed) was subtracted. The decay of P.sub.700.sup.+ was fit to a sum of 2-6 exponential decay components using the LevenbergMarquardt iteration algorithm.
(93) Anaerobic adaptation: To allow activation of the hydrogenase enzyme, cells were harvested in early/mid-logarithmic phase (2-6 ?g Chl mL .sup.?1) by centrifugation (3500?g for 5 min) and resuspended in fresh TAP medium at 1-2 ?g Chl mL.sup.?1 (for in vivo H.sub.2 measurements). Ten mL of the cell suspension was placed in a 25 mL clear glass bottle sealed with stoppers, wrapped in aluminum foil and bubbled with argon (flow rate 10-15 mL min .sup.?1) for 90 min in the dark, unless otherwise indicated, prior to the start of the H.sub.2 production period. Once sparging was terminated, cells were agitated on a shaker at 160 rpm.
(94) In vitro hydrogenase activity: Cells were centrifuged and resuspended at ?30 ?g Chl mL.sup.?1 in anaerobic adaptation buffer (50 mM potassium phosphate pH 7.2, 3 mM MgCl.sub.2) and sparged with water-saturated argon for variable times in the dark in the initial experiments; the standard time was 90 min thereafter. For each reaction, 1 mL of reaction buffer (100 mM Tris-HCl pH 7.3, 1 M NaCl, 10 mM methyl viologen, 0.2% Triton X-100) was mixed with 0.2 mL of 100 mM Na.sub.2S.sub.2O.sub.4 (dissolved in 30 mM NaOH) in an anoxic glovebox (Coy) and sealed; the headspace of the vial was sparged with argon for 20 min to remove any residual H.sub.2 from the glovebox gas and warmed to 37? C. prior to injection of 100 ?L of cell suspension into the reaction mixture. The vial was mixed well, temperature was maintained at 37? C. with mild shaking, and aliquots of the headspace gas were removed at intervals and analyzed by gas chromatography (see below).
(95) Gas chromatography (GC) measurements: A model SRI 310 GC equipped with a thermal conductivity detector (TCD) and molecular sieve (13X or 5A) was used for all gas measurements. A sample (80 ?L) of the headspace gas was removed with a 171ORN airtight Hamilton 100 ?L syringe (that had been flushed with argon) and injected into the GC. A 1% H.sub.2/99% N.sub.2 gas mixture (Supelco) was used to create a standard curve for H.sub.2, and air was used as a standard for O.sub.2 and N.sub.2. The O.sub.2:N.sub.2 ratio was used to monitor for air contamination during sampling, as the headspace of all samples was primarily Ar.
(96) Immunoblotting: Polypeptide separation and immunoblotting was performed as described previously..sup.20 Isolated PSI.sup.H6 or PSI-HydA.sup.H6 were loaded on the basis of P.sub.700 photobleaching activity (see below): 1.6 pmol of P.sub.700 for detection of small polypeptides (PsaC, PsaD, PsaCHydA2) or 0.4 pmol of P.sub.700 for detection of larger polypeptides (PsaA).
(97) Membrane inlet mass spectrometry (MIMS) measurements: Cells grown to early log phase were spun down and resuspended to 15 ?g Chl mL .sup.?1 in a total volume of 5 mL in TAP or TP medium (with or without acetate, respectively); 50 mM HEPES (pH 7.2) and 2 mM NaHCO.sub.3 were included to maintain pH and CO.sub.2 levels. Cell were loaded into a closed temperature-controlled (24.5? C.) and stirred MIMS cuvette. Anaerobiosis was achieved in approximately 1 hour due to respiration in the dark; relevant gas masses were monitored continuously. After approximately 1 h, cells were exposed to various intensities of red light (635 nm via the actinic module of the DUAL-PAM 100 from Heinz Walz GmbH) for 2 min interspersed with 2 min darkness. Rates were calculated from the slope of the best linear fit over a 1 min period. H.sub.2 and O.sub.2 analysis was done by MIMS..sup.33 Enforced anaerobiosis with glucose oxidase and glycolaldehyde treatment were performed as described previously..sup.16
(98) Light-to-hydrogen conversion efficiency: PAR was determined with Li-COR photon counter equipped with quantum sensor (LI-190R). Efficiency calculations were performed as previously described.sup.34 with slight modifications.
(99)
(100) where ?G? is the standard Gibbs free energy for water oxidation (237.2 kJ mol .sup.?1 at 25? C. and 1 atm), R is the universal gas constant, T is absolute temperature (K), P? and P are the hydrogen partial pressures (standard and observed, respectively), vh.sub.2=amount of H.sub.2 produced (mol), E.sub.i=energy flux of the incident light (J m.sup.?2 s.sup.?1), A=illuminated surface area (m.sup.2), t=duration of illumination (s). Energy for the incident light was either calculated using the Planck Einstein relation for red light at 630 nm or measured using a LI-200R pyranometer (LI-COR Biosciences, Lincoln, NE, USA) for white light.
(101) Dissolved O.sub.2 measurements in vivo: Dissolved O.sub.2 was monitored with a Firesting O.sub.2 optical oxygen meter (PyroScience). Cells were washed with either fresh TAP or TBP twice, then resuspended at approximately 5 ?g Chl ml.sup.?1. They were dark adapted and sparged with filtered water-saturated air for 10 min before the run. Each run made use of 2 ml of cell suspension stirred continuously in a 5-ml cuvette. For light-dependent O.sub.2 evolution rates, the dark O.sub.2 consumption rate (the average of rates in the dark just before and after illumination) was subtracted from the net evolution rate in the light. For maximal O.sub.2 evolution rates, the cell suspensions (in TBP) were subjected to a 5-min dark period in the presence of 0.2 mM Phenyl-p-benzoquinone (PPBQ; Acros Organics), followed by 5 min of high red light (?2300 ?mol photons m.sup.?2 s.sup.?1) and 5 min of darkness.
(102) NADP.sup.+ photoreduction assay: The reaction mixture (2 mL) consisted of 10 mM sodium ascorbate (Sigma), 17 ?M plastocyanin (Pc: prepared in-house from a recombinant source as described in Kuhlgert 2012), 3 ?M ferredoxin (Fd: prepared in-house from a recombinant source as previously described in Marco 2018), 0.2 ?M FNR (prepared in-house from a recombinant source as previously described in Marco 2018), 2.5 mM NADP.sup.+ disodium salt (Roche), and 27 nM PSI in reaction buffer (50 mM Tris-HCl, pH 7.4, 3.35 mg mL.sup.?1 BSA, 10 mM MgCl.sub.2, 200 mg mL.sup.?1 sucrose, 0.03% (3-DDM). The concentrations of Pc, Fd, and FNR were optimized for maximal reaction rates with WT PSI. Each sample was mixed in a 3-mL quartz cuvette with a stir bar for 3 minutes. All preparatory steps were done in the dark. The reference cuvette contained all components except PSI. Absorbance at 340 nm was measured with a Perkin Elmer Lambda35 double-beam spectrophotometer. Band pass filters (340 nm, 27 nm FWHM, Omega Optical) were placed before the detectors to block actinic light. A red LED light source (630 nm, 300 ?mol photons m.sup.?2 s.sup.?1) was assembled on top of the cuvette and controlled manually. A technical replicate consisted of a dark run of 3 minutes using a data collection frequency of 6 Hz, followed by 3 min of data collected with the actinic light on. The data were analyzed for each run separately; each dark slope was subtracted from the following light slope to obtain a light-dependent rate before averaging. The dark rates never exceeded 11% of the light rates. An initial rate was determined from the slope of the line (linear fit with the instrumental weighting of error) to the first 9 points of each averaged data set using Beer's law and the extinction coefficient for NADPH at 340 nm (6.22 mM.sup.?1 cm.sup.?1) with a path length of 1 cm.
(103) Flavodoxin photoreduction assay: Recombinant Synechococcus sp. PCC7002 flavodoxin was prepared as previously described in Zhao 1998. The reaction mixture consisted of 100 nM PSI particles in 25 mM Tricine-KOH (pH 8), 50 mM MgCl.sub.2, 20 mM KCl, 0.03% ?-DDM, 5 mM sodium ascorbate, 5 ?M Pc, and 5 ?M flavodoxin. All preparation steps were performed in the dark. Accumulation of flavodoxin semiquinone was monitored with a JTS-10 kinetic spectrometer (Bio-Logic) using 10-?s flashes centered at 573 nm (6 nm full width at half maximum). Actinic light consisted of 250-ms LED pulses at 630 nm (3000 ?mol m.sup.31 2 s.sup.?1), with the probe flash occurring 50 ms after the actinic pulse ceased, allowing time for any rapid decay processes to be complete. (This 250-ms/50-ms duty cycle was factored in the rate calculations.) An extinction coefficient of 5100 M.sup.?1 cm.sup.?1 for the flavosemiquinone-minus-flavin difference at 573 nm was used, based on the published difference spectrum of Synechococcus sp. PCC7002 flavodoxin (see Meimberg 1999). The slow baseline drift in the dark was subtracted from the rate in the light to yield the light-dependent rate.
