T cell receptors

12060404 ยท 2024-08-13

Assignee

Inventors

Cpc classification

International classification

Abstract

The present invention relates to T cell receptors (TCRs) which bind the HLA-A*0201 restricted peptide GVYDGEEHSV (SEQ ID NO: 1) derived from the MAGE-B2 protein. The TCRs of the invention demonstrate excellent specificity profiles for this MAGE epitope. Also provided are nucleic acids encoding the TCRs, cells engineered to present the TCRs, cells harbouring expression vectors encoding the TCRs and pharmaceutical compositions comprising the TCRs, nucleic acids or cells of the invention.

Claims

1. A T cell receptor (TCR) having binding specificity to GVYDGEEHSV (SEQ ID NO: 1) in complex with HLA-A*0201, comprising a TCR alpha chain variable domain (V?) comprising complementarity determining regions (CDR) V? CDR1, V? CDR2 and V? CDR3 and a TCR beta chain variable domain (V?) comprising V? CDR1, V? CDR2 and V? CDR3, wherein: the V? CDR1 comprises amino acid residues 28-33 of SEQ ID NO: 3; the V? CDR2 comprises amino acid residues 48-53 of SEQ ID NO: 3, or amino acid residues 48-53 of SEQ ID NO: 3 with an I3R substitution; the V? CDR3 comprises amino acid residues 91-105 of SEQ ID NO: 3; the V? CDR1 comprises amino acid residues 46-50 of SEQ ID NO: 4, or amino acid residues 46-50 of SEQ ID NO:4 with an H3R substitution; the V? CDR2 comprises amino acid residues 68-72 of SEQ ID NO: 4; and the V? CDR3 comprises amino acid residues 110-123 of SEQ ID NO: 4, or amino acid residues 110-123 of SEQ ID NO: 4 with an N10K substitution, wherein at least one of the V? CDR1 and V? CDR3 includes one of the corresponding substitutions.

2. One or more polynucleotide(s) encoding the TCR of claim 1.

3. A cell comprising the one or more polynucleotide(s) of claim 2.

4. A method for treating cancer comprising administering to a cancer patient the cell of claim 3, wherein the patient has a cancer cell that expresses a melanoma-associated antigen (MAGE) B2 protein.

5. A T cell receptor (TCR) having binding specificity to GVYDGEEHSV (SEQ ID NO: 1) in complex with HLA-A*0201, wherein the TCR comprises a TCR alpha chain variable domain (V?) comprising complementarity determining regions (CDR) V? CDR1, V? CDR2 and V? CDR3 and a TCR beta chain variable domain (V?) comprising V? CDR1, V? CDR2 and V? CDR3, wherein: the V? CDR1, V? CDR2 and V? CDR3 comprise amino acid residues 28-33, 48-53, and 91-105 of SEQ ID NO: 3 or 7, respectively, and the V? CDR1, V? CDR2 and V? CDR3 comprise amino acid residues 46-50, 68-72, and 110-123 of SEQ ID NO: 8 or 10, respectively.

6. The TCR of claim 5, wherein the V? CDR1, V? CDR2 and V? CDR3 comprise amino acid residues 28-33, 48-53, and 91-105 of SEQ ID NO: 3, respectively, and the V? CDR1, V? CDR2 and V? CDR3 comprise amino acid residues 46-50, 68-72, and 110-123 of SEQ ID NO: 8, respectively.

7. The TCR of claim 5, wherein the V? comprises the amino acid sequence of SEQ ID NO: 3 and the V? comprises the amino acid sequence of SEQ ID NO: 8.

8. The TCR of claim 5, wherein the V? CDR1, V? CDR2 and V? CDR3 comprise amino acid residues 28-33, 48-53, and 91-105 of SEQ ID NO: 3, respectively, and the V? CDR1, V? CDR2 and V? CDR3 comprise amino acid residues 46-50, 68-72, and 110-123 of SEQ ID NO: 10, respectively.

9. The TCR of claim 5, wherein the V? comprises the amino acid sequence of SEQ ID NO: 3 and the V? comprises the amino acid sequence of SEQ ID NO: 10.

10. One or more polynucleotide(s) encoding the TCR of claim 5.

11. A cell comprising the one or more polynucleotide(s) of claim 10.

12. A method for treating cancer comprising administering to a cancer patient the cell of claim 11, wherein the patient has a cancer cell that expresses a melanoma-associated antigen (MAGE) B2 protein.

Description

EXAMPLES

Example 1Cloning of the Reference MAGE-A4 TCR Alpha and Beta Chain Variable Region Sequences into pGMT7-Based Expression Plasmids

(1) The parental MAGE-A4 TCR variable alpha and TCR variable beta domains of SEQ ID NOs: 3 and 4 respectively were cloned into pGMT7-based expression plasmids containing either C? or C? by standard methods described in (Molecular Cloning a Laboratory Manual Third edition by Sambrook and Russell). Plasmids were sequenced using an Applied Biosystems 3730?1 DNA Analyzer. The reference MAGE-A4 TCR variable alpha and TCR variable beta domains of SEQ ID NOs: 3 and 4 respectively were cloned in the same way.

(2) The DNA sequence encoding the TCR alpha chain variable region was ligated into pEX956, which was cut with restriction enzymes. The DNA sequence encoding the TCR beta chain variable region was ligated into pEXb21, which was also cut with restriction enzymes.

(3) Ligated plasmids were transformed into competent E. coli strain XLI-blue cells and plated out on LB/agar plates containing 100 ?g/mL ampicillin. Following incubation overnight at 37? C., single colonies were picked and grown in 5 mL LB containing 100 ?g/mL ampicillin overnight at 37? C. with shaking. Cloned plasmids were purified using a Miniprep kit (Qiagen) and the plasmids were sequenced using an Applied Biosystems 3730?1 DNA Analyzer.

