MULTIPLY LABELLED PROTEIN FOR DETECTION ASSAYS

20240272155 ยท 2024-08-15

    Inventors

    Cpc classification

    International classification

    Abstract

    The present invention relates to methods, kits and devices for detecting a quantity of as biological target molecule. The invention is particularly relevant to techniques carried out on a flow based assay device. Each biological target molecule is labelled with a plurality of detectable nanoparticles, and may be detected on the device using an optical read-out.

    Claims

    1. A labelled protein construct comprising a region that is specific for a target and a plurality of affinity binding sites that are specific to detectable nanoparticles, the construct having at least two separate affinity binding sites independently linked to separate detectable nanoparticles.

    2. The labelled protein construct according to claim 1 wherein the plurality of affinity binding sites are selected from the group consisting of His, FLAG, E-tag HA, Strept-tag, myc, S-tag, SH3, and G4T.

    3. The labelled construct according to claim 1, wherein the plurality of detectable nanoparticles are antibody coated and said antibodies are linked to the affinity binding sites such that each protein molecule is linked to a plurality of detectable nanoparticles.

    4. The labelled construct according to claim 1 comprising a region that is specific for a target and a plurality of affinity binding sites that are specific to particular markers, the markers having further affinity binding sites which may be the same or different, the construct having at least two separate affinity binding sites independently linked to separate detectable nanoparticles in a branched configuration.

    5. The labelled construct according to claim 1, wherein there are greater than 50 detectable nanoparticles.

    6. The labelled construct according to claim 1, wherein there are between 100 and 10000 detectable nanoparticles.

    7. The labelled construct according to claim 6, wherein there are between 500 and 5000 detectable nanoparticles.

    8. The labelled construct according to claim 1, wherein the detectable nanoparticles are gold nanoparticles.

    9. The labelled construct according to claim 1, wherein the detectable nanoparticles are carbon nanoparticles.

    10. The labelled construct according to claim 1, wherein the detectable nanoparticles are silver nucleated gold nanoparticles.

    11. The labelled construct according to claim 1, wherein the detectable nanoparticles are platinum nanoparticles.

    12. The labelled construct according to claim 1, wherein the detectable nanoparticles are cellulose nanobeads.

    13. The labelled construct according to claim 1, wherein the particles are between 5 and 20 nm in size.

    14. The labelled construct according to claim 1, wherein the target is selected from the group consisting of a eukaryotic source, a microorganism, a virus, and a microbiome.

    15. The labelled construct according to claim 14, wherein the target is a protein.

    16. The labelled construct according to claim 14, wherein the target is a nucleic acid.

    17. A lateral flow device for detecting the presence of a target in a sample, comprising: (a) a sample loading area; (b) an area comprising a labelled protein construct comprising a region that is specific for a target in the sample and a plurality of regions that are specific to detectable nanoparticles, the construct having at least two separate affinity binding sites independently linked to separate detectable nanoparticles, wherein the construct is capable of wicking across at least a portion of the lateral flow device; (c) an area comprising capture probes for the specific target, wherein said capture probes are immobilized on the lateral flow device; and (d) absorbent material, wherein the absorbent material wicks an aqueous sample across the lateral flow device when the aqueous sample is added to the sample loading area.

    18. The device of claim 17, wherein the lateral flow device comprises a solid support selected from the group consisting of glass, paper, nitrocellulose and thread.

    19. The device of claim 17, wherein the target is selected from the group consisting of a eukaryotic source, a microorganism, a virus, and a microbiome.

    20. The device of claim 19, wherein the eukaryotic source is selected from the group consisting of algae, protozoa, fungi, slime molds and mammalian cells.

    21. A method for detecting the presence of a target in a biological sample from a subject, comprising: i) adding the sample to a sample loading area of a lateral flow device, wherein said device comprises: (a) a sample loading area; (b) an area comprising a labelled protein construct comprising a region that is specific for a target in the sample and a plurality of regions that are specific to detectable nanoparticles, the construct having at least two separate affinity binding sites independently linked to separate detectable nanoparticles, wherein the construct is capable of wicking across at least a portion of the lateral flow device; (c) an area comprising capture probes for the specific target, wherein said capture probes are immobilized on the lateral flow device; and (d) absorbent material, wherein the absorbent material wicks an aqueous sample across the lateral flow device when the aqueous sample is added to the sample loading area; and ii) determining from the presence of detectably labelled probe in (c) the presence of the target in the sample.

    22. The method according to claim 21, wherein the biological sample from the subject is selected from the group consisting of stool, peripheral blood, sera, plasma, ascites, urine, cerebrospinal fluid (CSF), sputum, saliva, bone marrow, synovial fluid, aqueous humor, amniotic fluid, cerumen, breast milk, broncheoalveolar lavage fluid, semen, prostatic fluid, cowper's fluid or pre-ejaculatory fluid, female ejaculate, sweat, fecal matter, hair, tears, cyst fluid, pleural and peritoneal fluid, pericardial fluid, lymph, chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit, vaginal secretions, mammary secretions, mucosal secretion, stool water, pancreatic juice, lavage fluids from sinus cavities, bronchopulmonary aspirates, blastocyl cavity fluid, and umbilical cord blood.

