CHIMERIC ANTIGEN RECEPTOR AND USE THEREOF
20240261329 ยท 2024-08-08
Assignee
Inventors
Cpc classification
A61K35/17
HUMAN NECESSITIES
C07K2319/33
CHEMISTRY; METALLURGY
C12N5/10
CHEMISTRY; METALLURGY
C07K2319/74
CHEMISTRY; METALLURGY
A61K2239/38
HUMAN NECESSITIES
C12N15/86
CHEMISTRY; METALLURGY
A61P35/00
HUMAN NECESSITIES
A61K39/464406
HUMAN NECESSITIES
A61K39/4611
HUMAN NECESSITIES
C12N2740/16043
CHEMISTRY; METALLURGY
C07K14/42
CHEMISTRY; METALLURGY
C12N2740/15043
CHEMISTRY; METALLURGY
A61K2239/59
HUMAN NECESSITIES
International classification
A61K35/17
HUMAN NECESSITIES
C07K16/28
CHEMISTRY; METALLURGY
C07K14/42
CHEMISTRY; METALLURGY
C12N15/86
CHEMISTRY; METALLURGY
A61K39/00
HUMAN NECESSITIES
Abstract
The present invention belongs to the field of biomedicine, and particularly relates to a chimeric antigen receptor and use thereof. The present invention provides a novel chimeric antigen receptor, comprising an extracellular domain, a transmembrane domain and an intracellular domain, wherein the transmembrane domain and the intracellular domain of the chimeric antigen receptor form a costimulatory signaling domain, and the costimulatory signaling domain comprises a full length or a fragment of an amino acid sequence encoding a reverse dectin-1. Experiments prove that novel CAR-T cells provided by the present invention are effective against a variety of solid tumors and hematological malignancies.
Claims
1. A chimeric antigen receptor, comprising an extracellular domain, a transmembrane domain and an intracellular domain, wherein the transmembrane domain and the intracellular domain of the chimeric antigen receptor form a costimulatory signaling domain, and the costimulatory signaling domain comprises a full length or a fragment of an amino acid sequence encoding a reverse dectin-1.
2. The chimeric antigen receptor according to claim 1, wherein the extracellular domain comprises a single-chain antibody targeting to CD19 or HER2.
3. The chimeric antigen receptor according to claim 2, wherein the chimeric antigen receptor further comprises a CD8? hinge region, a reverse dectin-1 transmembrane domain, a reverse dectin-1 intracellular signaling domain and a CD32 intracellular signaling domain which are connected in sequence.
4. The chimeric antigen receptor according to claim 1, wherein the amino acid sequence encoding the reverse dectin-1 is shown in SEQ ID NO:3.
5. The chimeric antigen receptor according to claim 3, wherein an amino acid sequence encoding the reverse dectin-1 transmembrane domain is shown in SEQ ID NO:2.
6. The chimeric antigen receptor according to claim 3, wherein an amino acid sequence encoding the reverse dectin-1 intracellular signaling domain is shown in SEQ ID NO:1.
7. A lentiviral vector comprising the chimeric antigen receptor according to claim 1, wherein the lentiviral vector is optionally pCLK, psPAX2 or pMD2.0G.
8. (canceled)
9. A CAR-T cell, wherein expressing the chimeric antigen receptor according to claim 1.
10. An antitumor drug, comprising the CAR-T cell according to claim 9 and a pharmaceutically acceptable excipient and/or adjuvant.
11. The antitumor drug according to claim 10, wherein the tumor comprises hematological tumors and solid tumors.
12. The antitumor drug according to claim 10, wherein the tumor comprises large B-cell lymphoma, B-cell lymphoma, non-Hodgkin lymphoma, myelogenous leukemia, lymphoblastic leukemia, breast cancer, gastric cancer, esophageal cancer or ovarian cancer.
13. Use of the CAR-T cell according to claim 9 in preparation of an antitumor drug.
14. The use according to claim 13, wherein the CAR-T cell can stimulate secretion of effector cytokine.
15. The use according to claim 14, wherein the effector cytokine comprises IFN-?, TNF-? and IL-6.
16. The use according to claim 13, wherein the CAR-T cell, upon being stimulated, display phenotype of a central memory T cell.