Example 2Expression, Refolding and Purification of Soluble Reference MAGE-A4 TCR

(4) The expression plasmids containing the reference TCR ?-chain and ?-chain respectively, as prepared in Example 1, were transformed separately into E. coli strain BL21pLysS, and single ampicillin-resistant colonies were grown at 37? C. in TYP (ampicillin 100 ?g/ml) medium to OD600 of ?0.6-0.8 before inducing protein expression with 0.5 mM IPTG. Cells were harvested three hours post-induction by centrifugation for 30 minutes at 4000 rpm in a Beckman J-6B. Cell pellets were lysed with 25 ml Bug Buster (NovaGen) in the presence of MgCl.sub.2 and DNaseI. Inclusion body pellets were recovered by centrifugation for 30 minutes at 13000 rpm in a Beckman J2-21 centrifuge. Three detergent washes were then carried out to remove cell debris and membrane components. Each time the inclusion body pellet was homogenised in a Triton buffer (50 mM Tris-HCl pH 8.0, 0.5% Triton-X100, 200 mM NaCl, 10 mM NaEDTA) before being pelleted by centrifugation for 15 minutes at 13000 rpm in a Beckman J2-21. Detergent and salt was then removed by a similar wash in the following buffer: 50 mM Tris-HCl PH 8.0, 1 mM NaEDTA. Finally, the inclusion bodies were divided into 30 mg aliquots and frozen at ?70? C. Inclusion body protein yield was quantified by solubilising with 6 M guanidine-HCl and an OD measurement was taken on a Hitachi U-2001 Spectrophotometer. The protein concentration was then calculated using the extinction coefficient.

(5) Approximately 15 mg of TCR ? chain and 15 mg of TCR ? chain solubilised inclusion bodies were thawed from frozen stocks and diluted into 10 ml of a guanidine solution (6 M Guanidine-hydrochloride, 50 mM Tris HCl pH 8.1, 100 mM NaCl, 10 mM EDTA, 10 mM DTT), to ensure complete chain denaturation. The guanidine solution containing fully reduced and denatured TCR chains was then injected into 0.5 litre of the following refolding buffer: 100 mM Tris pH 8.1, 400 mM L-Arginine, 2 mM EDTA, 5 M Urea. The redox couple (cysteamine hydrochloride and cystamine dihydrochloride) to final concentrations of 6.6 mM and 3.7 mM respectively, were added approximately 5 minutes before addition of the denatured TCR chains. The solution was left for ?30 minutes. The refolded TCR was dialysed in Spectrapor 1 membrane (Spectrum; Product No. 132670) against 10 L H2O for 18-20 hours. After this time, the dialysis buffer was changed twice to fresh 10 mM Tris pH 8.1 (10 L) and dialysis was continued at 5? C.?3? C. for another ?8 hours.

(6) Soluble TCR was separated from degradation products and impurities by loading the dialysed refold onto a POROS 50HQ anion exchange column and eluting bound protein with a gradient of 0-500 mM NaCl in 10 mM Tris pH 8.1 over 50 column volumes using an Akta purifier (GE Healthcare). Peak fractions were pooled and a cocktail of protease inhibitors (Calbiochem) were added. The pooled fractions were then stored at 4? C. and analysed by Coomassie-stained SDS-PAGE before being pooled and concentrated. Finally, the soluble TCR was purified and characterised using a GE Healthcare Superdex 75HR gel filtration column pre-equilibrated in PBS buffer (Sigma). The peak eluting at a relative molecular weight of approximately 50 kDa was pooled and concentrated prior to characterisation by BIAcore surface plasmon resonance analysis.

Example 3Binding Characterisation

(7) BIAcore Analysis

(8) A surface plasmon resonance biosensor (BIAcore 3000?) can be used to analyse the binding of a soluble TCR to its peptide-MHC ligand. This is facilitated by producing soluble biotinylated peptide-HLA (pHLA) complexes which can be immobilised to a streptavidin-coated binding surface (sensor chip). The sensor chips comprise four individual flow cells which enable simultaneous measurement of T-cell receptor binding to four different pHLA complexes. Manual injection of pHLA complex allows the precise level of immobilised class I molecules to be manipulated easily.

(9) Biotinylated class I HLA-A*0201 molecules were refolded in vitro from bacterially-expressed inclusion bodies containing the constituent subunit proteins and synthetic peptide, followed by purification and in vitro enzymatic biotinylation (O'Callaghan et al. (1999) Anal. Biochem. 266: 9-15). HLA-A*0201-heavy chain was expressed with a C-terminal biotinylation tag which replaces the transmembrane and cytoplasmic domains of the protein in an appropriate construct. Inclusion body expression levels of ?75 mg/litre bacterial culture were obtained. The MEW light-chain or ?2-microglobulin was also expressed as inclusion bodies in E. coli from an appropriate construct, at a level of ?500 mg/litre bacterial culture.

(10) E. coli cells were lysed and inclusion bodies are purified to approximately 80% purity. Protein from inclusion bodies was denatured in 6 M guanidine-HCl, 50 mM Tris pH 8.1, 100 mM NaCl, 10 mM DTT, 10 mM EDTA, and was refolded at a concentration of 30 mg/litre heavy chain, 30 mg/litre ?2m into 0.4 M L-Arginine, 100 mM Tris pH 8.1, 3.7 mM cystamine dihydrochloride, 6.6 mM cysteamine hydrochloride, 4 mg/L of the MAGE-A4 GVYDGREHTV (SEQ ID NO: 2) or MAGE-B2 GVYDGEEHSV (SEQ ID NO: 1) peptide required to be loaded by the HLA-A*02 molecule, by addition of a single pulse of denatured protein into refold buffer at <5? C. Refolding was allowed to reach completion at 4? C. for at least 1 hour.