    23. A device for detecting the presence of a target analyte in a fluid, the device comprising: i) a displacement area having a first immobilised marker, for example having a protease or other enzyme, which can be displaced by the presence of the target analyte to produce a first released marker, wherein the displacement occurs without breaking covalent bonds, for example by denaturing a nucleic acid duplex; ii) one or more signal amplification areas having further immobilised markers which can be released by the presence of the first released (enzymatic) marker to produce a detectable marker, wherein the detectable marker is a labelled protein construct comprising a region that is specific for a target in the sample and a plurality of regions that are specific to detectable nanoparticles, the construct having at least two separate affinity binding sites independently linked to separate detectable nanoparticles; and iii) one or more detection areas which can identify the presence of the detectable marker; wherein the displacement area, signal amplification area(s) and detection area(s) are connected such that fluid can flow from the displacement area through the signal amplification area(s) and into the detection area(s).

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0051] FIG. 1 shows an exemplary polymeric conjugate or construct as described herein. A single target binding moiety (T) is labelled with multiple receptors (X). The multiple receptors are available to bind to a moiety (X) each having further receptors (Y). Receptors Y can bind to Y, each Y being attached to further multiple receptors Z. Each Z can bind to a colloidal gold particle. Thus each target binding to a single (T) accumulates many colloidal gold particles. Whilst each colloidal gold particle may bind to many copies of Z per particle, each T will also bind to many colloidal particles. When molecule T, molecule X, molecule Y and molecule Z are constructed in sequential order, the signal is amplified when compared to a singly labelled T (e.g. up to hundreds of times in this case).

    [0052] FIG. 2 shows a similar arrangement to FIG. 1. A single target binding moiety (T) is labelled with multiple receptors (shown as biotin for the sake of demonstration only). Each of the many receptors can be further labelled with molecules having many more receptors. The introduction of an anti-biotin or other receptor labelled colloidal gold particle produces a polymer with many gold particles per target binding moiety (T).

    [0053] FIG. 3 shows an example of multi tagged molecules using homo oligomeric molecules: Molecule A is a homo heptamer (e.g. co-chaperonin GP31 from bacteriophage T4) covalently fused to molecule X, having a tail formed by Y tags positioned in tandem. As previous example in FIG. 1, oligomers increase the branching of molecules. In this case each homo heptamer molecule has 49 y tags, offering a 49 times amplification.

    [0054] FIG. 4 shows an example of chemically tagged molecules using a branched molecule: Molecule X is covalently linked to a chemical polymer (e.g. poly-ethyleneimine, carboxymethylcellulose), this polymer can be further linked to other molecules (B), where B is a receptor tag.

    [0055] FIG. 5 shows an example of signal amplification using polymeric molecules: a modified oligonucleotide sequence is labelled with a peptide formed by x tags positioned in tandem using for example a covalent reaction. A further modified oligonucleotide is labelled with a peptide formed by y tags positioned in tandem using for example a covalent reaction. The complex formed by the hybridization of a target sequence in the presence of the two labelled oligonucleotides can be detected on a lateral flow device that contain Y molecules as test line. The interaction between the oligo complex can be detected using polymeric molecules containing binding moieties (X) and multiple nanoparticles to amplify the signal.

    [0056] FIG. 6 shows an example of a strip assay or lateral flow device of the invention, where S represents a sample loading area, A.sup.1, A.sup.2 and A.sup.3 represent areas comprising a labelled protein construct, each B represents a buffer loading region and the test line comprises capture probes for a specific target.

    DETAILED DESCRIPTION OF THE INVENTION

    [0057] The technology described herein relates to a polymeric molecular construct comprising a plurality of detectable nanoparticles. The technology described herein also relates to a labelled protein construct comprising a region that is specific for a target and a plurality of regions that are specific to detectable nanoparticles. Each construct has a region that is specific for a target. Each construct has a plurality of detectable nanoparticles. The plurality of nanoparticles can be attached via ligand binding, where suitable ligands act as affinity binding sites. Thus each polymeric molecular construct or labelled protein construct has multiple affinity binding sites within the protein sequence. Each of the multiple affinity binding sites can act independently. Therefore multiple affinity binding sites will act to bind to multiple separate detectable nanoparticles. At least two of the affinity binding sites will be independently linked to a separate detectable nanoparticle, thereby giving a polymeric molecule having at least two detectable nanoparticles on the same polymeric molecule. The at least two affinity binding sites may be independently linked to separate detectable nanoparticles.

    [0058] The use of such constructs means that each individual target molecule will be labelled with multiple nanoparticles, thereby increasing the sensitivity of the detection.

    [0059] The term comprising is used to indicate that the polymeric molecular construct or labelled protein construct is an assembly of multiple molecular species, and is not necessarily a single covalently linked molecule. Depending on the level of signal amplification, the construct can optionally be a single chain linked to multiple particles, or can be a single chain linked to further chains, where each further chain carries the particles (as shown in the figures), thereby obtaining a level of branching which can optionally be repeated using suitable affinity binding regions. Thus the labelled nanoparticles may be bound directly to the peptides, or may be attached via other branched linking groups, for example other peptides.

    [0060] For example, FIG. 1 shows an exemplary polymeric conjugate or construct as described herein. A single target binding moiety (T) is labelled with multiple receptors (X) (the affinity binding sites). The multiple affinity binding sites are available to bind to a moiety (X) each having further receptors (Y). Receptors Y can bind to Y, each Y being attached to further multiple receptors Z. Each Z can bind to a colloidal gold particle. Thus each target binding to a single (T) accumulates many colloidal gold particles via a plurality of binding events. Whilst each colloidal gold particle may bind to many copies of Z per particle, each T will also bind to many colloidal particles. When molecule T, molecule X, molecule Y and molecule Z are constructed in sequential order, the signal is amplified when compared to a singly labelled T (e.g. up to hundreds or thousands of times).