(104) O.sub.2 uptake assay: Reaction mixtures were prepared as in the flavodoxin photoreduction experiment, except that 2,6-dichlorophenol indophenol (0.2 mM) was used as mediator instead of Pc, and flavodoxin was not added. Dissolved O.sub.2 was measured with a Clark-type electrode. Each sample was mixed in the dark to saturate with air. Data was collected with 1 Hz frequency for 1 minute in the dark, followed by 2 minutes under saturating illumination from a white LED (1200 ?mol m.sup.?2 s.sup.?1 of PAR). Rates of O.sub.2 consumption/production in the light were calculated for each replicate (n=3) via linear regression of 10-s intervals. The dark rate for each replicate was calculated from the last 2 minutes of the 3-min dark run of the sample before illumination commenced. This dark rate was subtracted from the light rate to determine the light-dependent rate, which was normalized to the amount of photobleachable P.sub.700. The dark rate never exceeded 18% of the corresponding light rate. After data collection, the Chl content of each sample was measured to ensure consistency between replicates.
(105) In vivo P.sub.700 photobleaching and fluorescence measurements: Cells were collected during early log phase, centrifuged (3500?g for 5 min) and resuspended to a Chl concentration of 33 ?g mL.sup.?1 (P.sub.700) or ?9 ?g mL.sup.?1 (fluorescence) in 20% Ficoll? PM400 (GE Healthcare), 10 mM sodium phosphate (pH 7.2). P.sub.700 bleaching and recovery was performed essentially as previously described in Alric 2010. Absorbance changes at 695 nm were measured with the JTS-10 spectrometer. For P.sub.700 photobleaching, actinic light (630 nm) was briefly (200 ?s) switched off for each 10-?s detection measurement during the 10-s illumination period, followed by the dark decay. For fluorescence, cells were dark adapted for 5 min before taking each measurement. (During dark periods, samples were sparged with air to prevent development of anoxia.) Fluorescence emission from Chl was measured with the JTS-10 Fluo59 accessory. A saturating pulse (80 ms, 8 mmol photons m.sup.?2 s.sup.?1, 520 nm) was used to obtain Fmax, measured 170 ?s is after the pulse. The steady-state fluorescence parameter (F.sub.s) was measured after 2 minutes of illumination (520 nm) with actinic light of variable intensities. Quantum yields of PS II (?(II)) were calculated as described in Genty 1989.
(106) Long term H.sub.2 production in a photobioreactor (PBR): Cells were grown in 4 L TAP under ambient room light (?5 ?mol m.sup.?2 s.sup.?1 photosynthetically active radiation (PAR)) with constant air-sparging and stirring. They were harvested in the mid log-phase, resuspended in ?500 mL fresh TAP to OD.sub.735?0.7 (corresponding to 30 ?g/mL of Chl) and transferred to the 400-mL PBR vessel. Once in the FMT150 PBR (see above), the culture was continuously sparged with Ar at 80 mL min.sup.?3, controlled at the influx and monitored at the efflux by mass flow controllers (MC-500SCCM-D/5M, Alicat Scientific, USA). After 2 h of anaerobic adaptation in the dark, the culture was illuminated continuously with white light at 600 ?mol photons m.sup.?2 s.sup.?1 PAR. Sterile argon was hydrated by bubbling through water and then through the sterile TAP media, before it entered the PBR vessel. The PBR was operated in turbidostat mode with OD.sub.735 set to remain between 0.60 and 0.65; Ar-sparged sterile TAP was used to dilute the culture, which was constantly stirred. The PBR gas efflux was passed through a 500-mL trap flask (to retain excess culture) before passing out and through the monitoring mass flow controller. A rubber septum mounted atop the trap flask allowed probing of the efflux gas with an airtight syringe (100 ?L, Hamilton), followed by injection of the sample into the GC-TCD, as in the experimental section.
Results and Discussion
(107) Chimeric protein design and creation: Based on the crystal structure of cyanobacterial PSI (1JB0).sup.35 and a homology model of HydA2,.sup.36 the turn of a ?-hairpin over the terminal FB cluster in PsaC was selected as the optimal insertion point for the hydrogenase domain. The entire sequence of the mature HydA2 hydrogenase from C. reinhardtii was inserted into this site as an in-frame fusion that would effectively split PsaC into two polypeptide segments. (See Experimental Design section for details and
(108) The psaChydA2 gene was introduced into the chloroplast genome by particle-mediated gene transfer using flanking sequences to direct homologous recombination such that it would replace the endogenous psaC gene..sup.25 Serial cloning under selective conditions was maintained until a homoplasmic state was achieved (i.e., all copies of psaC replaced by psaC-hydA2), as verified by PCR (
(109) Subunit composition of PSI-HydA chimera: PSI and PSI-HydA were purified from WT.sup.H6 and ?H1.sup.H6, respectively, via immobilized metal affinity chromatography..sup.28 Purified complexes were denatured with SDS and equivalent amounts of PSI were analyzed by immunoblotting with antibodies against PSI subunits and hydrogenase, to assess the subunit composition of the complexes. The anti-PsaC antibody recognized a ?9 kDa polypeptide in WT PSI (
(110) Roughly equal amounts of PsaA were detected in PSI and PSI-HydA (1.0:1.1;
(111) Based on the structure of cyanobacterial PSI,.sup.35 as well as mutagenesis.sup.38 and modeling.sup.39 studies, it is thought that the Fd-docking site of PSI is formed by PsaC in concert with PsaD. The structure of PSI reveals an intimate interaction between PsaC and a long C-terminal extension of PsaD, and the addition of the HydA domain in the fusion had the potential to interrupt this interaction and prohibit assembly of PsaD into the complex. However, it was observed that the level of PsaD in the purified PSI complexes was similar in both preparations (
(112) Activities of the PSI-HydA chimera in vitro: Laser-flash spectroscopy experiments were performed to assess the photochemical activity of the PSI portion of the PSI-HydA chimera. P.sub.700 is a pair of Chl a molecules serving as the primary electron donor in PSI. Excitation of PSI produces a charge separated state in which P.sub.700 is oxidized (P.sub.700.sup.+) and the terminal acceptor is reduced. In the absence of an electron acceptor, the rate of charge recombination is characteristic of the charge separated state; for example, charge recombination of P.sub.700.sup.+ (FA/FB).sup.? occurs in 40-200 ms, but is >50 times faster from the prior charge separated state (P.sub.700.sup.+ FX). In the absence of the PsaC subunit, the PsaA/PsaB heterodimer is degraded and does not accumulate in C. reinhardtii..sup.40 Therefore, the level of photoactive PSI can be used to assess the ability of PsaC-HydA2 to assemble with and stabilize the PSI core. The amount of photo-bleachable P700 in thylakoid membranes isolated from ?H1 was ?15% that of WT (
(113) TABLE-US-00002 TABLE 20 Fitting parameters of P.sub.700.sup.+ decay in thylakoid membranes parameter PSI PSI-hydrogenase Comments ?.sub.1 91 ? 5.6 ms 79 ? 12 Decay constant of fast phase (ms) A.sub.1 33 ? 0.7% 30 ? 1.5% Amplitude of fast phase (% of total) ?.sub.2 5500 ? 150 4500 ? 290 Decay constant of slow ms phase (ms) A.sub.2 60 ? 0.6% 51 ? 1.3% Amplitude of slow phase (% of total) A.sub.0 6 ? 0.4% 15 ? 0.8% Non-decaying fraction (% of total) R.sup.2 0.9993 0.9961 Coefficient of determination
(114) Table 2. Bi-exponential fitting parameters of P.sub.700.sup.+ decay curves in vitro shown in
(115) P700 photobleaching and recovery in thylakoid membranes: A saturating laser flash was used to trigger charge separation and creation of the P.sub.700.sup.+ (FA/FB).sup.? charge-separated state in <10 ns; (see Fischer 1999 and Brettel and Leibl 2001) photo-induced bleaching of P700 and its recovery were monitored with 10-?sLED flashes. The fast component is attributed to charge recombination of the P.sub.700.sup.+ (FA/FB).sup.? state, which has a decay time of 40-200 ms, whereas the preceding P.sub.700.sup.+ (F.sub.A/F.sub.B).sup.? state recombines in 0.5-1 ms (see Brettel 1997). The slower decay is attributed to reduction of P.sub.700.sup.+ by ascorbate in the fraction of photosystems in which the electron on F.sub.A/F.sub.B escaped to an exogenous acceptor (e.g. O.sub.2) and is commonly seen (see Jordan 1998). Charge recombination from the iron sulfur cluster of hydrogenase domain of the chimera doesn't occur when oxygen is present as over 50% of electrons escape ETC and must be replenished by ascorbate. The fitting parameters are reported in Table 2.