(11) Buffer was exchanged by dialysis in 10 volumes of 10 mM Tris pH 8.1. Two changes of buffer were necessary to reduce the ionic strength of the solution sufficiently. The protein solution was then filtered through a 1.5 ?m cellulose acetate filter and loaded onto a POROS 50HQ anion exchange column (8 ml bed volume). Protein was eluted with a linear 0-500 mM NaCl gradient in 10 mM Tris pH 8.1 using an Akta purifier (GE Healthcare). HLA-A*0201-peptide complex eluted at approximately 250 mM NaCl, and peak fractions were collected, a cocktail of protease inhibitors (Calbiochem) was added and the fractions were chilled on ice.

(12) Biotin-tagged pHLA molecules were buffer exchanged into 10 mM Tris pH 8.1, 5 mM NaCl using a GE Healthcare fast desalting column equilibrated in the same buffer. Immediately upon elution, the protein-containing fractions were chilled on ice and protease inhibitor cocktail (Calbiochem) was added. Biotinylation reagents were then added: 1 mM biotin, 5 mM ATP (buffered to pH 8), 7.5 mM MgCl2, and 5 ?g/ml BirA enzyme (purified according to O'Callaghan et al. (1999) Anal. Biochem. 266: 9-15). The mixture was then allowed to incubate at room temperature overnight.

(13) The biotinylated pHLA-A*0201 molecules were purified using gel filtration chromatography. A GE Healthcare Superdex 75 HR 10/30 column was pre-equilibrated with filtered PBS and 1 ml of the biotinylation reaction mixture was loaded and the column was developed with PBS at 0.5 ml/min using an Akta purifier (GE Healthcare). Biotinylated pHLA-A*0201 molecules eluted as a single peak at approximately 15 ml. Fractions containing protein were pooled, chilled on ice, and protease inhibitor cocktail was added. Protein concentration was determined using a Coomassie-binding assay (PerBio) and aliquots of biotinylated pHLA-A*01 molecules were stored frozen at ?20? C.

(14) Such immobilised complexes are capable of binding both T-cell receptors and the coreceptor CD8??, both of which may be injected in the soluble phase. The pHLA binding properties of soluble TCRs are observed to be qualitatively and quantitatively similar if the TCR is used either in the soluble or immobilised phase. This is an important control for partial activity of soluble species and also suggests that biotinylated pHLA complexes are biologically as active as non-biotinylated complexes.

(15) The BIAcore 3000? surface plasmon resonance (SPR) biosensor measures changes in refractive index expressed in response units (RU) near a sensor surface within a small flow cell, a principle that can be used to detect receptor ligand interactions and to analyse their affinity and kinetic parameters. The BIAcore experiments were performed at a temperature of 25? C., using PBS buffer (Sigma, pH 7.1-7.5) as the running buffer and in preparing dilutions of protein samples. Streptavidin was immobilised to the flow cells by standard amine coupling methods. The pHLA complexes were immobilised via the biotin tag. The assay was then performed by passing soluble TCR over the surfaces of the different flow cells at a constant flow rate, measuring the SPR response in doing so.

(16) Equilibrium Binding Constant

(17) The above BIAcore analysis methods were used to determine equilibrium binding constants. Serial dilutions of the disulfide linked soluble heterodimeric form of the reference MAGE-A4 TCR were prepared and injected at constant flow rate of 5 ?l min-1 over two different flow cells; one coated with ? 1000 RU of specific GVYDGREHTV (SEQ ID NO: 2)-HLA-A*0201 complex, the second coated with ?1000 RU of non-specific complex. Response was normalised for each concentration using the measurement from the control cell. Normalised data response was plotted versus concentration of TCR sample and fitted to a non-linear curve fitting model in order to calculate the equilibrium binding constant, K.sub.D. (Price & Dwek, Principles and Problems in Physical Chemistry for Biochemists (2.sup.nd Edition) 1979, Clarendon Press, Oxford). The disulfide linked soluble form of the reference MAGE-A4 TCR (Example 2) demonstrated a K.sub.D of approximately 2.00 ?M. From the same BIAcore data the T? was approximately 0.95 s.

(18) Kinetic Parameters

(19) The above BIAcore analysis methods were also used to determine equilibrium binding constants and off-rates.

(20) For high affinity TCRs (see Example 4 below) K.sub.D was determined by experimentally measuring the dissociation rate constant, koff, and the association rate constant, kon. The equilibrium constant K.sub.D was calculated as koff/kon.

(21) TCR was injected over two different cells one coated with ?1000 RU of specific GVYDGREHTV (SEQ ID NO: 2)-HLA-A*0201 complex, the second coated with ? 1000 RU of non-specific complex. Flow rate was set at 50 ?l/min. Typically 250 ?l of TCR at ?1 ?M concentration was injected. Buffer was then flowed over until the response had returned to baseline or >2 hours had elapsed. Kinetic parameters were calculated using BIAevaluation software. The dissociation phase was fitted to a single exponential decay equation enabling calculation of half-life.