    [0061] The detectable nanoparticles may be for example antibody coated. The polymeric molecule or labelled protein may contain a plurality of antigens such that each polymeric molecule or labelled protein can bind to more than one nanoparticles (i.e. the affinity sites can be antigens specific to particularly coated nanoparticles). The antigens can be for example peptide regions which can appear repeatedly in particular polymers or proteins. Thus for example the polymers or proteins can be repeating strings of particular amino acids where the amino acids act as antigens (receptors) to antibodies coated on the nanoparticles.

    [0062] In one embodiment, the polymeric molecular construct comprises: [0063] (a) a region specific for a target from a sample; [0064] (b) multiple affinity binding sites; and [0065] (c) a plurality of detectable nanoparticles, wherein said detectable nanoparticles are antibody coated and said antibodies are linked to the affinity binding sites of the polymeric molecule such that each polymeric molecule is linked to a plurality of detectable nanoparticles in a linear configuration.

    [0066] In one embodiment, the labelled protein construct comprises: [0067] (a) a region specific for a target from a sample; [0068] (b) multiple affinity binding sites; and [0069] (c) a plurality of detectable nanoparticles, wherein said detectable nanoparticles are antibody coated and said antibodies are linked to the affinity binding sites such that each protein molecule is linked to a plurality of detectable nanoparticles.

    [0070] In one embodiment, the polymeric molecular construct comprises: [0071] (a) a region specific for a target from a sample; [0072] (b) multiple first affinity binding sites for a binding species having further affinity binding sites which may be the same or different; [0073] (c) more than one binding species attached to the first affinity sites; and [0074] (d) a plurality of detectable nanoparticles, wherein said detectable nanoparticles are antibody coated and said antibodies are linked to the further affinity binding sites of the binding species such that each of the multiple binding species is linked to a plurality of detectable nanoparticles, and each construct is in a branched configuration.

    [0075] In one embodiment, the labelled protein construct comprises: [0076] (a) a region specific for a target from a sample; [0077] (b) multiple first affinity binding sites for a binding species having further affinity binding sites which may be the same or different; [0078] (c) more than one binding species attached to the first affinity sites; and [0079] (d) a plurality of detectable nanoparticles, wherein said detectable nanoparticles are antibody coated and said antibodies are linked to the further affinity binding sites of the binding species such that each of the multiple binding species is linked to a plurality of detectable nanoparticles, and each construct is in a branched configuration.

    [0080] In one embodiment, the polymeric molecular construct or labelled protein construct has between 100 and 10,000 detectable nanoparticles.

    [0081] In one embodiment, the polymeric molecular construct or labelled protein construct has between 500 and 5000 detectable nanoparticles.

    [0082] In one embodiment, the polymeric molecular construct or labelled protein construct has greater than 20 detectable nanoparticles.

    [0083] In one embodiment, the polymeric molecular construct or labelled protein construct has greater than 50 detectable nanoparticles.

    [0084] In one embodiment, the polymeric molecular construct or labelled protein construct comprises a plurality of detectable nanoparticles selected from: gold, iron, copper, silver, silver nucleated gold, platinum, carbon, cellulose beads.

    [0085] In one embodiment, the polymeric molecular construct or labelled protein construct comprises a plurality of detectable gold nanoparticles.

    [0086] In one embodiment, the polymeric molecular construct or labelled protein construct comprises a plurality of detectable carbon nanoparticles.

    [0087] In one embodiment, the polymeric molecular construct or labelled protein construct comprises a plurality of detectable silver nucleated gold nanoparticles.

    [0088] In one embodiment, the polymeric molecular construct or labelled protein construct comprises a plurality of detectable platinum nanoparticles.

    [0089] In one embodiment, the polymeric molecular construct or labelled protein construct comprises a plurality of detectable cellulose nanobeads.

    [0090] The nanoparticles are typically sub-micrometer in size. Typical colloidal nanoparticles can be 5-100 nanometers in size. The size and shape of the particles is unimportant, but the particles are often spherical, but can be cylindrical or any other shape. A larger increase in signal can be obtained from smaller nanoparticles. The size of the particles may be between 5 and 20 nm. The size of the particles may be 5, 10, 15 or 20 nm.

    [0091] The term affinity binding site refers to a region of amino acid/peptide sequence. The affinity binding site can be a region of amino acid/peptide sequences specific to a particular antibody. The affinity binding site can be one or more of Glu-Glu-tag, HA-tag, Myc-tag, GCN4-tag, Anti-SH3 protein, ubiquitin. In the polymeric molecular constructs or labelled protein constructs described herein the plurality of regions can be selected from His, FLAG, E-tag HA, Strept-tag, myc, S-tag, SH3, G4T.