(116) For the experiment shown in
(117) The HydEF/G maturases are required for insertion of the di-iron site into the HydA domain after assembly of the [4Fe-4S] cluster by the chloroplast SUF machinery,.sup.41 and it was unclear if the maturases would be able to access the HydA domain in the new chimeric context. The hydrogenase activity of cells expressing PSI-HydA was assessed in detergent-permeabilized cells with reduced methyl viologen (MV) as electron donor. It was determined that maximal hydrogenase activity was attained within 1.5 hours after a shift to anaerobiosis, similar to what was shown for WT hydrogenases in C. reinhardtii..sup.15 (
(118) Addition of the large HydA domain to PsaC was expected to block its access to electron acceptors such as Fd. This was tested in vitro by assaying the purified protein for light-dependent reduction of low-potential electron acceptors in the presence of ascorbate, a high-potential electron donor. The PSI-HydA chimera exhibited a 9-fold drop in light-driven reduction of cyanobacterial flavodoxin (
(119) Production of H.sub.2 and O.sub.2 in vivo
(120) The ability of the hydrogenase domain in PSI-HydA to carry out H.sub.2 production during dark fermentative conditions, in which Fd is largely reduced by pyruvate:Fd oxidoreductase,.sup.46 was assessed by gas chromatography using a thermal conductivity detector (GC-TCD). Slow accumulation of H.sub.2 in the headspace was observed in the cultures incubated in the dark (
(121) Illumination of the anoxic WT culture resulted in transient H2 production, as observed previously..sup.16,47 The average rate was 28?8 ?mol H.sub.2 h.sup.?1 (mg Chl).sup.?1 during the first hour, but rapidly dropped to negligible levels thereafter (
(122) Like many redox enzymes catalyzing low-potential redox reactions, the algal hydrogenase is inactivated by O.sub.2. One of the reasons for sustained H.sub.2 production by ?H1 is that O.sub.2 does not accumulate in the sealed culture, unlike WT or hydA (
(123) To quantify the instantaneous rates of H.sub.2 and O.sub.2 production by the algal cells, an online membrane inlet mass spectrometry (MIMS) technique was used to measure dissolved gasses during short illumination times (<2 min). The ?H1 cells exhibited a significantly higher H2 evolution rate than WT at photon fluxes above 300 ?mol m.sup.?2 s.sup.?1 and did not saturate until over 1000 ?mol photons m.sup.?2 s.sup.?1 (
(124) We now turn to the possible sinks in ?H1 cells for electrons from PSII. A major motivation for our design was to intercept electrons from the PETC before they reached the Fd pool. Examination of
(125) We tested the utility of this system for long-term H2 production. After anoxia was imposed in a sealed bottle, the culture produced H2 continuously for 5 days at an average rate of 14.0?1.7 ?mol H.sub.2 h.sup.?1 (mg Chl).sup.?1 (
(126) It is somewhat surprising that marrying two very different proteins resulted in such an active chimeric protein. Using the maximal rate estimated from the MIMS experiment, and taking into account the PSI-HydA cellular abundance, one arrives at a H2 production rate of ?170 H.sub.2 s-1 for each PSI-HydA (i.e., 340 electrons s-1). This is in line with previously reported electron throughput rates for PSI..sup.52 It also compares favorably with the PSI-hydrogenase assembly created in vitro that is currently the best in vitro H2 photoproduction device (?50 H.sub.2 s.sup.?1)..sup.53 In both cases, the overall throughput is likely limited by electron donation to P.sub.700. The PSI-HydA chimera may have an advantage there, as algal Pc can reduce P.sub.700 in <50 ?s..sup.54 Based on these calculations, we conclude that the PSI-HydA chimera reported here is actually a very efficient light driven proton photoreduction machine, capable of producing a dihydrogen every 6 ms in vivo.
(127) It is important to realize that the addition of the hydrogenase domain to PSI has created a photosystem that is fundamentally different from PSI, which is a type I reaction center that oxidizes and reduces 1-electron carriers. The PSI-HydA chimera requires 2 electrons to produce 1 H.sub.2. Thus, it first needs to accumulate one electron on the HydA domain; after re-reduction of P.sub.700.sup.+ by plastocyanin and excitation of the reaction center, a second electron can be sent to the hydrogenase active site, resulting in reduction of 2 protons to a dihydrogen molecule. This is more akin to the action of a type II photochemical reaction center, which accumulates 2 electrons to reduce a quinone to quinol (also consuming 2 protons), although in this case the product is a gaseous molecule. Thus, it is not an overstatement to say that we have created a novel photochemical reaction center by fusing hydrogenase to PSI. It is also important to consider the competition between reduction of Fd (requiring 1 electron) and protons (requiring 2 electrons). The longer the delay between the first and second electron arriving at the H-cluster, the more time that Fd has to bind to the HydA domain and steal the electron. This almost certainly explains the very high light flux required to saturate H2 production in the TH1 cultures (
(128) Future efforts to increase H2 production with this system will focus on use of more O.sub.2-tolerant hydrogenases. This would in turn allow use of PSI-HydA chimeras that accumulated to higher levels. While that would increase H.sub.2 production, it would allow more O.sub.2 production. However, as long as the steady-state level of O.sub.2 present in the flow PBR system were not higher than the tolerance of the hydrogenase domain, the system should be able to produce H.sub.2 continuously at a rate significantly higher than reported here. It should also be possible to modulate the partitioning of electrons between reduction of Fd and protons by modifying the Fd binding site of the HydA domain.
(129) Use of the PSI-HydA chimera offers at least 4 advantages: (1) it constitutively expresses the chimeric protein; (2) it directs the majority of electrons from water oxidation to H.sub.2 production; (3) it constrains O.sub.2 evolution from PRI, preserving hydrogenase activity for sustained H.sub.2 production over many days, obviating the need to use nutrient deprivation, PRI inhibitors or mutations; and (4) it preserves the proton pumping and ATP production carried out by the PETC, thus maintaining cell viability. By rewiring photosynthesis to deliver electrons from PSI directly to hydrogenase thus cutting out the Fd middlemanone is no longer at the mercy of cellular metabolic networks. With the system entirely encoded by the algal chloroplast genome, the use of directed evolution techniques to improve the system also becomes possible. Perhaps more important than this particular example, however, is the discovery of a site in PSI that allows in-frame fusion of a protein to intercept electors from PSI. The F.sub.A/F.sub.B clusters of PSI are at a lower reduction potential than any soluble electron carrier in the cell (e.g. Fd, NADPH, thioredoxin). This opens the ability to drive novel redox chemistries not native to plants and algae at high flux by using a large fraction of the electrons from water-splitting and the PETC.