17. The use according to claim 13, wherein the tumor comprises hematological tumors and solid tumors.
18. The use according to claim 13, wherein the tumor comprises large B-cell lymphoma, B-cell lymphoma, non-Hodgkin lymphoma, myelogenous leukemia, lymphoblastic leukemia, breast cancer, gastric cancer, esophageal cancer or ovarian cancer.
19. A synthesis method for the chimeric antigen receptor according to claim 1, comprising the following steps: (1) synthesizing a gene sequence of the reverse dectin-1 transmembrane domainreverse dectin-1 intracellular domain or a gene sequence of the reverse dectin-1 transmembrane domainCD3? intracellular signaling domain; (2) synthesizing primers according to a target, and synthesizing a gene sequence of the chimeric antigen receptor by an overlapping PCR method.
20. The synthesis method according to claim 19, wherein the step (2) specifically comprises: first using primers F1 and R1 to expand a bound gene sequence of the extracellular domain and the CD8? hinge region, then using primers F2 and R2 to expand the gene sequence of the reverse dectin-1 transmembrane domainCD3? intracellular signaling domain, and finally using the bound gene sequence of the extracellular domain and the CD8? hinge region as well as the gene sequence of the reverse dectin-1 transmembrane domainCD3? intracellular signaling domain as templates and using F1 and R2 as primers to synthesize the gene sequence of the chimeric antigen receptor.
21. The synthesis method according to claim 20, wherein the primer F1 is shown in SEQ ID NO:7, R1 is shown in SEQ ID NO:8, F2 is shown in SEQ ID NO:9, and R2 is shown in SEQ ID NO: 10.
Description
DESCRIPTION OF DRAWINGS
[0034] To make the embodiments of the present invention or the technical solutions in the prior art clearer, the drawings required to be used in the description of the embodiments or the prior art will be briefly introduced below. It is obvious that the drawings described below are some embodiments of the present invention, and that other drawings can be obtained from these drawings for those of ordinary skill in the art without making inventive effort.
[0035]
[0036]
[0037]
[0038]
[0039]
[0040]
[0041]
[0042]
DETAILED DESCRIPTION
[0043] To make the objective, the technical solutions and advantages of the embodiments of the present invention clearer, the technical solutions of the embodiments of the present invention will be clearly and completely described below in combination with drawings. It is obvious that the described embodiments are some of the embodiments of the present invention, not all of the embodiments. Based on the embodiments of the present invention, all other embodiments obtained by those of ordinary skill in the art without making inventive effort shall belong to the protection scope of the present invention.
[0044] The embodiments are for the purpose of better illustration of the present invention, but the contents of the present invention are not limited to the embodiments. Therefore, non-essential improvements and adjustments of the embodiments made by those skilled in the art according to the above-mentioned contents of the present invention still belong to the protection scope of the present invention.
[0045] It should be noted that the term include, comprise or any variant thereof is intended to encompass nonexclusive inclusion so that a process, method, article or device including a series of elements includes not only those elements but also other elements which have been not listed definitely or an element(s) inherent to the process, method, article or device. Moreover, the expression comprising a(n) . . . in which an element is defined will not preclude presence of an additional identical element(s) in a process, method, article or device comprising the defined element(s) unless further defined.
[0046] As used herein, the term about, typically means+/?5% of the stated value, more typically +/?4% of the stated value, more typically +/?3% of the stated value, more typically, +/?2% of the stated value, even more typically +/?1% of the stated value, and even more typically +/?0.5% of the stated value.
[0047] Throughout this application, embodiments of this invention may be presented with reference to a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6, etc.; as well as individual numbers within that range, for example, 1, 2, 3, 4, 5, and 6. This applies regardless of the breadth of the range.