    [0092] A list of examplary peptide affinity binding sites is below:

    TABLE-US-00001 Alfa-tag (SEQIDNO:10) (SRLEEELRRRLTE) Avi-tag (SEQIDNO:11) (GLNDIFEAQKIEWHE) C-tag (SEQIDNO:12) (EPEA) Calmodulin-tag (SEQIDNO:13) (KRRWKKNFIAVSAANRFKKISSSGAL) Dogtag (SEQIDNO:14) (DIPATYEFTDGKHYITNEPIPPK) E-tag (SEQIDNO:3) (GAPVPYPDPLEPR) FLAG (SEQIDNO:2) (DYKDDDDK) G4T (SEQIDNO:9) (EELLSKNYHLENEVARLKK) HA (SEQIDNO:4) (YPYDVPDYA) His (SEQIDNO:1) (HHHHHH) Isopeptag (SEQIDNO:15) (TDKDMTITFTNKKDAE) Myc (SEQIDNO:6) (EQKLISEEDL) NE-Tag (SEQIDNO:16) (TKENPRSNQEESYDDNES) PolyGlutamate-tag (SEQIDNO:17) (EEEEEEE) PolyArginine-tag (SEQIDNO:18) (RRRRRRR) Rho1D4-tag (SEQIDNO:19) (TETSQVAPA) SBP-tag (SEQIDNO:20) (MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP) Sdytag (SEQIDNO:21) (DPIVMIDNDKPIT) SH3 (SEQIDNO:8) (STVPVAPPRRRRG) Snooptag (SEQIDNO:22) (KLGDIEFIKVNK) Softag1 (SEQIDNO:23) (SLAELLNAGLGGS) Softag3 (SEQIDNO:24) (TQDPSRVG) Spot-tag (SEQIDNO:25) (PDRVRAVSHWSS) Spytag (SEQIDNO:26) (AHIVMVDAYKPTK) S-tag (SEQIDNO:7) (KETAAAKFERQHMDS) Strep-tag (SEQIDNO:5) (WSHPQFEK) T7tag (SEQIDNO:27) (MASMTGGQQMG) TC-tag (SEQIDNO:28) (EVHTNQDPLD) Ty-tag (SEQIDNO:29) (CCPGCC) VSV-tag (SEQIDNO:30) (YTDIEMNRLGK) Xpress-tag (SEQIDNO:31) (DLYDDDDK)

    [0093] The binding species can be an antibody. The binding species can be any species corresponding to the above-mentioned binding sites. The binding species can be Anti-Glu-Glu-tag, Anti-HA antibody, Anti-Flag antibody, Anti-Myc antibody, anti-GCN4 antibody, Anti-SH3 protein, ubiquitin binding proteins.

    [0094] The target can be any molecule for which the detection is desired. The target can be a nucleic acid, for example DNA, RNA or modified forms thereof. The target can be a particular protein. The target may be a drug or a drug metabolite.

    [0095] The target may be derived directly from an organism, for example a virus, bacteria or other pathogen. The target may be from a eukaryotic source, a microorganism, a virus, or a microbiome. The source may be mammalian. The target may be a particular sequence of nucleic acid, DNA, RNA or protein. The target nucleic acid may be single stranded or double stranded.

    [0096] In one embodiment, the eukaryotic source is selected from algae, protozoa, fungi, slime molds and/or mammalian cells. In one embodiment, the microorganism or virus is selected from Escherichia, Campylobacter, Clostridium difficile, Enterotoxigenic E. coli (ETEC), Enteroaggregative Escherichia coli (EAggEC), Shiga-like Toxin producing E. coli, Salmonella, Shigella, Vibrio cholera, Yersinia enterocolitica, Adenovirus, Norovirus, Rotavirus A, Cryptosporidium parvum, Entamoeba histolytica, Giardia lamblia, Clostridia, Methicillin-resistant Staphylococcus aureus MRSA, Klebsiella pneumonia, flu, Zika, dengue, chikungunya, West Nile virus, Japanese encephalitis, malaria, HIV, H1N1, and Clostridium difficile resistant organisms.

    [0097] In one embodiment, the sample is a biological sample from a subject. The biological sample from the subject can be selected from stool, peripheral blood, sera, plasma, ascites, urine, cerebrospinal fluid (CSF), sputum, saliva, bone marrow, synovial fluid, aqueous humor, amniotic fluid, cerumen, breast milk, broncheoalveolar lavage fluid, semen, prostatic fluid, cowper's fluid or pre-ejaculatory fluid, female ejaculate, sweat, fecal matter, hair, tears, cyst fluid, pleural and peritoneal fluid, pericardial fluid, lymph, chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit, vaginal secretions, mammary secretions, mucosal secretion, stool water, pancreatic juice, lavage fluids from sinus cavities, bronchopulmonary aspirates, blastocyl cavity fluid, and umbilical cord blood.

    [0098] The technology described herein also relates to a lateral flow device for detecting the presence of a target, the device comprising: [0099] (a) a sample loading area; [0100] (b) an area comprising a polymeric molecular construct, wherein said polymeric molecular construct is bound to at least two detectable nanoparticles and has an affinity binding site specific to a target molecule in the sample, wherein the polymeric molecular construct is capable of wicking across at least a portion of the lateral flow device; [0101] (c) an area comprising capture probes for the specific target and capture probes for the polymeric molecular construct, wherein said capture probes are immobilized on the lateral flow device; and [0102] (d) absorbent material, wherein the absorbent material wicks an aqueous sample across the lateral flow device when the aqueous sample is added to the sample loading area.

    [0103] The technology described herein also relates to a lateral flow device for detecting the presence of a target in a sample, comprising: [0104] (a) a sample loading area; [0105] (b) an area comprising a labelled protein construct comprising a region that is specific for a target in the sample and a plurality of regions that are specific to detectable nanoparticles, the construct having at least two separate affinity binding sites independently linked to separate detectable nanoparticles, wherein the construct is capable of wicking across at least a portion of the lateral flow device; [0106] (c) an area comprising capture probes for the specific target, wherein said capture probes are immobilized on the lateral flow device; and [0107] (d) absorbent material, wherein the absorbent material wicks an aqueous sample across the lateral flow device when the aqueous sample is added to the sample loading area.