REFERENCES
(130) 1 S. S. Veeravalli, S. R. Shanmugam, S. Ray, J. A. Lalman and N. Biswas, in Advanced Bioprocessing for Alternative Fuels, Biobased Chemicals, and Bioproducts, ed. M. Hosseini, Woodhead Publishing, Cambridge, UK, 2019, vol.15, pp. 289-312. 2 K. D. Swanson, M. W. Ratzloff, D. W. Mulder, J. H. Artz, S.Ghose, A.Hoffman, S. White, 0. A. Zadvornyy, J. B. Broderick, B. Bothner, P. W. King and J. W. Peters, J. Am. Chem. Soc., 2015, 137, 1809-1816. 3 N. Nelson and A. Ben-Shem, Nat. Rev. Mol. Cell Biol., 2004,5, 971. 4 D. W. Mulder, E. S. Boyd, R. Sarma, R. K. Lange, J. A. Endrizzi, J. B. Broderick and J. W. Peters, Nature, 2010, 465, 248-251. 5 M. C. Posewitz, P. W. King, S. L. Smolinski, L. Zhang, M. Seibert and M. L. Ghirardi, J. Biol. Chem., 2004, 279, 25711-25720. 6 B. Ghysels, D. Godaux, R. F. Matagne, P. Cardol and F. Franck, PLoS One, 2013, 8, e64161. 7 G. Torzillo, A. Scoma, C. Faraloni and L. Giannelli, Crit. Rev. Biotechnol., 2015, 35, 485-496. 8 S. Z. To'th and I. Yacoby, Trends Biotechnol., 2019, 37, 1159-1163. 9 I. Yacoby, S. Pochekailov, H. Toporik, M. L. Ghirardi, P. W. King and S. Zhang, Proc. Natl. Acad. Sci. U.S.A., 2011, 108, 9396-9401. 10 D. Nikolova, C. Heilmann, S. Hawat, P. Ga belein and M. Hippler, Photosynth. Res., 2018, 137, 281-293. 11 P. Decottignies, P. Lemarechal, J. P. Jacquot, J. M. Schmitter and P. Gadal, Arch. Biochem. Biophys., 1995, 316, 249-259. 12 P.Decottignies, V. Flesch,C.Ge'rard-Hirne and P. LeMare'chal, Plant Physiol. Biochem., 2003, 41, 637-642. 13 M. Winkler, S. Kuhlgert, M. Hippler and T. Happe, J. Biol. Chem., 2009, 284, 36620-36627. 14 G. Vonabendroth, S. Stripp, A. Silakov, C. Croux, P. Soucaille, L. Girbal and T. Happe, Int. J. Hydrogen Energy, 2008, 33, 6076-6081. 15 T. Happe and J. D. Naber, Eur. J. Biochem., 1993, 214, 475-481. 16 Y. Milrad, S. Schweitzer, Y. Feldman and I. Yacoby, Plant Physiol., 2018, 177, 918-926. 17 S. Kosourov, M. Jokel, E. M. Aro and Y. Allahverdiyeva, Energy Environ. Sci., 2018, 1-2. 18 K. Brettel, Biochim. Biophys. Acta, Bioenerg., 1997, 1318, 322-373. 19 M. Forestier, P. King, L. Zhang, M. Posewitz, S. Schwarzer, T. Happe, M. L. Ghirardi and M. Seibert, Eur. J. Biochem., 2003, 270, 2750-2758. 20 K. Reifschneider-Wegner, A. Kanygin and K. E. Redding, Int. J. Hydrogen Energy, 2014, 39, 3657-3665. 21 A. Sawyer, Y. Bai, Y. Lu, A. Hemschemeier and T. Happe, Plant J., 2017, 90, 1134-1143. 22 L. A. Kelley, S. Mezulis, C. M. Yates, M. N. Wass and M. J. E. Sternberg, Nat. Protoc., 2015, 10, 845-858. 23 D. Kozakov, D. R. Hall, B. Xia, K. A. Porter, D. Padhorny, C. Yueh, D. Beglov and S. Vajda, Nat. Protoc., 2017, 12, 255. 24 A. Fiser, R. K. G. Do and A. S ali, Protein Sci., 2000, 9, 1753-1773. 25 N. Fischer, P. Se'tif and J. D. Rochaix, Biochemistry, 1997, 36, 93-102. 26 J. E. Meuser, S. D'Adamo, R. E. Jinkerson, F. Mus, W. Yang, M. L. Ghirardi, M. Seibert, A. R. Grossman and M. C. Posewitz, Biochem. Biophys. Res. Commun., 2012, 417, 704-709. 27 N. Fischer, O. Stampacchia, K. Redding and J.-D. Rochaix, Mol. Gen. Genet., 1996, 251, 373-380. 28 G. Gulis, K. V. Narasimhulu, L. N. Fox and K. E. Redding, Photosynth. Res., 2008, 96, 51-60. 29 Y. Li, M.-G. Lucas, T. Konovalova, B. Abbott, F. MacMillan, A. Petrenko, V. Sivakumar, R. Wang, G. Hastings, F. Gu J. van Tol, L.-C. Brunel, R. Timkovich, F. Rappaport and K. Redding, Biochemistry, 2004, 43, 12634-12647. 30 J. Kropat, A. Hong-Hermesdorf, D. Casero, P. Ent,M. Castruita, M. Pellegrini, S. S. Merchant and D.Malasarn, Plant J., 2011, 66, 770-780. 31 R. J. Porra, W. A. Thompson and P. E. Kriedemann, Biochim. Biophys. Acta, Bioenerg., 1989, 975, 384-394. 32 M. Byrdin, S. Santabarbara, F. Gu, W. V. Fairclough, P. Heathcote, K. Redding and F. Rappaport, Biochim. Biophys. Acta, Bioenerg., 2006, 1757, 1529-1538. 33 O. Liran, R. Semyatich, Y. Milrad, H. Eilenberg, I. Weiner and I. Yacoby, Plant Physiol., 2016, 172, 264-271. 34 S. Kosourov, M. Jokel, E. M. Aro and Y. Allahverdiyeva, Energy Environ. Sci., 2018, 11, 1431-1436. 35 P. Jordan, P. Fromme, H. T. Witt and O. Klukas, et al., Nature, 2001, 411, 909. 36 C. H. Chang, P. W. King, M. L. Ghirardi and K. Kim, Biophys. J., 2007, 93, 3034-3045. 37 O. Ostersetzer and Z. Adam, Plant Cell, 1997, 9, 957-965. 38 P. Se'tif, N. Fischer, B. Lagoutte, H. Bottin and J. D. Rochaix, Biochim. Biophys. Acta, Bioenerg., 2002, 1555, 204-209. 39 D. J. Cashman, T. Zhu, R. F. Simmerman, C. Scott, B. D. Bruce and J. Baudry, J. Mol. Recognit., 2014, 27, 597-608. 40 Y. Takahashi, M. Goldschmidt-Clermont, S. Y. Soen, L. G. Franze'n, J. D. Rochaix, L. G. Franzen and J. D. Rochaix, EMBO J., 1991, 10, 2033. 41 E. M. Shepard, F. Mus, J. N. Betz, A. S. Byer, B. R. Duffus, J. W. Peters and J. B. Broderick, Biochemistry, 2014, 53, 4090-4104. 42 H. Witt, E. Bordignon, D. Carbonera, J. P. Dekker, N. Karapetyan C. Teutloff, A. Webber, W. Lubitz and E. Schlodder, J. Biol. Chem., 2003, 278, 46760-46771. 43 P. Se'tif, Biochim. Biophys. Acta, Bioenerg., 2001, 1507, 161-179. 44 N. Fischer, EMBO J., 1998, 17, 849-858. 45 K. Meimberg, N. Fischer, J. D. Rochaix and U. Muhlenhoff, Eur. J. Biochem., 1999, 263, 137-144. 46 J. Noth, D. Krawietz, A. Hemschemeier and T. Happe, J. Biol. Chem., 2013, 288, 4368-4377. 47 O. Ben-Zvi, E. Dafni, Y. Feldman and I. Yacoby, Biotechnol. Biofuels, 2019, 12, 266. 48 S. P. Chapman, C. M. Paget, G. N. Johnson and J. M. Schwartz, Front. Plant Sci., 2015, 6, 474. 49 L. Wang, W. Gong, A. Lin and B. Hu, Int. J. Biometeorol., 2014, 58, 1711-1720. 50 D. L. Erbes, D. King and M. Gibbs, Plant Physiol., 1979, 63, 1138-1142. 51 R. C. Sicher, in Advances in Photosynthesis Research: Proceedings of the Vlth International Congress on Photosynthesis, Brussels, Belgium, August 1-6, 1983, ed. C. Sybesma, Springer, Netherlands, Dordrecht, 1984, pp. 413-416. 52 H. Takahashi, S. Clowez, F.-A. Wollman, O. Vallon andF. Rappaport, Nat. Commun., 2013, 4, 1954. 53 C. E. Lubner, A. M. Applegate, P. Knorzer, A. Ganago, D. A. Bryant, T. Happe and J. H. Golbeck, Proc. Natl. Acad. Sci. U.S.A., 2011, 108, 20988-20991. 54 S. Santabarbara, K. E. Redding and F. Rappaport, Biochemistry, 2009, 48, 10457-10466. 55 H. Bohme, Eur. J. Biochem., 1978, 83, 137-141. 56 D. Weis, G. Schneider, B. Niemann, P. Guttmann, D. Rudolph and G. Schmahl, Ultramicroscopy, 2000, 84, 185-197. 57 J. E. W. Polle, J. R. Benemann, A. Tanaka and A. Melis, Planta, 2000, 211, 335-344. S. Kuhlgert, F. Drepper, C. Fufezan, F. Sommer and M. Hippler, Biochemistry, 2012, 51, 7297-7303. P. Marco, M. Kozuleva, H. Eilenberg, Y. Mazor, P. Gimeson, A. Kanygin, K. Redding, I. Weiner and I. Yacoby, Biochim. Biophys. Acta-Bioenerg., 2018, 1859, 234-243. J. Zhao, R. Li and D. A. Bryant, Anal. Biochem., 1998, 264, 263-270. K. Meimberg and U. Muhlenhoff, Photosynth. Res., 1999, 61, 253-267. J. Alric, J. Lavergne and F. Rappaport, Biochim. Biophys. Acta-Bioenerg., 2010, 1797, 44-51. B. Genty, J.-M. Briantais and N. R. Baker, Biochim. Biophys. Acta-Gen. Subj., 1989, 990, 87-92. N. Fischer, P. Setif and J. D. Rochaix, J. Biol. Chem., 1999, 274, 23333-23340. K. Brettel and W. Leibl, Biochim. Biophys. Acta-Bioenerg., 2001, 1507, 100-114. K. Brettel, Biochim. Biophys. Acta-Bioenerg., 1997, 1318, 322-373. R. Jordan, U. Nessau and E. Schlodder, in Photosynthesis: Mechanisms and Effects, ed. G. Garab, Springer Netherlands, Dordrecht, 1998, pp. 663-666.