Example 4Preparation of High Affinity TCRs of the Invention

(22) Expression plasmids containing the TCR ?-chain and ?-chain respectively were prepared as in Example 1:

(23) TABLE-US-00004 TCR ID Alpha Chain SEQ ID NO: Beta Chain SEQ ID NO: TCR1 (parental) 3 4 TCR2 958 7 (I3R) 4 TCR3 962 3 8 (H3R) TCR4 1028 3 9 (N10R) TCR5 1030 7 (I3R) 9 (N10R) TCR6 1034 3 10 (N10K)

(24) The plasmids were transformed separately into E. coli strain BL21pLysS, and single ampicillin-resistant colonies grown at 37? C. in TYP (ampicillin 100 ?g/ml) medium to OD600 of ?0.6-0.8 before inducing protein expression with 0.5 mM IPTG. Cells were harvested three hours post-induction by centrifugation for 30 minutes at 4000 rpm in a Beckman J-6B. Cell pellets were lysed with 25 ml Bug Buster (Novagen) in the presence of MgCl2 and DNaseI. Inclusion body pellets were recovered by centrifugation for 30 minutes at 13000 rpm in a Beckman J2-21 centrifuge. Three detergent washes were then carried out to remove cell debris and membrane components. Each time the inclusion body pellet was homogenised in a Triton buffer (50 mM Tris-HCl pH 8.0, 0.5% Triton-X100, 200 mM NaCl, 10 mM NaEDTA) before being pelleted by centrifugation for 15 minutes at 13000 rpm in a Beckman J2-21. Detergent and salt was then removed by a similar wash in the following buffer: 50 mM Tris-HCl pH 8.0, 1 mM NaEDTA. Finally, the inclusion bodies were divided into 30 mg aliquots and frozen at ?70? C. Inclusion body protein yield was quantified by solubilising with 6 M guanidine-HCl and an OD measurement was taken on a Hitachi U-2001 Spectrophotometer. The protein concentration was then calculated using the extinction coefficient.

(25) Approximately 10 mg of TCR ? chain and 10 mg of TCR ? chain solubilised inclusion bodies for each TCR of the invention were diluted into 10 ml of a guanidine solution (6 M Guanidine-hydrochloride, 50 mM Tris HCl pH 8.1, 100 mM NaCl, 10 mM EDTA, 10 mM DTT), to ensure complete chain denaturation. The guanidine solution containing fully reduced and denatured TCR chains was then injected into 0.5 litre of the following refolding buffer: 100 mM Tris pH 8.1, 400 mM L-Arginine, 2 mM EDTA, 5 M Urea. The redox couple (cysteamine hydrochloride and cystamine dihydrochloride) to final concentrations of 6.6 mM and 3.7 mM respectively, were added approximately 5 minutes before addition of the denatured TCR chains. The solution was left for ?30 minutes. The refolded TCR was dialysed in Spectrapor 1 membrane (Spectrum; Product No. 132670) against 10 L H.sub.2O for 18-20 hours. After this time, the dialysis buffer was changed twice to fresh 10 mM Tris pH 8.1 (10 L) and dialysis was continued at 5? C. 3? C. for another ?8 hours.

(26) Soluble TCR was separated from degradation products and impurities by loading the dialysed refold onto a POROS 50HQ anion exchange column and eluting bound protein with a gradient of 0-500 mM NaCl in 10 mM Tris pH 8.1 over 15 column volumes using an Akta purifier (GE Healthcare). The pooled fractions were then stored at 4? C. and analysed by Coomassie-stained SDS-PAGE before being pooled and concentrated. Finally, the soluble TCRs were purified and characterised using a GE Healthcare Superdex 75HR gel filtration column pre-equilibrated in PBS buffer (Sigma). The peak eluting at a relative molecular weight of approximately 50 kDa was pooled and concentrated prior to characterisation by BIAcore surface plasmon resonance analysis.

(27) The affinity profiles of the thus-prepared TCRs for the MAGE-A4 epitope or MAGE-B2 epitope were assessed using the method of Example 3, and compared with the reference TCR. The results are set forth in the following table:

(28) TABLE-US-00005 MAGE A4 MAGE-B2 K.sub.D (?M) K.sub.D (?M) Reference (TCR1) 65.1 17 TCR2 208.4 17.8 TCR3 195.5 16.61 TCR4 183.3 11.27 TCR5 484 18.77 TCR6 305.3 6.03

(29) Attempts were also made to prepare high affinity TCRs based on combinations of SEQ ID NOs: 11/12, 13/14, 15/16.

(30) In the case of TCR A, which combines alpha chain of SEQ ID NO: 11 and the Beta chain of SEQ ID NO: 12, cross-reactivity was noted between MAGE-A1, MAGE-A10 and PRAME. It was not possible to remove this cross-reactivity by mutation and selection.

(31) TCR B combines the alpha chain of SEQ ID NO: 12 and the Beta chain of SEQ ID NO: 14. TCR ? could not be folded to form a soluble TCR, so no binding characterisation was possible.

(32) TCR C combines the alpha chain of SEQ ID NO: 15 and the Beta chain of SEQ ID NO: 16. This TCR was soluble when expressed and could bid to antigen. However, when expressed in T-cells, TCR C showed no activity.

Example 5Transfection of T-Cells with Parental and Variant MAGE-A4 TCRs

(33) (a) Lentiviral Vector Preparation by Express-In Mediated Transient Transfection of 293T Cells

(34) A 3rd generation lentiviral packaging system was used to package lentiviral vectors containing the gene encoding the desired TCR. 293T cells were transfected with 4 plasmids (one lentiviral vector containing the TCR alpha chain-P2A-TCR beta chain single ORF gene described in Example 5c (below), and 3 plasmids containing the other components necessary to construct infective but non-replicative lentiviral particles) using Express-In mediated transfection (Open Biosystems).