    [0108] In one embodiment, the lateral flow device comprises a solid support. The solid support can be selected from glass, paper, nitrocellulose and thread. The lateral flow assay test strip may consist of the following components:

    [0109] An adsorbent pad onto which the test sample is applied. This acts as a sponge and holds an excess of sample fluid.

    [0110] A conjugate or reagent pad. Once the sample pad is saturated the fluid migrates to a porous conjugate pad which contains regions specific to the target analyte conjugated to the multiply particle labelled polymeric molecular constructs. When the sample fluid dissipates the matrix, it also dissolves the polymeric molecular constructs and in one combined, conveying action, the sample and conjugate mix flow through the porous structure. In this way, the analyte binds to the particles while migrating further along the test strip.

    [0111] A reaction membrane. This is typically a membrane onto which anti-target analytes are immobilised in a stripe that crosses the membrane to act as a capture zone or test line (a control zone can also be present, containing analytes specific for the multiply labelled polymer).

    [0112] The reaction membrane has one or more areas (stripes) where a third molecule has been immobilized. By the time the sample-conjugate mix reaches these stripes, the analyte has been bound on the particles and the third capture molecule in the stripe binds the complex. After a while, when more and more fluid has passed across the stripes, particles accumulate and the stripe-area changes colour. Typically there are at least two stripes: one (the control) that captures any particle and thereby shows that reaction conditions and technology worked fine, the second contains a specific capture molecule and only captures those particles onto which an analyte molecule has been immobilized.

    [0113] A wick or waste reservoir. A further absorbent pad designed to draw the sample across the reaction membrane by capillary action. After passing the test stripes the fluid enters a final porous material, which simply acts as a waste container.

    [0114] The components of the test strip are usually fixed to an inert backing material and may be presented in a simple dipstick format or within a plastic casing with a sample port and reaction window showing the capture and control zones.

    [0115] In one embodiment, the device can take the form of a test strip where the fluid flow occurs along a single axis. The device may also be referred to as a chip, where the strip is contained within a holder in order to aid handing of the strip. All of the chemicals and reagents required for detection of the target are immobilised onto a solid support surface which is then exposed to the fluid being tested for the target.

    [0116] In one embodiment, flow assay can be a lateral flow assay, where fluid flows along a strip of porous material, or a vertical flow assay where the fluid passes through various sections under gravity or capillarity. The vertical and lateral flow can be combined.

    [0117] In one embodiment, detection can be carried out without the need for any solution reagents as everything required can be immobilised on the surface of the device. Particular applications relate to the identification of protein or nucleic acid molecules. No further enzymes or molecules other than those immobilised are required. For example the technology allows the detection of RNA without the need for reverse transcriptase or the detection of DNA without the need for polymerase based amplification. It also allows the detection of small amounts of other molecules such as lipoproteins, lipids, saccharides, metabolites, small molecules and chemicals.

    [0118] In one embodiment, the measurement may be a simple end point detection (is the target present; yes or no), or may involve an element of quantitative analysis. For quantitative analysis, the device can be coupled to a suitable reader allowing a direct measurement of the signal intensity in the detection zone. This can be correlated to the number of molecules present in the target sample. For semi-quantitative analysis, the detection zone can be calibrated to bind different amounts of colour particles (for example gold colloidal stained protein, bound to a printed antibody).

    [0119] For end point or semi-quantitative detection, the detection can be carried out using the human eye, rather than requiring any further hardware to read the result.

    [0120] In one embodiment, detection can be carried out in multiple zones or lines. For example, for semi quantitative detection different lines with different amount of trapping molecules can be printed (e.g. a first line containing 25 ng/cm, a second line containing 250 ng/cm, a third line containing 2.5 ?g/cm and so on). Therefore, considering the molecular weight of the trapping molecule, the accumulation of colour on the stripes will be a reflection of the amount of target on the sample (i.e. if sample contains 1-10 target molecules, only first line will accumulate the colour. If sample contains 10-100 target molecules, first and second lines will accumulate the colour. If sample contains 100-1,000 target molecules, first, second and third lines will accumulate the colour etc. Thus the quantification can be carried out using the different bands where the different bands have different responses depending on the amount of detectable marker in the fluid.

    [0121] The technology described herein also relates to a method for detecting the presence of a target in a biological sample from a subject, comprising: [0122] i) adding the sample to a sample loading area of a lateral flow device, wherein said device comprises: [0123] (a) a sample loading area; [0124] (b) an area comprising a polymeric molecular construct, wherein said polymeric molecular construct is bound to at least two detectable nanoparticles and has an affinity binding site specific to a target molecule in the sample, wherein the polymeric molecular construct is capable of wicking across at least a portion of the lateral flow device; [0125] (c) an area comprising capture probes for the specific target and capture probes for the polymeric molecular construct, wherein said capture probes are immobilized on the lateral flow device; and [0126] (d) absorbent material, wherein the absorbent material wicks an aqueous sample across the lateral flow device when the aqueous sample is added to the sample loading area. [0127] ii) determining from the presence of detectably labelled probe in (c) the presence of the target in the sample.