Example 2-In Vivo Fusion of Photosystem I (PS1) and Algal Hydrogenase 1
(131) We have previously demonstrated that a photosystem I-hydrogenase chimera, in which light-driven charge separation in photosystem I feeds electrons directly into the hydrogenase domain, allowing for prolonged photobiological hydrogen production. Here we describe a new PSI-hydrogenase chimera using HydA1, the more abundant and physiologically active endogenous hydrogenase of Chlamydomonas reinhardtii. The resulting transformants in a C. reinhardtii strain lacking endogenous hydrogenases showed that PSI-HydA1 is active and accumulates ?5 times more chimeric protein than the previous PSI-HydA2 chimera. The majority of chimeric hydrogen production activity can be restored after complete inactivation by oxygen without requiring new synthesis of PSI or the PsaC-HydA1 polypeptide. The PSI-HydA1 chimera reduces ferredoxin in vivo to such an extent that it can drive the Calvin-Benson-Bassham cycle, leading to sufficiently high O.sub.2 levels that eventually inactivate the hydrogenase, as hypothesized earlier.
Experimental Design
(132) Design of PsaC-HydA1 chimera: A complete annotated protein sequence of PsaC-HydA1 is shown in
(133) The transit peptide sequence of HydA1 (first 56 amino acids.sup.28) was removed and the remaining unstructured region (AAPAAEAPLS; SEQ ID NO: 15) leading up to the first ?-helix H67-L75 was replaced with the sequence used in the psaC-hydA2 construct (
(134) For modeling the PsaC-HydA1 chimera, the crystal structure of HydA1 (3LX4) was used as the ligand and PsaA, PsaB, PsaC (D32-K35 residues removed) and PsaF subunits of C. reinhardtii PSI (6IJP.sup.29) were used as a receptor in docking with ClusPro2. Unstructured terminal residues (6 N-terminal residues only) were removed from the ligand by the ClusPro2 algorithm prior to docking. Also, distance restraints of 1-25 ? were placed between the outermost cysteine of the FB iron-sulfur cluster (Cys14) and the outermost cysteines of the H-cluster: cysteines 185 or 377 in 3LX4 (corresponding to cysteines 199 or 391 in PsaC-HydA1, respectively). The most plausible model was chosen based on the ClusPro2 energy minimization algorithm. Linking regions between PsaC and HydA1 domains were modeled with the help of the Robetta web server by uploading docked coordinates into their comparative modeling option.sup.30. The PsaD subunit (6IJJ, chain D) was aligned as in native PSI. PyMOL.sup.31 was used for generation of final images as well as structure alignments.
(135) For modeling ferredoxin docking to the PSI-HydA1 chimera, ferredoxin 1 of the 2N0S mode1.sup.32 was used as a ligand and PsaA, PsaB, PsaC-HydA1, PsaD, and PsaF of our model as receptor in ClusPro2 server. A single distance restraint of 1-25 ? between Cys42 of ferredoxin and Cys391 of PsaC-HydA1 were used.
(136) Generation of algal mutants bearing chimeric photosystem 1-hydrogenase: All transformations were carried out in hydA strain (mt hydAl-1, hydA2-1).sup.33 that lacks both endogenous hydrogenases via DNA-coated particle bombardment.sup.27.
(137) PCR for homoplasmy confirmation: PsaC-HydA1 homoplasmy confirmation was performed with flanking primers (PsaC5: TAATATGGAGATGACATATTTAG (SEQ ID NO: 10) and PsaC3: GATCTCACCAAGATACTCCC (SEQ ID NO: 11)) on 100 ng of genomic DNA as previously described.sup.27, with minor modifications. Detection limit of psaC was tested by making a series of dilutions of genomic DNA of parental strain (containing psaC gene) into ?H2 genomic DNA (containing psaC-HydA2 gene known to be homoplamic).
(138) Growth conditions: Alga was routinely grown on Tris-acetate-phosphate (TAP) medium with revised mineral nutrient supplement.sup.34 as previously described.sup.27.
(139) For growth assay on plates, 10 ?L (?10.sup.4 cells) cells resuspended in the same buffer as the corresponding agar plate were spotted and let dry for 10 min. Then, plates were either sealed with parafilm to prevent further drying or placed in the anaerobe pouch (for high CO.sub.2/anoxia conditions). 1.4% agar TAP or TBP (Tris-bicarbonate phosphate) plates were used. TBP containing plates were prepared by replacing acetate (16.6 mM) with sodium bicarbonate (25 mM, pH 7.0). Growth assay was performed under continuous white fluorescent light (70 ?mol m.sup.?2 s.sup.?1). Plates were photographed on the second and 7.sup.th day of growth.
(140) Chlorophyll (Chl) measurement: Chl a+b concentrations were determined by method of Porra in 80% acetone.sup.35.
(141) Thylakoids and PSI preparation; Cells were grown in TAP to mid-to-late log phase in 4 L flasks with aeration and stirring under ambient room light (<5 ?mol m.sup.2s.sup.?1 white fluorescent). Thylakoids were prepared as previously described.sup.36 with minor modifications. Cells harvested at 3500?g at 4? C. for 10 min. The pellet was washed with buffer H1 (25 mM HEPES-KOH, 5 mM MgCl.sub.2, 0.3 M sucrose, pH 7.5), flash-frozen in liquid nitrogen and stored at ?80? C. Further steps were done in the dark. Cells resuspended in H1+1 mM phenylmethane sulfonyl fluoride to 4?10.sup.8 cells m1.sup.?1 were broken by French press applying ?1.7 tons of pressure or Branson Sonifier S-450 using amplitude 3 (50% duty cycle) for 2 min ON followed by 2 min OFF and repeated 3 times under temperature control (4? C.). The membranes were pelleted at 20000?g for 10 min and washed with buffer H2 (5 mM HEPES-KOH, 10 mM EDTA, 1.8 M sucrose, pH 7.5). The washed pellet was resuspended in buffer H3 (5 mM HEPES-KOH, 10 mM EDTA, 1.8 M sucrose, pH 7.5) and overlaid with buffer H4 (1.3 M sucrose) and H5 (0.5 M sucrose) in a gradient tube. After 1 h of centrifugation (SW-28 rotor at 112400 x g) the upper green band formed between 0.5 M and 1.3 M sucrose layers was pooled with the lower band (1.3 M/1.8M sucrose). Purified membranes were centrifuged (90000?g for 30 min) and resuspended in H6+20% glycerol for storage at ?80? C.
(142) Anoxic PSI-HydA1 isolation: As previously described for PSI-HydA2.sup.27. Since PSI was not tagged, we used our sucrose gradient protocol for anoxic PSI isolation (adding ?2 mM sodium dithionite at every step).
(143) Laser-flash spectroscopy: Our experimental setup was very similar to what is described in.sup.27. Thylakoids (?60 ?g Chl mL.sup.?1 in 25 mM HEPES-KOH, pH 7.5, 5 mM sodium ascorbate) or PSI particles (?6 ?g Chl mL.sup.?1 in 25 mM tricine-KOH, 300 mM KCl pH 8.0, 10% glycerol, 0.03% ?-DDM, 5 mM sodium ascorbate) were kept on ice in the dark before measurements. Absorbance changes at 696 nm were triggered by 20-25 mJ excitation flash (6 ns) generated by a frequency-doubled Nd/YAG laser (532 nm) and probed with weak LED pulses (10 ?s) using JTS-10 (Bio-Logic) spectrophotometer. Once saturation of P.sub.700.sup.+ signal was established, its decay was recorded, and background transient subtracted. Background transient was collected by running the same sequence with laser shutter closed. It consists of actinic effects of probing light and electronic artifact (due to changing collecting rates).