(35) For transfection one T150 flask of 293T cells in exponential growth phase was taken, with cells evenly distributed on the plate, and slightly more than 50% confluent. Express-In aliquots were brought to room temperature. 3 ml Serum-Free Medium (RPMI 1640+10 mM HEPES) were placed in a sterile 15 ml conical tube. 174 ?l of Express-In Reagent were added directly into the Serum-Free Medium (this provides for a 3.6:1 weight ratio of Reagent to DNA). This was mixed thoroughly by inverting tubes 3-4 times and incubated at room temperature for 5-20 minutes.

(36) In a separate 1.5 ml microtube was added 15 ?g plasmid DNA to premixed packaging mix aliquots (containing 18 ?g pRSV.REV (Rev expression plasmid), 18 ?g pMDLg/p.RRE (Gag/Pol expression plasmid), 7 ?g pVSV-G (VSV glycoprotein expression plasmid), usually ?22 and pipetted up and down to ensure homogeneity of the DNA mix. Approx 1 mL of Express-In/Serum-Free Medium was added to the DNA mix dropwise then pipetted up and down gently before transferring back to the remainder of the Express-In/Serum-Free Medium. The tube was inverted 3-4 times and incubated at room temperature for 15-30 minutes. Old culture medium was removed from the flask of cells. Express-In/medium/DNA (3 mL) complex was added directly into the bottom of an upright flask of 293T cells. Slowly, the flask was placed flat to cover the cells and very gently rocked to ensure even distribution. After 1 minute 22 ml fresh culture medium (R10+HEPES: RPMI 1640, 10% heat-inactivated FBS, 1% Pen/Strep/L-glutamine, 10 mM HEPES) was added and the flask carefully returned to the incubator. This was incubated overnight at 37? C./5% CO.sub.2. After 24 hours, the medium containing packaged lentiviral vectors was harvested.

(37) To harvest the packaged lentiviral vectors, the cell culture supernatant was filtered through a 0.45 micron nylon syringe filter, the culture medium centrifuged at 10,000 g for 18 hours (or 112,000 g for 2 hours), most of the supernatant removed (taking care not to disturb the pellet) and the pellet resuspended in the remaining few mL of supernatant (usually about 2 ml from a 31 ml starting volume per tube). This was snap frozen on dry ice in 1 ml aliquots and stored at ?80? C.

(38) (b) Transduction of T Cells with Packaged Lentiviral Vectors Containing Gene of Interest

(39) Prior to transduction with the packaged lentiviral vectors, human T cells (CD8 or CD4 or both depending on requirements) were isolated from the blood of healthy volunteers. These cells were counted and incubated overnight in R10 containing 50 U/mL IL-2 at 1?10.sup.6 cells per ml (0.5 mL/well) in 48 well plates with pre-washed anti-CD3/CD28 antibody-coated microbeads (Dynabeads? T cell expander, Invitrogen) at a ratio of 3 beads per cell.

(40) After overnight stimulation, 0.5 ml of neat packaged lentiviral vector was added to the desired cells. This was incubated at 37? C./5% CO2 for 3 days. 3 days post-transduction the cells were counted and diluted to 0.5?106 cells/ml. Fresh medium containing IL-2 was added as required. Beads were removed 5-7 days post-transduction. Cells were counted and fresh medium containing IL-2 replaced or added at 2 day intervals. Cells were kept between 0.5?10.sup.6 and 1?10.sup.6 cells/mL. Cells were analysed by flow cytometry from day 3 and used for functional assays (e.g. ELISpot for IFN? release, see Example 6) from day 5. From day 10, or when cells are slowing division and reduced in size, cells are frozen in aliquots of at least 4?10.sup.6 cells/vial (at 1?10.sup.7 cells/ml in 90% FBS/10% DMSO) for storage.

Example 6Activation of MAGE B2 TCR Engineered T Cells

(41) The following assay was carried out to demonstrate the activation of TCR-transduced cytotoxic T lymphocytes (CTLs) in response to tumour cell lines. IFN-? production, as measured using the ELISPOT assay, was used as a read-out for cytotoxic T lymphocyte (CTL) activation.

(42) ELISPOTS

(43) Reagents

(44) Assay media: 10% FCS (Gibco, Cat #2011-09), 88% RPMI 1640 (Gibco, Cat #42401), 1% glutamine (Gibco Cat #25030) and 1% penicillin/streptomycin (Gibco Cat #15070-063). Wash buffer: 0.01M PBS/0.05% Tween 20 PBS (Gibco Cat #10010)

(45) The Human IFN? ELISPOT kit (BD Bioscience; Cat #551849) containing capture and detection antibodies and Human IFN-? PVDF ELISPOT 96 well plates, with associated AEC substrate set (BD Bioscience, Cat #551951).

(46) Methods

(47) Target Cell Preparation

(48) The target cells used in this method were natural epitope-presenting cells: A375 human melanoma cells which are both HLA-A2+MAGE A10+. HCT116 human colon cancer, which are HLA-A2+MAGE A10+, were used as a negative control. Sufficient target cells (50,000 cells/well) were washed by centrifugation three times at 1200 rpm, 10 min in a Megafuge? 1.0 (Heraeus). Cells were then re-suspended in assay media at 106 cells/ml.