    [0128] The technology described herein also relates to a method for detecting the presence of a target in a biological sample from a subject, comprising: [0129] i) adding the sample to a sample loading area of a lateral flow device, wherein said device comprises: [0130] (a) a sample loading area; [0131] (b) an area comprising a labelled protein construct comprising a region that is specific for a target in the sample and a plurality of regions that are specific to detectable nanoparticles, the construct having at least two separate affinity binding sites independently linked to separate detectable nanoparticles, wherein the construct is capable of wicking across at least a portion of the lateral flow device; [0132] (c) an area comprising capture probes for the specific target, wherein said capture probes are immobilized on the lateral flow device; and [0133] (d) absorbent material, wherein the absorbent material wicks an aqueous sample across the lateral flow device when the aqueous sample is added to the sample loading area. [0134] ii) determining from the presence of detectably labelled probe in (c) the presence of the target in the sample.

    [0135] The technology described herein also relates to a method for detecting the presence of a target in a biological sample from a subject, comprising: [0136] i) mixing a sample with a polymeric molecular construct, wherein said polymeric molecular construct is bound to at least two detectable nanoparticles and has an affinity binding site specific to a target molecule; [0137] ii) adding the sample to a sample loading area of a lateral flow device, wherein said device comprises: [0138] (a) a sample loading area; [0139] (b) an area comprising capture probes for the specific target and capture probes for the polymeric molecular construct, wherein said capture probes are immobilized on the lateral flow device; and [0140] (c) absorbent material, wherein the absorbent material wicks an aqueous sample across the lateral flow device when the aqueous sample is added to the sample loading area. [0141] ii) determining from the presence of detectably labelled probe in (b) the presence of the target in the sample.

    [0142] The technology described herein also relates to a method for detecting the presence of a target in a biological sample from a subject, comprising: [0143] i) mixing a sample with a labelled protein construct, wherein said construct is bound to at least two detectable nanoparticles and has an affinity binding site specific to a target molecule; [0144] ii) adding the sample to a sample loading area of a lateral flow device, wherein said device comprises: [0145] (a) a sample loading area; [0146] (b) an area comprising a labelled protein construct comprising a region that is specific for a target in the sample and a plurality of regions that are specific to detectable nanoparticles, the construct having at least two separate affinity binding sites independently linked to separate detectable nanoparticles, wherein the construct is capable of wicking across at least a portion of the lateral flow device; [0147] (c) an area comprising capture probes for the specific target, wherein said capture probes are immobilized on the lateral flow device; and [0148] (d) absorbent material, wherein the absorbent material wicks an aqueous sample across the lateral flow device when the aqueous sample is added to the sample loading area. [0149] iii) determining from the presence of detectably labelled probe in (c) the presence of the target in the sample.

    [0150] In one embodiment, the present technology can be used for fast detection of the presence of many targets, for example interleukins, hormones, oncogenes (as protein or nucleic acid), pathogens (as protein or nucleic acid), virus (as protein or nucleic acid), drugs, toxins, metabolites. The target can be mycoplasma, for example for identification of cell line contamination. The target can be a coronavirus. Assays and conjugates as described herein can be used for detection of virus infection in mammalian samples.

    [0151] Fields in which the technology may be used include pathogen identification and contaminant tracing; forensic analyses; food industry; soil analyses; agriculture; aquaculture etc.

    [0152] Also disclosed is a kit of reagents for detecting a target, the kit containing a device as described above and a buffer solution into which a biological sample can be added. The kit may further include instructions for use of the kit.

    [0153] WO2016/203272 describes a flow assay where molecules are amplified during the assay. The use of the labelled constructs described herein can also be used within such an amplification assay.

    [0154] The technology described therein releases a small number of molecules, which triggers an amplification of the signal inducing a cascade or domino effect that amplifies the signal in a near-exponential manner. No reagents are required from solution, the amplification cascade is initiated simply by applying a test sample to the device. In the following description, the term displaced refers to the process of causing release from a surface without breaking chemical bonds. Displacement is a spontaneous process caused by the presence of the target analyte, rather than a chemical reaction that requires another reagent to enable the release.

    [0155] Described herein is a device for detecting the presence of a target analyte in a fluid, the device comprising: [0156] i) a displacement area having a first immobilised marker, for example having a protease or other enzyme, which can be displaced by the presence of the target analyte to produce a first released marker, wherein the displacement occurs without breaking covalent bonds, for example by denaturing a nucleic acid duplex; [0157] ii) one or more signal amplification areas having further immobilised markers which can be released by the presence of the first released (enzymatic) marker to produce a detectable marker, wherein the detectable marker is a polymeric molecular construct comprising a region that is specific for a target and a plurality of detectable nanoparticles, the polymeric molecular construct having multiple affinity binding sites wherein at least two of the affinity binding sites are each independently linked to a detectable nanoparticle; and [0158] iii) one or more detection areas which can identify the presence of the detectable marker; [0159] wherein the displacement area, signal amplification area(s) and detection area(s) are connected such that fluid can flow from the displacement area through the signal amplification area(s) and into the detection area(s).