[0048] RD-1 is a reverse dectin-1, with an amino acid sequence of GLVVAIVLIVLCLIGLIVAILRWPPSAACSGKESVVAIRTNSQSDFHLQTYGDE DLNELDPHYEM, as shown in SEQ ID NO:3; whereas an amino acid sequence of a dectin-1 is
[0049] MEYHPDLENLDEDGYTQLHFDSQSNTRTAVVSEKGSCAASPPWRLIAVILGI LCLVILVIAVVLG, as shown in SEQ ID NO:4. An amino acid sequence of an RD-1 intracellular domain is RWPPSAACSGKESVVAIRTNSQSDFHLQTYGDEDLNELDPHYEM, as shown in SEQ ID NO: 1; and an amino acid sequence of an RD-1 transmembrane domain is GLVVAIVLIVLCLIGLIVAIL, as shown in SEQ ID NO:2. The inventor investigated that in preparation of a novel 2nd generation CAR, using the reverse dectin-1 as a costimulatory domain can efficiently produce and maintain activity and functions of the dectin-1 (i.e. can influence functions of T cells, enhance secretion and lytic capacity of a variety of cytokines (including IFN-?, TNF-? and IL-6), reduce exhaustion potential, and increase cell expansion and significant antitumor activity). Therefore, unless otherwise specified herein, a dectin-1 in a CAR structure refers to a reverse dectin-1.
Embodiment 1
Materials and Methods
[0050] 1. Cell lines: all cell lines were obtained from the American Type Culture Collection (ATCC). The K562 (myelogenous leukemia) and NALM6 (lymphoblastic leukemia) were cultured in RPMI-1640 with heat-inactivated 10% fetal bovine serum (FBS) (PAN, Germany. Cat: ST30-3302), penicillin (Gibco, Thermo Fisher, Waltham, MA. Cat: SV30010) (100 U/mL) and streptomycin (Gibco, Thermo Fisher, Waltham, MA. Cat: SV30010) (100 ug/mL). The human cancer cell lines SK-OV-3 (ovarian cystadenocarcinoma) and MDA-MB-468 (breast cancer) were cultured in DMEM with heat-inactivated 10% FBS, penicillin (100 U/mL) and streptomycin (100 ug/mL). SK-OV-3 cells were also engineered to express luciferase.
2. Construction of Plasmids Encoding CARs
[0051] Anti-CD19 or anti-HER2 CARs include a single-chain fragment variable (scFv) specific to CD19 (clone FMC63) or HER2 (clone 4D5). The scFv was followed by a human CD8? hinge region, then either a human CD8? transmembrane domain (TM), 4-1BB or CD3? intracellular domains (ICDs). CAR sequences are formed by overlapping PCR. Individual lentiviral plasmids encoding each CAR sequence was constructed using double enzymes digestion with the PCLK lentiviral vector. Four CAR sequences constructed were as follows: [0052] 1) hH8-BBZ: HER2 scFv-CD8? (hinge+TM)-4-1BB-CD3? ICDs [0053] 2) hHD-DZ: HER2 scFv-CD8? hinge+Dectin-1(TM+cytoplasm)-CD3? ICDs [0054] 3) h198-BBZ: CD19 scFv-CD8a(hinge+TM)-4-1BB-CD3? ICDs [0055] 4) h19D-DZ: CD19 scFv-CD8? hinge+Dectin-1(TM+cytoplasm)-CD3? ICDs
3. Generation of Lentiviral Particles
[0056] HEK-293T cells (embryonic kidney cells) from ATCC were cultured in DMEM with heat-inactivated 10% fetal bovine serum (FBS) (PAN, Germany. Cat: ST30-3302), penicillin (100 U/mL) and streptomycin (Gibco, Thermo Fisher, Waltham, MA. Cat: SV30010) (100 ug/mL).
[0057] To produce lentivirus-comprising supernatant, HEK-293T cells were transfected with the following plasmids as detailed previously: the appropriate CAR-encoding plasmids, psPAX2 and pMD2.0G (Invitrogen). The medium was changed 12 h after transfection. The supernatant was harvested and spun to get rid of cell debris. The supernatant was filtered and concentrated by ultracentrifugation at 19,700 rpm for 2 h. The supernatant was discarded. The lentiviral pellet was dissolved in PBS medium and the concentrated lentivirus was stored at ?80? C. The concentrated lentivirus titers were measured by quantitative real time polymerase chain reaction (Q-RT-PCR).