(49) Effector Cell Preparation

(50) The effector cells (T cells) used in this method were peripheral blood lymphocytes (PBL), obtained by negative selection using CD14 and CD25 microbead kits (Miltenyi Biotech Cat #130-050-201 and 130-092-983 respectively) from freshly isolated peripheral blood mononuclear cells (PBMC) from the venous blood of healthy volunteers. Cells were stimulated with antiCD3/CD28 coated beads (Dynabeads? T cell expander, Invitrogen), transduced with lentivirus carrying the gene encoding the full ?? TCR of interest (based on the construct described in Example 5) and expanded in assay media containing 50 U/mL IL-2 until between 10 and 13 days post transduction. These cells were then placed in assay media prior to washing by centrifugation at 1200 rpm, 10 min in a Megafuge? 1.0 (Heraeus). Cells were then re-suspended in assay media at a 4? the final required concentration.

(51) Plates were prepared as follows: 100 ?L anti-IFN-? capture antibody was diluted in 10 ml sterile PBS per plate. 100 ?L of the diluted capture antibody was then dispensed into each well. The plates were then incubated overnight at 4? C. Following incubation the plates were washed (programme 1, plate type 2, Ultrawash Plus 96-well plate washer; Dynex) to remove the capture antibody. Plates were then blocked by adding 200 ?L of assay media to each well and incubated at room temperature for two hours. The assay media was then washed from the plates (programme 1, plate type 2, Ultrawash Plus 96-well plate washer, Dynex) and any remaining media was removed by flicking and tapping the ELISPOT plates on a paper towel.

(52) The constituents of the assay were then added to the ELISPOT plate in the following order: 50 ?L of target cells 10.sup.6 cells/ml (giving a total of 50,000 target cells/well) 50 ?L media (assay media) 50 ?L effector cells (20,000 TCR-transduced PBL cells/well).

(53) The plates were then incubated overnight (37? C./5% CO2). The next day the plates were washed three times (programme 1, plate type 2, Ultrawash Plus 96-well plate washer, Dynex) with wash buffer and tapped dry on paper towel to remove excess wash buffer. 100 ?l of primary detection antibody was then added to each well. The primary detection antibody was diluted into 10 mL of dilution buffer (the volume required for a single plate) using the dilution specified in the manufacturer's instructions. Plates were then incubated at room temperature for at least 2 hours prior to being washed three times (programme 1, plate type 2, Ultrawash Plus 96-well plate washer, Dynex) with wash buffer; excess wash buffer was removed by tapping the plate on a paper towel.

(54) Secondary detection was performed by adding 100 ?L of diluted streptavidin-HRP to each well and incubating the plate at room temperature for 1 hour. The streptavidin-HRP was diluted into 10 mL dilution buffer (the volume required for a single plate), using the dilution specified in the manufacturer's instructions. The plates were then washed three times (programme 1, plate type 2, Ultrawash Plus 96-well plate washer, Dynex) with wash buffer and tapped on paper towel to remove excess wash buffer. Plates were then washed twice with PBS by adding 200 ?L to each well, flicking the buffer off and tapping on a paper towel to remove excess buffer. No more than 15 min prior to use, one drop (20 ?L) of AEC chromogen was added to each 1 ml of AEC substrate and mixed. 10 ml of this solution was prepared for each plate; 100 ?L was added per well. The plate was then protected from light using foil, and spot development monitored regularly, usually occurring within 5-20 min. The plates were washed in tap water to terminate the development reaction, and shaken dry prior to their disassembly into three constituent parts. The plates were then allowed to dry at room temperature for at least 2 hours prior to counting the spots using an Immunospot? Plate reader (CTL; Cellular Technology Limited).

Example 7Identification of the Binding Motif by Substitution with all Alternative Amino Acids

(55) Variants of the native MAGE-B2 peptide were obtained in which the amino acid residue at each position was sequentially replaced with all 19 alternative naturally-occurring amino acid, such that 171 peptides were prepared in total. The native and amino-acid substituted peptides were pulsed on to antigen presenting cells, and interferon ? (IFN?) production, as measured using the ELISpot assay, used as a read-out for the activation of T cells transduced with TCR1. Essential positions were defined by a greater than 50% reduction in T cell activity relative to the native peptide.

(56) ELISpot assays were carried as described in Example 6.

(57) The tolerated residues at each position of the peptide are shown below. Underlined amino acids represent the native residue at the corresponding position in the peptide.

(58) TABLE-US-00006 Position Toleratedresidues 1 G 2 V 3 FY 4 D 5 GN 6 DAES 7 YSWTFQMHPLANGDICE 8 FWVLMAYRKCTIQSHGPN 9 TVIASPGKEQNH 10 FMVAI

(59) It is therefore apparent that the MAGE B2 TCR4 makes contact with at least V2 Y3 and D4 of the peptide (SEQ ID NO: 1) when in complex with HLA-A*0201 on the surface of antigen presenting cells.

(60) The invention is further described by the following numbered paragraphs: 1. A T cell receptor (TCR) having the property of binding to GVYDGEEHSV (SEQ ID NO: 1) in complex with HLA-A*0201 with a dissociation constant of from about 0.05 ?M to about 20.0 ?M when measured with surface plasmon resonance at 25? C. and at a pH between 7.1 and 7.5 using a soluble form of the TCR, and has at least a ten-fold selectivity of binding to SEQ ID NO:1 in complex with HLA-A*0201 over binding to GVYDGREHTV (SEQ ID NO: 2) in complex with HLA-A*0201 wherein the TCR comprises a TCR alpha chain variable domain and a TCR beta chain variable domain, and wherein the TCR variable domains form contacts with at least residues V2, Y3 and D4 of GVYDGEEHSV (SEQ ID NO: 1). 2. A TCR according to numbered paragraph 1, which is an alpha-beta heterodimer, having an alpha chain TRAV10+TRAC constant domain sequence and a beta chain TRBV24-1+TRBC-2 constant domain sequence. 3. A TCR as claimed in numbered paragraph 1, which is in single chain format of the type V?-L-V?, V?-L-V?, V?-C?-L-V?, or V?-L-V?-CB, wherein V? and V? are TCR ? and ? variable regions respectively, Ca and CB are TCR ? and ? constant regions respectively, and L is a linker sequence. 4. A TCR as claimed in any preceding numbered paragraph, which is associated with a detectable label, a therapeutic agent or a PK modifying moiety. 5. A TCR as claimed in any preceding numbered paragraph, wherein the alpha chain variable domain comprises an amino acid sequence that has at least 80% identity to the sequence of amino acid residues 1-105 of SEQ ID NO: 3 and has the following mutation:

(61) TABLE-US-00007 CDR2 I3 R
with reference to the numbering shown in SEQ ID NO: 3, and/or the beta chain variable domain comprises an amino acid sequence that has at least 80% identity to the sequence of amino acid residues 1-105 of SEQ ID NO: 4 and has at least one of the following mutations:

(62) TABLE-US-00008 CDR1 H3 R CDR3 N10 E CDR3 N10 R
with reference to the numbering shown in SEQ ID NO: 4. 6. A TCR as claimed in any preceding numbered paragraph, wherein the alpha chain variable domain comprises the amino acid sequence of amino acid residues 1-105 of SEQ ID NO: 3 or 7 or an amino acid sequence in which amino acid residues 1-27, 34-47, and 54-90 thereof have at least 90% or 95% identity to the sequence of amino acid residues 1-27, 34-47, and 54-90 respectively of SEQ ID NO: 3 or 7 and in which amino acid residues 28-34, 48-53 and 91-105 have at least 90% or 95% identity to the sequence of amino acid residues 28-33, 48-53 and 91-105 respectively of SEQ ID NO: 3 or 7. 7. A TCR as claimed in any one of numbered paragraphs 1-6, wherein the alpha chain variable domain comprises the amino acid sequence of amino acid residues 1-105 of SEQ ID NO: 3 or 7 or an amino acid sequence in which amino acid residues 1-27, 34-47 and 54-90 thereof have at least 90% or 95% identity to the sequence of amino acid residues 1-27, 34-47, and 54-90 respectively of SEQ ID NO: 3 or 7 and in which amino acid residues 28-33, 48-53 and 91-105 have at least 90% or 95% identity to the sequence of amino acid residues 28-33, 48-53 and 91-105 respectively of SEQ ID NO: 3 or 7. 8. A TCR as claimed in any preceding numbered paragraph, wherein in the alpha chain variable domain the sequence of (i) amino acid residues 1-27 thereof has (a) at least 90% identity to the sequence of amino acid residues 1-27 of SEQ ID NO: 3 or (b) has one, two or three amino acid residues inserted or deleted relative to the sequence of (a); (ii) amino acid residues 28-33 of SEQ ID NO: 3; (iii) amino acid residues 34-47 thereof has (a) at least 90% identity to the sequence of amino acid residues 34-47 of SEQ ID NO: 3 or (b) has one, two or three amino acid residues inserted or deleted relative to the sequence of (a); (iv) amino acid residues 48-53 is of SEQ ID NO: 3 or amino acid residues 48050, 52 and 53 of SEQ ID NO: 3 with amino acid residues 51 of SEQ ID NO: 3 substituted with R instead of I; (v) amino acid residues 54-90 thereof has at least 90% identity to the sequence of amino acid residues 54-90 of SEQ ID NO: 3 or has one, two or three insertions, deletions or substitutions relative thereto; (vi) amino acids 91-105 of SEQ ID NO: 3. 9. A TCR as claimed in any preceding numbered paragraph, wherein the beta chain variable domain comprises the amino acid sequence of SEQ ID NO: 4 or 8-10 or an amino acid sequence in which amino acid residues 1-45, 51-67, and 74-109 thereof have at least 90% or 95% identity to the sequence of amino acid residues 1-45, 51-67, and 74-109 respectively of SEQ ID NO: 4 or 8-10 and in which amino acid residues 46-50, 68-73 and 109-123 have at least 90% or 95% identity to the sequence of amino acid residues 46-50, 68-73 and 109-123 respectively of SEQ ID NO: 4 or 8-10. 10. A TCR according to any preceding numbered paragraph, wherein in the beta chain variable domain the sequence of (i) amino acid residues 1-45 thereof has (a) at least 90% identity to the amino acid sequence of residues 1-27 of SEQ ID NO: 4 or (b) has one, two or three amino acid residues inserted or deleted relative to the sequence of (a); (ii) amino acid residues 46-50 is of SEQ I D NO: 4 or residues 46, 47, 49 and 50 of SEQ ID NO: 4 with amino acid residue 48 of SEQ ID NO: 4 substituted with R instead of H; (iii) amino acid residues 51-67 thereof has (a) at least 90% identity to the sequence of amino acid residues 51-67 of SEQ ID NO: 4 or (b) has one, two or three amino acid residues inserted or deleted relative to the sequence of (a); (iv) amino acid residues 68-73 of SEQ ID NO: 4; (v) amino acid residues 54-90 thereof has (a) at least 90% identity to the sequence of amino acid residues 54-90 of SEQ ID NO: 4 or (b) has one, two or three amino acid residues inserted or deleted relative to the sequence of (a); (vi) amino acid residues 110-123 of SEQ ID NO: 4 or amino acid residue 110-118 and 120-123 of SEQ ID NO: 4 with amino acid residue 119 of SEQ ID NO: 4 substituted with R instead of N or amino acid residues 110-118 and 120-123 of SEQ ID NO: 4 with amino acid residue 119 of SEQ ID NO: 4 substituted with K instead of N. 11. Nucleic acid encoding a TCR as claimed in any one of the preceding numbered paragraphs. 12. An isolated or non-naturally occurring cell, especially a T-cell, presenting a TCR as claimed in any one of numbered paragraphs 1 to 10. 13. A cell harbouring (a) a TCR expression vector which comprises nucleic acid as claimed in numbered paragraph 11 in a single open reading frame, or two distinct open reading frames encoding the alpha chain and the beta chain respectively; or (b) a first expression vector which comprises nucleic acid encoding the alpha chain of a TCR as claimed in any of numbered paragraphs 1 to 10, and a second expression vector which comprises nucleic acid encoding the beta chain of a TCR as claimed in any of numbered paragraphs 1 to 10. 14. A pharmaceutical composition comprising a TCR as claimed in any one of numbered paragraphs 1 to 10, nucleic acid of numbered paragraph 11 or a cell as claimed in numbered paragraph 12 or numbered paragraph 13, together with one or more pharmaceutically acceptable carriers or excipients. 15. The TCR of any one of numbered paragraphs 1 to 10, nucleic acid of numbered paragraph 11 or cell of numbered paragraph 12 or numbered paragraph 13 for use in medicine. 16. The TCR, nucleic acid or cell for use as claimed in numbered paragraph 15, for use in a method of treating cancer.