    [0160] Described herein is a device for detecting the presence of a target analyte in a fluid, the device comprising: [0161] i) a displacement area having a first immobilised marker, for example having a protease or other enzyme, which can be displaced by the presence of the target analyte to produce a first released marker, wherein the displacement occurs without breaking covalent bonds, for example by denaturing a nucleic acid duplex; [0162] ii) one or more signal amplification areas having further immobilised markers which can be released by the presence of the first released (enzymatic) marker to produce a detectable marker, wherein the detectable marker is a labelled protein construct comprising a region that is specific for a target in the sample and a plurality of regions that are specific to detectable nanoparticles, the construct having at least two separate affinity binding sites independently linked to separate detectable nanoparticles; and [0163] iii) one or more detection areas which can identify the presence of the detectable marker; [0164] wherein the displacement area, signal amplification area(s) and detection area(s) are connected such that fluid can flow from the displacement area through the signal amplification area(s) and into the detection area(s).

    [0165] The presence of one target molecule in the displacement area produces the release of one molecule that will travel with the flow of the sample. When the released molecule (or first released marker) gets into contact with the next section, the signal amplification area, it will trigger the release of more molecules, for example 80-200 molecules each having detectable markers, that will also travel with the fluid flow and will allow the release of more molecules, for example 80-200 molecules per each molecule released on the previous step. This will produce the same reaction in the following step and so on, giving a near-logarithmic amplification in the amount of detectable marker molecules. The amplification modules can be used multiple times in series allowing high sensitivity. The cascade can be achieved by chemical cleavage of molecules, by the use of proteases or enzymatically active molecules.

    [0166] Once the sample has reached the detection area, there will be enough released molecules that an enzymatic reaction or accumulation of colour reaction product can be used to detect the signal, even if the amount of target analyte applied in the fluid sample was very low.

    [0167] In order to detect a single applied molecule, amplification to the marker molecules can allow for, for example, at least 106 or more copies of the detectable marker. Such an amount is readily detectable. The number of detectable markers may be for example 10.sup.8 or higher. The number of detectable markers may be for example 10.sup.9 or higher. The number of detectable marker can be adjusted by the size and number of the amplification zones. Larger amplification zones mean that the sample takes longer to flow through the zone, thereby giving more time to catalyse release of the detectable markers.

    [0168] In contrast to the displacement, where no covalent bonds are broken, the amplification cascade can be carried out by cleaving material from the surface via chemical bond cleavage. The chemical covalent bond cleavage can be carried out using enzymes or other catalysts, the presence of which is only occasioned should they be displaced from the displacement area. Thus the amplification cascade can be a catalysed reaction, whereas the displacement using the target analyte is a non catalysed reaction.

    [0169] The present description of this technology uses as an exemplar specific peptidases on the cascade to amplify the signal. However to achieve the same result, other enzymatically active molecules can be used such as nucleases, lipases, disaccharidases, polysaccharides, kinases, phosphorylases, methylases, sumorilases, ubiquitin deacetylases.

    EXAMPLES

    [0170] Examples of compounds having many labels are shown below:

    Example 1

    Expression of Recombinant Molecules Fused to Tags Positioned in Tandem.

    [0171] Fab anti-GCN4 antibody sequence was cloned in frame with 7xMyc tag (7xGSKSGEQKLISEEDL) (SEQ ID NO:32) and a 6xHis tag for purification (FIG. 1). Fab anti-Myc antibody sequence was cloned in frame with 10xSH3 tag (10xSTVPVAPPRRRRG) (SEQ ID NO:8) and a 6xHis tag for purification (FIG. 1). Anti-SH3 protein sequence was cloned in frame with 6xHis tag for purification (FIG. 1). Recombinant proteins were expressed using New England Biolab Shuffle cells and purified using NTA-agarose and further purified using AKTA gel filtration P-200.

    [0172] Poly tag proteins (e.g. KK-6xHis-7xFlag, KK-6xhis-7xG4tag and KK-6xHis7xHA) were cloned in to T7 expression vector. Recombinant proteins were expressed using Thermo Scientific BL21(DE3) cells and purified using NTA-agarose and further purified using AKTA gel filtration P-200.

    Expression of Recombinant Self Homo Oligomeric Molecules.

    [0173] Anti-GFP nanobody sequence was cloned in frame homo heptamer co-chaperonin GP31 protein from bacteriophage T4 (FIG. 3) and 7xGCN4tag (7xGSKSGEELLSKNYHLENEVARLKK) (SEQ ID NO:34), including a 6xHis tag for purification. Homo oligomer molecules have also been made fusing tetramer molecules such as avidin and streptavidin.

    Covalent Binding of Molecules to Branched Molecule.

    [0174] Single amino group of branched molecule PEI (Poly-ethyleneimine, Sigma 408700) were transformed into maleimide groups by reacting with crosslinker SMCC (Succinimidyl trans-4-(N-maleimidylmethyl) cyclohexane-1-carboxylate) using 1:1.5 molar ratio. Thiolation of Anti-MYC antibody was performed using SPDP (Succinimidyl 3-(2-pyridyldithio) propionate). Thiol modified Anti-MYC antibody was reduced using TCEP before were added drop by drop to single-maleimide derived PEI. The result of this reaction was a fusion between Anti-Myc antibody to PEI, this was subsequently purified using AKTA gel filtration P-200. The remaining amino groups of Anti-Myc-PEI were subsequently transformed into maleimide groups by reacting with crosslinker SMCC using 1:200 molar ratio. Thiolation of SH3 peptide (MGSGSTVPVAPPRRRRG) (SEQ ID NO:33) was performed using SPDP, alternatively Cysteine SH3 peptides (MCGSGSTVPVAPPRRRRG) (SEQ ID NO:35) was used with less efficiency. Thiol modified SH3 peptide or Cysteine SH3 peptides were reduced using TCEP before they were added drop by drop to maleimide derived Anti-Myc-PEI. The result of this reaction is Anti-Myc that carries 15-25 SH3 tags.