(144) In vitro hydrogenase activity: This assay is similar to what we used before.sup.27. Cells were resuspended in TAP at ?30 ?g Chl ML.sup.?1. 0.2 mL of cell suspension was taken at various times during anaerobic adaptation and mixed with pre-sparged (Ar), pre-warmed (37? C.) reaction buffer (100 mM Tris-HCl, pH 7.3, 1 M NaCl, 8 mM methyl viologen, 0.2% Triton X-100, 16 mM sodium dithionite). After 10-30 min of incubation at 37? C. with agitation, headspace of the vial was probed with gas chromatography. For inhibition with chloramphenicol (CAM), a 50 mg/mL CAM stock solution in ethanol was freshly prepared.
(145) Gas chromatography (GC) measurements: A model SRI 310 gas chromatograph with thermal conductivity detector and 5 ? molecular sieve prepacked column (3 ft long) was used in all measurements. Gas tight syringes (1700 series) with non-coring needles were used for probing headspace.
(146) Western blotting: Immunoblots were performed as described in.sup.27. Solubilized thylakoids were loaded on the basis of the same P.sub.700.sup.+ photobleaching (1.41 pmol) or the same Chl (2 ?g) amounts.
(147) Membrane inlet mass spectrometry (MIMS) measurements of H.sub.2, O.sub.2 and CO.sub.2 in vivo: Cells were washed once with TP media, then resuspended in either TP or TAP media to 15 ?g/mL of total Chl. Anaerobic adaption was done in 25-mL Wheaton glass bottles covered with aluminum foil. Cell suspensions were sparged with either argon or nitrogen at 100 mL min.sup.?1 for 10 min, followed up by at least 3 hours of agitation in the dark. Five mL of suspended cells were injected into a continuously purged (500 mL min.sup.?1 N.sub.2) custom-built glass cuvette (5 mL) with 4 ports on top. 2 mM sodium bicarbonate in 50 mM HEPES-KOH (pH 7.2), 10 ?M DCMU in DMSO and 40 mM glycolaldehyde (GA) final concentrations were added where indicated followed up by removing purging line and incubating with continuous stirring in the dark for 5 minutes. Cuvette was kept at 24? C. and stirring via Peltier temperature programmer (PTP-1 by Perkin Elmer). Red LED lights (Hansatech instruments) of various intensity were used to illuminate the cuvette.
(148) QMG 220 M1 Prisma Plus compact mass spectrometer (Pfeiffer vacuum) equipped with gas-tight ion source was connected to a home-built membrane inlet system. The system was made of ? OD stainless steel tubing (0.035 wall thickness) that included a loop for cold trap, a port for a pressure gauge, an external vacuum line port and a narrowing to 1/16 OD stainless steel probe at the end where silicone-based polymer tube was attached. Membrane inlet consisted of 7 mm long tube supported by rings on the inside and ended with 5 mm long silicone rubber tapered plug. A mixture of dry ice and ethanol was used for the cold trap in all experiments.
(149) Ion currents (m/z 2, m/z 32, m/z 44) were collected with a 0.5 s dwelling time and used for H.sub.2, O.sub.2 and CO.sub.2 determination, respectively. Standards were made by sparging cell-free buffers either with a 1% H.sub.2 (balance N.sub.2) standard (Matheson) or air at the known pressure until equilibrium was reached. Rates of gas consumption by the mass spectrometer were calculated after removing sparging from cell free buffers as described elsewhere.sup.38.
(150) In vivo dissolved O.sub.2 measurements with FireSting-O.sub.2: Cells were grown on TAP to mid-to-late log phase. Then, they were resuspended in TAP+25 mM sodium bicarbonate (freshly made) to ?20 ?g of Chl) mL.sup.?1 and briefly sparged with air to saturate with oxygen. Once placed in the cuvette with continuous stirring, O.sub.2 concentration was measured with FireSting-O.sub.2 (Pyroscience) probe for dark respiration (5 min) followed by 5 min of continuous red light (?1435 ?mol PAR m.sup.?2 s.sup.?1). Gross oxygen rate was calculated as Light (net) minus dark rates.
(151) In vivo P.sub.700.sup.+ recovery measurements, chlorophyll fluorescence measurements and quantum yield of PSII: Cells were collected during early log phase, centrifuged (3500?g for 5 min) and resuspended in 10 mM sodium phosphate (pH 7.0), 2 mM sodium bicarbonate and 20% Ficoll? PM400 (GE Healthcare) to ?30 ?g/mL Chl (P.sub.700.sup.+) or 9 ?g Chl mL.sup.?1 (fluorescence). Cells were dark adapted for 5 min before taking each measurement. (During dark periods, samples were briefly sparged with air to prevent development of anoxia.) P.sub.700.sup.+ signal was measured with JTS-10 as previously described.sup.27. Fluorescence emission from Chl was measured with the JTS-10 Fluo59 accessory. A saturating pulse (80 ms, 8 mmol photons m.sup.?2, s.sup.?1, 520 nm) was used to obtain F.sub.max, measured 170 ?s after the pulse. The steady-state fluorescence parameter (F.sub.s) was measured after 2 minutes of illumination (520 nm) with actinic light of variable intensities. Quantum yields of PS II (?.sub.II)) were calculated as described.sup.39.
Results and Discussion
(152) Chimeric protein making: Based on our previous work with the PsaC-HydA2 chimera and the close similarity of the two endogenous hydrogenases of C. reinhardtii, we designed a PsaC-HydA1 construct that has 78% identity and 88% similarity to the PsaC-HydA2 chimera (
(153) The psaC-hydAl gene was introduced into the chloroplast genome of the hydA1-1 hydA2-1 strain via biolistic transformation followed up by homologous recombination, as previously described for the psaC-hydA2 gene.sup.27. After several passages on selective plates, transformants were screened for homoplasmy (i.e., all copies of the chloroplast genome contained the same psaC-hydA1 in place of psaC; see
(154) Expression of PsaC-HydA1 was verified by immunoblots using solubilized thylakoid membranes prepared from aerobically grown cells. We measured the amount of photoactive PSI in WT and ?H2 thylakoids (as described below) and loaded equal amounts of PSI reaction centers. When probed with anti-PsaC antibodies (
(155) Spectroscopic characterization of the PSI-HydA1 chimera: The light-driven generation of a stable charge-separated state in PSI can only be achieved if all core subunits carrying electron transfer cofactors are functional and properly assembled into the PSI complex. Since we replaced the PsaC subunit, which coordinates the terminal iron sulfur clusters of PSI, with the PsaC-HydA1 chimera, we wanted to see if it is still capable of assembling into PSI and whether we could detect the additional iron sulfur cluster within the H-cluster of hydrogenase.