(63) TABLE-US-00009 MAGEB2Epitope SEQIDNO:1 GVYDGEEHSV MAGEA4Epitope SEQIDNO:2 GVYDGREHTV alphavariablechain SEQIDNO:3 MKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTIMTFSENTKSNGRYT ATLDADTKQSSLHITASQLSDSASYICVVSGGTDSWGKLQF betavariablechain SEQIDNO:4 MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRL IYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSGQGAYNEQFF alphachainsolubleform SEQIDNO:5 MKKHLTTFLVILWLYFYRGNGKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRG PVSLTIMTFSENTKSNGRYTATLDADTKQSSLHITASQLSDSASYICVVSGGTDSWGKLQFGAG TQVVVTPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDF KSNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESS betachainsolubleform SEQIDNO:6 MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRL IYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSGQGAYNEQFFGPGTR LTVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVSTDP QPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAE AWGRAD mutantalphavariablechain SEQIDNO:7 MKNQVEQSPQSLIILEGKNCTLQCNYTVSPFSNLRWYKQDTGRGPVSLTRMTFSENTKSNGRYT ATLDADTKQSSLHITASQLSDSASYICVVSGGTDSWGKLQF mutantbetavariablechain SEQIDNO:8 MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGRDRMYWYRQDPGLGLRL IYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSGQGAYNEQFF mutantbetavariablechain SEQIDNO:9 MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRL IYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSGQGAYEEQFF mutantbetavariablechain SEQIDNO:10 MASLLFFCGAFYLLGTGSMDADVTQTPRNRITKTGKRIMLECSQTKGHDRMYWYRQDPGLGLRL IYYSFDVKDINKGEISDGYSVSRQAQAKFSLSLESAIPNQTALYFCATSGQGAYREQFF alphachainsolubleform SEQIDNO:11 METLLGLLILWLQLQWVSSKQEVTQIPAALSVPEGENLVLNCSFTDSAIYNLQWFRQDPGKGLT SLLLIQSSQREQTSGRLNASLDKSSGRSTLYIAASQPGDSATYLCAVGGYSTLTFGKGTVLLVS PDNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFKSNSA VAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRILLLK VAGFNLLMTLRLWSS betachainsolubleform SEQIDNO:12 MSISLLCCAAFPLLWAGPVNAGVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKL IYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSYSRWSPLHFGNGTRL TVTEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQ PLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEA WGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF alphachainsolubleform SEQIDNO:13 MQKEVEQNSGPLSVPEGAIASLNCTYSDRGSQSFFWYRQYSGKSPELIMFIYSNGDKEDGRFTA QLNKASQYVSLLIRDSQPSDSATYLCAVKMANQAGTALIFGKGTTLSVSSNIQNPDPAVYQLRD SKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFN NSIIPEDTFFPSPESS betachainsolubleform SEQIDNO:14 MQDGGITQSPKFQVLRTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVGAGITDQGEVPN GYNVSRLNKREFSLRLESAAPSQTSVYFCASLGGLADEQFFGPGTRLTVLEDLKNVFPPEVAVF EPSEAEISHTQKATLVCLATGFYPDHVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSS RLRVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD alphachainsolubleform SEQIDNO:15 MKTFAGFSFLFLWLQLDCMSRGEDVEQSLFLSVREGDSSVINCTYTDSSSTYLYWYKQEPGAGL QLLTYIFSNMDMKQDQRLTVLLNKKDKHLSLRIADTQTGDSAIYFCAERNSGAGSYQLTFGKGT KLSVIPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKTVLDMRSMDFK SNSAVAWSNKSDFACANAFNNSIIPEDTFFPSPESSCDVKLVEKSFETDTNLNFQNLSVIGFRI LLLKVAGFNLLMTLRLWSS betachainsolubleform SEQIDNO:16 MGTSLLCWMALCLLGADHADTGVSQNPRHKITKRGQNVTFRCDPISEHNRLYWYRQTLGQGPEF LTYFQNEAQLEKSRLLSDRFSAERPKGSFSTLEIQRTEQGDSAMYLCASSLFSGVNTEAFFGQG TRLTVVEDLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVST DPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVS AEAWGRADCGFTSVSYQQGVLSATILYEILLGKATLYAVLVSALVLMAMVKRKDF