    Increasing Sensitivity of Oligo Chromatography FIG. 5:

    [0175] Poly tag proteins (e.g. KK-6Xhis-7xFLAG, KK-6xhis-7xG4tag and KK-6xHis7xHA) were transformed into maleimide groups by reacting with crosslinker SMCC (Succinimidyl trans-4-(N-maleimidylmethyl) cyclohexane-1-carboxylate). Thiol modified oligos (ATCTGTCTATTTCGTTCATC-3Thiol (SEQ ID NO:36), 5Thiol-CCAATGCTTAATCAGTGAG (SEQ ID NO:37), CAGTTCTTCACCT TTGCCAAC-3Thiol (SEQ ID NO:38 and 5Thiol-CACCAGAATCAGTGCACAAC (SEQ ID NO:39)) were reduced using DTT before were added drop by drop to maleimide derived tag protein. These reactions produce ATCTGTCTATTTCGTTCATC-7xG4Tag (SEQ ID NO:36), 7xHA-CCAATGCTTAATCAGTGAG (SEQ ID NO:37), CAGTTCTTCACCTTTGCCAAC-7xG4Tag (SEQ ID NO:38) and 7xFLAG-CACCAGAATCAGTGCACAAC (SEQ ID NO:39) linked oligos (as described on FIG. 5). Similar results can be achieved by the thiolation of amino modified oligos using SPDP (Succinimidyl 3-(2-pyridyldithio) propionate).

    [0176] Labelled oligos were hybridized to target sequence 5 TGGATGAACGAAATAGACA GATCGCTGAGATAGGTGCCTCACTGATTAAGCATTGGTAAGGT (SEQ ID NO:40) and 5 GTTGGCAAAGGTGA AGAACTGTTTACCGGCGTTGTGCACTGATTCTGGTG (SEQ ID NO:41) before loading the mix on to a lateral flow device that has been previously printed with 12CA5 anti-HA antibody and Anti-FlagM2 antibody. Hybridized oligos were detected using a mix of anti-GCN4-7xMyc, Anti-Myc-10xSH3 and Anti-SH3 Colloidal Gold. Alternatively Anti-Myc-PEI-20xSH3 was used replacing Anti-Myc-10xSH3.

    Preparation of Colloidal Gold Protein Conjugates.

    [0177] Colloidal gold solution was prepared following method from Turkevich et al (Discuss. Faraday Soc., 1951, 11, 55-75) and G. Frens (Phys. Sci., 1973, 241, 20-22). 200 ml of 0.01% HAuCl4 in Milli-Q water was stirred vigorously and heated till boiling under reflux conditions. Depending on designated particle size sodium citrate (1% aqueous solution) was added very quickly while the solution was stirred and boiled vigorously. After about 1 minute the light yellow solution loses colour completely before changing colour to deep blue and finally dark red. To make sure the reaction had finished completely, the solution was allowed to boil for another 10 min. After cooling to room temperature pH was adjusted with 1 ml of 0.2 M K.sub.2CO.sub.3 solution. The desired conjugate protein, such as Anti-SH3 protein, was diluted in 10 ml of PBS, and added in small volumes to 200 ml colloidal gold with continuous stirring. After mixing the conjugation reaction was left for 30 minutes at room temperature. The appropriate amount of conjugate protein, such as Anti-SH3 protein, was empirically calculated by performing a series dilution and measuring the protection of colloidal gold to 10% Sodium Chloride. After conjugation Anti-SH3 Colloidal gold solution was precipitated at 8000 g for 30 min and resuspended in 20 ml of PBS 0.002% Tween-20.

    Lateral Flow Test for Detection of Ampicillin Resistance.

    [0178] Lateral flow device was printed with two lines on the nitrocellulose membrane (Test Line using 1 ?g/cm of 12CA5 anti-HA antibody and Positive control using 0.5 ?g/cm of Anti-Flag M2 antibody) (FIG. 6). Three solutions containing 2% sucrose, 1%BSA, 0.5% and either Anti-GCN4-7X Myc, Anti-Myc-10XSH3 or Anti-SH3 Colloidal Gold were prepared, the solutions were printed on the cellulose sample pad on position A.sup.1, A.sup.2 and A.sup.3 respectively (FIG. 6), lateral flow strips where dried for 2 hours at 37? C.

    [0179] 20 ?L of bacteria was mixed with 20 ?L lysis buffer (200 mM KOH and Oligo mix containing 0.2 ?M of ATCTGTCTATTTCGTTCATC-7xG4Tag (SEQ ID NO:36), 7xHA-CCAATGCTTA ATCAGTGAG (SEQ ID NO:37), -7xG4Tag, 7xFLAG-CACCAGAATCAGTGCACA AC (SEQ ID NO:38) and 0.01 ?M of Positive Control Oligo GTTGGCAAAGGTGAAGAACTGTTTACCGG CGTTGTGCACTGATTCTGGTG) (SEQ ID NO:40), after mix 20 ?l of neutralization buffer (30 mM Tris Ph8, 0.5% Tween, complemented with 200 mM HCL). 20 ?L of sample mix was loaded on the lateral flow strip (position S FIG. 6), subsequently 40 ?L of running buffer (PBS with 0.5% Tween-20) were added in each position B. The present of Ampicillin resistance gene is detected by the accumulation of colloidal Gold at the test line.