(156) Thylakoid membranes prepared from aerobically grown cultures were used as samples in a P.sub.700 photobleaching experiment. The amplitude of the P.sub.700.sup.+ signal from ?H2 thylakoids after a saturating laser flash was 76% of the parental strain (
(157) TABLE-US-00003 TABLE 4 Fitting coefficients of P.sub.700.sup.+ decay in thylakoids parameter PSI PSI-hydrogenase Comments ?.sub.1 77 ? 4.5 ms 123 ? 9 ms Decay constant of fast phase (ms) A.sub.1 31 ? 0.6% 23.2 ? 0.6% Amplitude of fast phase (% of total) ?.sub.2 4.3 ? 0.1 s 10 ? 0.3 s Decay constant of slow phase (s) A.sub.2 66 ? 0.5% 71.1 ? 0.7% Amplitude of slow phase (% of total) A.sub.0 1.6 ? 0.3% 3.7 ? 0.8% Non-decaying fraction (% of total) R.sup.2 0.99951 0.99931 Coefficient of determination
(158) As noted previously, the absence of exogenous electron acceptors is crucial for longevity of charge separated state and measuring charge recombination kinetics. To remove oxygen as a potential electron acceptor, we anaerobically adapted ?H2 cells and isolated the PSI-HydA1 complex anoxically. Another PSI-HydA1 preparation was accomplished without anaerobic adaptation and in the presence of air as a control. P700 recovery kinetics of anoxic and oxic PSI-HydA1 after a single saturating laser flash are presented in
(159) TABLE-US-00004 TABLE 5 Fitting coefficients of P.sub.700.sup.+ decay in isolated PSI-HydA1 particles Time constant ? SE, ms (relative amplitude, %) Phase assignment PSI-HydA1 (oxic) PSI-HydA1 (anoxic) CR of P.sub.700.sup.+(F.sub.AF.sub.B).sup.? 42 ? 6 (19 ? 3) 29 ? 2 (28 ? 4) 183 ? 21 (20 ? 3) 86 ? 11 (40.5 ? 2.5) CR of P.sub.700.sup.+F.sub.H.sup.? N/A 269 ? 34 (13.5 ? 3.5) ascorbate 40,000 ? 4100 (65 ? 5) 14500 ? 400 (17.8 ? 0.2) Non-decaying ?(5 ? 5) ?(?1.3 ? 0.2) R.sup.2 0.99968 0.99999
(160) PSI-HydA1 activity in vitro: The HydEF and HydG maturases are necessary for insertion of the unique diiron site, completing H-cluster assembly of the [FeFe]-hydrogenase. The ?H2 strain accumulates about 5 times as much photoactive PSI-HydA as the PSI-HydA2 chimera in the TH1 mutant. It was thus important to determine the time necessary for maturation of all the PSI-HydA1 chimera, as it might be longer in the ?H2 strain. The activity of hydrogenase can be assayed in detergent-permeabilized cells using reduced methyl viologen as electron donor. We performed this assay to determine maximal hydrogenase activity in cells after anaerobic adaptation for various amounts of time (
(161) Like the PsaC polypeptide, the P saC-HydA 1 chimeric polypeptide is constitutively expressed in the chloroplast, as opposed to anaerobically induced. In contrast, the HydA1 product is increased by at least 6-fold in anoxia.sup.40. This provided an opportunity to use the methyl viologen assay to monitor the maturation and re-activation of PSI-HydA1 in vivo. Chloramphenicol (CAM) an inhibitor of translation in the chloroplast.sup.41was added to cells immediately before anaerobic adaptation to block further synthesis of PSI-HydA1. (The PsaA, PsaB, PsaC-HydA1 core subunits are all made by chloroplast ribosomes.) After 4 h of anaerobic adaptation, the amount of hydrogenase activity was >90% of the control activity observed without chloramphenicol treatment (
(162) To test the ability of the maturase system to re-activate hydrogenase that had been inactivated by exposure to O2, we took control cells that had undergone 4 hours of anaerobic adaptation (in the absence of chloramphenicol) and bubbled them with air for 5 minutes. This was sufficient to kill all the hydrogenase activity, as verified by the assay. Chloramphenicol was added to the receiving vessel during cell transfer to aerobic conditions to prevent synthesis of new PsaC-HydA1 (prior to sparging with air). Another 4 h anaerobic adaptation was performed before measurement of hydrogenase activity. More than 60% of the activity was recovered, indicating that the algal maturases are capable of re-activating hydrogenase in at least half of the active sites previously inactivated by O.sub.2 (
(163) Hydrogen evolution in vivo: We first examined the chimera's ability to carry out H.sub.2 production in vivo in the dark. For H.sub.2 production to take place, the electron donor (reduced ferredoxin) must transiently bind to PsaC-HydA1 and transfer an electron to one of the iron-sulfur clusters, ultimately arriving at the H-cluster; this must happen twice for each H.sub.2 produced. Since the native binding mode of ferredoxin 1 (the major form) to either HydA1 or PsaC is highly unlikely, according to our modeling (see
(164) TABLE-US-00005 TABLE 3 Maximal rate ?mol H.sub.2 (mg Chl).sup.?1 h.sup.?1 Conditions 797 ? 53 Reduced methyl viologen in permeabilized cells after 4 h of anaerobic induction (GC) (n = 9) 723 ? 140 Reduced methyl viologen in permeabilized cells (GC) (n = 3) with 200 ?g/mL CAM added at the beginning of anaerobic adaptation (4 hours of anaerobic induction) 18 ? 2 TP under ~200 ? mol m.sup.?2 s.sup.?1 (white fluorescent) light (GC) (n = 3) 21 ? 1 TAP under ~200 ? mol m.sup.?2 s.sup.?1 (white fluorescent) light (GC) (n = 3) 1.5 ? 0.3 TAP in the dark (GC) (n+326) 3.1 ? 0.3 TP (+10 ?M DCMU) under ~200 ? ?mol m.sup.?2 s.sup.?1 (white fluorescent) light (GC) (n = 3) 58 ? 14 TP, under 1170 ?mol m.sup.?2 s.sup.?1 (red LED) light (MIMS) (n = 5) 59 ? 11 TAP, under 1170 ?mol m.sup.?2 s.sup.?1 (red LED) light (MIMS) (n = 3) 39 ? 5 TP (+2 mM bicarbonate), under 1170 ?mol m.sup.?2 s.sup.?1 (red LED) light (MIMS) (n = 3) 6 ? 1 TP (+10 ?M DCMU) under 1170 ?mol m.sup.?2 s.sup.?1 (red LED) light (MIMS) (n = 3) 52 ? 18 TP (+2 mM bicarbonate + 40 mM GA), under 1170 ?mol m.sup.?2 s.sup.?1 (red LED) light (MIMS) (n = 3)
(165) We next measured photobiohydrogen production in closed glass bottles (
(166) It is worth mentioning that after 18 hours of illumination, ?H2 cells in the presence of acetate grew significantly better, consumed some hydrogen from the headspace, and produced copious amounts of oxygen (?8% O.sub.2 in the headspace). In the same time period, ?H2 cells without acetate hardly grew at all and accumulated 20 times less O.sub.2. They also did not consume H.sub.2; in fact, a ?50% increase in headspace H.sub.2 was seen overnight.
(167) Addition of 3-(3,4-dichlorophenyl)-1,1-dimethylurea (DCMU)a potent PSII inhibitor to cultures without acetate resulted in a 6-fold decrease in H2 production (
(168) Membrane inlet mass spectrometry (MIMS) was employed to monitor instantaneous rates of gas evolution/consumption. Cells were grown on TAP under low (?5 ?mol m.sup.?2 s.sup.?1 white fluorescent) light, anaerobically adapted (3 h) before being injected into the MIMS cuvette, which was continuously flushed with N.sub.2. Once sealed inside the cuvette, the N.sub.2 line was removed and ion currents were measured for H.sub.2, O.sub.2, and CO.sub.2 under increasing intermittent illumination followed by continuous illumination. (see
(169) The maximal oxygen evolution rate increased with increasing light flux for cultures without acetate (
(170) The decrease in oxygen evolution rate coincided with an increased CO.sub.2 evolution rate (
(171) Instantaneous rates of H.sub.2 evolution measured during the first 2 min of illumination did not match well the rates observed during longer irradiances (compare
(172) To bridge the gaps in our understanding of physiology of ?H2 mutant, we monitored H.sub.2, O.sub.2, and CO.sub.2 rates with MIMS during a 30-min period of continuous high illumination (1435 i.tmol red photons m.sup.?2 s.sup.?1) using cells that had undergone the cycles of increasing light (2 min ON, 3 min OFF) shown in
(173) Under similar conditions, wild type cells (D66) exhibited a sudden surge in H.sub.2 evolution that switched to net H.sub.2 uptake within 5 min, three times faster than the ?H2 strain (
(174) Under conditions of excess bicarbonate (without acetate), ?H2 cells showed a much smaller initial surge in H.sub.2 evolution (?35 ?mol H.sub.2 (mg Chl).sup.?1 h.sup.?1), which switched to H.sub.2 uptake within 2 minutes of the onset of light (
(175) Addition of 40 mM glycol aldehyde (GA) an inhibitor of the CBB cycleto ?H2 cells in the presence of excess bicarbonate resulted in an initial H2 evolution rate of ?45 ?mol (mg Ch1).sup.?1 h.sup.?1 (
(176) Our previous observations of the ?H1 mutant demonstrated the benefits of adding acetate to the media for photobiohydrogen production, in terms of both maximal rate and longevity. Our long-term experiments with ?H2 did not show a clear advantage of having acetate in the media for photobiohydrogen production (
(177) In the best performing trial (
(178) Cyclic electron flow (CEF) in ?H2 in vivo: CEF around PSI is an effective way to deal with ATP shortages in the light. In the typical paradigm of oxygenic photosynthesis, electrons from the acceptor side of PSI can enter the plastoquinone pool, thus forming a cycle. To test ?H2's ability to perform CEF under fully aerobic conditions (where they cannot make H.sub.2), we added 10 ?M DCMU to cells and then illuminated them for 10 s, after which the P.sub.700.sup.+ decay rate was measured as a proxy for CEF (
REFERENCES
(179) 1 Hydrogen Council, Hydrogen Insights 2021, 2021.
(180) 2 J. Swartz, Curr. Opin. Biotechnol., 2020, 62, 248-255.
(181) 3 A. Stirbet, D. Lazar, Y. Guo and G. Govindjee, Ann. Bot., 2020, 126, 511-537.
(182) 4 W. J. Nawrocki, B. Bailleul, D. Picot, P. Cardol, F. Rappaport, F.-A. Wollman and P. Joliot, Biochim. Biophys. Acta-Bioenerg., 2019, 1860, 433-438.
(183) 5 L. Cournac, F. Mus, L. Bernard, G. Guedeney, P. M. Vignais and G. Peltier, Int. J. Hydrogen Energy, 2002, 27, 1229-1237.
(184) 6 S. Clowez, D. Godaux, P. Cardol, F.-A. Wollman and F. Rappaport, J. Biol. Chem., 2015, 290, 8666-8676.
(185) 7 Y. Milrad, S. Schweitzer, Y. Feldman and I. Yacoby, Plant Physiol., 2018, 177, 918-926.
(186) 8 D. Godaux, B. Bailleul, N. Berne and P. Cardol, Plant Physiol., 2015, 168, 648-658.
(187) 9 A. Burlacot, A. Sawyer, S. Cuine, P. Auroy-Tarrago, S. Blangy, T. Happe and G. Peltier, Plant Physiol., 2018, 177, 1639 LP 1649.
(188) 10 W. Lubitz, H. Ogata, O. Rudiger and E. Reijerse, Chem. Rev., 2014, 114, 4081-4148.
(189) 11 M. Winkler, S. Kuhlgert, M. Hippler and T. Happe, J. Biol. Chem., 2009, 284, 36620-36627.
(190) 12 M. Winkler, A. Hemschemeier, J. Jacobs, S. Stripp and T. Happe, Eur. J. Cell Biol., 2010, 89, 998-1004.
(191) 13 Y. Milrad, S. Schweitzer, Y. Feldman and I. Yacoby, Plant Physiol., 2021, 186, 168-179.
(192) 14 M. C. Posewitz, P. W. King, S. L. Smolinski, L. Zhang, M. Seibert and M. L. Ghirardi, J. Biol. Chem., 2004, 279, 25711-25720.
(193) 15 G. Berggren, A. Adamska, C. Lambertz, T. R. Simmons, J. Esselborn, M. Atta, S. Gambarelli, J.-M. Mouesca, E. Reijerse, W. Lubitz, T. Happe, V. Artero and M. Fontecave, Nature, 2013, 499, 66-69.
(194) 16 Y. Bai, T. Chen, T. Happe, Y. Lu and A. Sawyer, Metallomics, 2018, 10, 1038-1052.
(195) 17 R. D. Britt, L. Tao, G. Rao, N. Chen and L. P. Wang, ACS Bio Med Chem Au, 2021, acsbiomedchemau.1c00035.
(196) 18 A. Kubas, C. Orain, D. De Sancho, L. Saujet, M. Sensi, C. Gauquelin, I. Meynial-Salles, P. Soucaille, H. Bottin, C. Baffert, V. Fourmond, R. B. Best, J. Blumberger and C. Leger, Nat. Chem., DOI: 10.1038/nchem.2592.
(197) 19 K. D. Swanson, M. W. Ratzloff, D. W. Mulder, J. H. Artz, S. Ghose, A. Hoffman, S. White, 0. A. Zadvornyy, J. B. Broderick, B. Bothner, P. W. King and J. W. Peters, J. Am. Chem. Soc., 2015, 137, 1809-1816.
(198) 20 S. T. Stripp, G. Goldet, C. Brandmayr, O. Sanganas, K. A. Vincent, M. Haumann, F. A. Armstrong and T. Happe, Proc. Natl. Acad. Sci., 2009, 106, 17331-17336.
(199) 21 T. S. Pinto, F. X. Malcata, J. D. Arrabaca, J. M. Silva, R. J. Spreitzer and M. G. Esquivel, Appl. Microbiol. Biotechnol., 2013, 97, 5635-5643.
(200) 22 A. Melis, L. Zhang, M. Forestier, M. L. Ghirardi and M. Seibert, Plant Physiol., 2000, 122, 127-136.
(201) 23 S. Kosourov, M. Jokel, E. M. Aro and Y. Allahverdiyeva, Energy Environ. Sci., 2018, 1-2.
(202) 24 0. Ben-Zvi, E. Dafni, Y. Feldman and I. Yacoby, Biotechnol. Biofuels, 2019, 12, 266.
(203) 25 H. Eilenberg, I. Weiner, O. Ben-Zvi, C. Pundak, A. Marmari, O. Liran, M. S. Wecker, Y. Milrad and I. Yacoby, Biotechnol. Biofuels, 2016, 9, 182.
(204) 26 I. Yacoby, S. Pochekailov, H. Toporik, M. L. Ghirardi, P. W. King and S. Zhang, Proc. Natl. Acad. Sci., 2011, 108, 9396-9401.
(205) 27 A. Kanygin, Y. Milrad, C. Thummala, K. Reifschneider, P. Baker, P. Marco, I. Yacoby and K. E. Redding, Energy Environ. Sci., 2020, 13, 2903-2914.
(206) 28 T. Happe and A. Kaminski, Eur. J. Biochem., 2002, 269, 1022-1032.
(207) 29 X. Su, J. Ma, X. Pan, X. Zhao, W. Chang, Z. Liu, X. Zhang and M. Li, Nat. Plants, 2019, 5, 273-281.
(208) 30 Y. Song, F. DiMaio, R. Y.-R. Wang, D. Kim, C. Miles, T. Brunette, J. Thompson and D. Baker, Structure, 2013, 21, 1735-1742.
(209) 31 L. Schrodinger, The {PyMOL} Molecular Graphics System, Version 2.4.0, 2015.
(210) 32 S. Rumpel, J. F. Siebel, M. Diallo, C. Fares, E. J. Reijerse and W. Lubitz, ChemBioChem, 2015, 16, 1663-1669.
(211) 33 J. E. Meuser, S. D'Adamo, R. E. Jinkerson, F. Mus, W. Yang, M. L. Ghirardi, M. Seibert, A. R. Grossman and M. C. Posewitz, Biochem. Biophys. Res. Commun., 2012, 417, 704-709.
(212) 34 J. Kropat, A. Hong-Hermesdorf, D. Casero, P. Ent, M. Castruita, M. Pellegrini, S. S. Merchant and D. Malasarn, Plant J., 2011, 66, 770-780.
(213) 35 R. J. Porra, W. A. Thompson and P. E. Kriedemann, Biochim. Biophys. Acta-Bioenerg., 1989, 975, 384-394.
(214) 36 N. Fischer, P. Setif and J. D. Rochaix, Biochemistry, 1997, 36, 93-102.
(215) 37 G. Gulis, K. V Narasimhulu, L. N. Fox and K. E. Redding, Photosynth. Res., 2008, 96, 51-60.
(216) 38 A. Burlacot, F. Burlacot, Y. Li-Beisson and G. Peltier, Front. Plant Sci. DOI:10.3389/fp1s.2020.01302.
(217) 39 B. Genty, J.-M. Briantais and N. R. Baker, Biochim. Biophys. Acta-Gen. Subj., 1989, 990, 87-92.
(218) 40 D. Nikolova, C. Heilmann, S. Hawat, P. Gabelein and M. Hippler, Photosynth. Res., 2018, 137, 281-293.
(219) 41 J. K. Hoobert and G. Blobel, J. Mol. Biol., 1969, 41, 121-138.
(220) 42 S. Kosourov, V. Nagy, D. Shevela, M. Jokel, J. Messinger and Y. Allahverdiyeva, Proc. Natl. Acad. Sci., 2020, 202009210.
(221) 43 S. Tirumani, K. M. Gothandam and B. J Rao, Protoplasma, 2019, 256, 117-130.
(222) 44 X. Xie, A. Huang, W. Gu, Z. Zang, G. Pan, S. Gao, L. He, B. Zhang, J. Niu, A. Lin and G. Wang, New Phytol., 2016, 209, 987-998.
(223) 45 I. Polukhina, R. Fristedt, E. Dinc, P. Cardol and R. Croce, Plant Physiol., 2016, 172, 1494-1505.
(224) 46 X. Johnson and J. Alric, J. Biol. Chem., 2012, 287, 26445-26452.
(225) 47 T. Urbig, R. Schulz and H. Senger, Zeitschrift fur Naturforsch. C, 1993, 48, 41-45.
(226) 48 W. M. Kaiser, Planta, 1979, 145, 377-382.
(227) 49 S. Yadav and N. Atri, in Reactive Oxygen Species in Plants, John Wiley & Sons, Ltd, Chichester, UK, 2017, pp. 157-163.
(228) 50 D. J. Cashman, T. Zhu, R. F. Simmerman, C. Scott, B. D. Bruce and J. Baudry, J. Mol. Recognit., 2014, 27, 597-608.
(229) 1 M. Forestier, P. King, L. Zhang, M. Posewitz, S. Schwarzer, T. Happe, M. L.
(230) Ghirardi and M. Seibert, Eur. J. Biochem., 2003, 270, 2750-2758.