4. Isolation, Transduction, Production and Expansion of CAR-T Cells
[0058] Peripheral Blood Mononuclear Cells (PBMCs) were isolated from healthy donor blood by the Ficoll-hypaque density gradient (Lonza, Cat:04-418Q). All samples were obtained after informed consent and approval by the Ethics Committee of the State Key Laboratory of Biotherapy.
[0059] PBMCs were cultured in X-VIVO 15 medium (Sigma-Aldrich, Cat: 10771) with 5% human serum (Sigma-Aldrich, H4522) and 100 U/ml recombinant human IL-2 (rhIL-2) (PeproTech, NJ, USA. Cat: 200-02-10). PBMCs were stimulated with anti-CD3/CD28 magnetic beads (Gibco, Thermo Fisher, Waltham, MA. Cat: 11131D). After 24 h, T cells were cultured with the lentivirus at a multiplicity of infection (MOI) of 5 for 48 h, and then the cells were washed and cultured in the T cell medium. Transduction efficiency was determined by CAR expression measured by a flow cytometry.
5. Flow Cytometry Assays
[0060] All flow cytometry assays were performed on a Novocyte flow cytometry (ACEA Biosicences, Inc.), and data were analyzed by novocyte express (ACEA Biosicences, Inc.).
[0061] Transduction efficiency and associated CAR protein expression were evaluated using biotin-SP-conjugated AffiniPure Goat Anti-Mouse IgG, F(ab)2 Fragment Specific (Cat: 120962, Jackson Immune Research) with PE-streptavidin (Cat: 405203, BD Biosciences).
[0062] The following antibodies were used for differentiation phenotype, and exhaustion marker assays:
[0063] anti-CD3-FITC (clone: HIT3a, Cat: 300306, Biolegend), anti-CD8-APC (clone: HIT8a, Cat: 300912, Biolegend), anti-CD4-PE (clone: RPA-T4, Cat: 300508, Biolegend), anti-CD45ROPE (BD Biosciences, clone: UCHL1, Cat: 555493), antiCD62L-APC (BD Biosciences, clone: DREG-56, Cat: 559772), anti-PD-1-APC (clone: EH12.2H7, Cat: 329908, Biolegend), anti-CTLA-4-APC (Cat: 369612, Biolegend), anti-LAG3-APC (Cat: 369212, Biolegend), and anti-TIM3-APC (Cat: 345012, Biolegend).
6. In Vitro Cytokine Experiments
[0064] Target cells (NALM6, K562, SK-OV-3 or MDA-MB-468, at 1?10.sup.5 cells/well) were seeded in 96-well plates and incubated at 37? C. with 5% CO.sub.2 overnight. After that, CAR-T cells were added at an effector/target ratio (E:T) of 5 or 10. The CAR-T cell number was normalized by transduction efficiency. Supernatants were collected 24 h after co-culture with the target cells. ELISA kits for cytokine assay from Invitrogen (IFN-? Cat: 88-7316-88, TNF-? Cat: 88-7346-88, and IL-6 Cat: 88-7066-88) were used to quantify IFN-?, TNF-? and IL-6.
7. Real-Time Cytotoxicity Assays (RTCA)
[0065] The cytotoxic effect of CAR-T cells was measured by the real-time cytotoxicity assay (ACEA Bioscience, Inc. xCELLigence RTCA SP). SK-OV-3 or MDA-MB-468 cells at 1?10.sup.4 cells/well were cultured in an E-plate 96 for ?24 h. CAR-T cells (hH8-BBz and hHD-Dz) or mock T cells were added to the plates at an E:T ratio of 10. Data were acquired and analyzed according to the protocols specified by the manufacturers (ACEA 162 Bioscience, Inc. RTCA Software 2.1).
8. In Vivo Xenograft Studies
[0066] Six-week old female B-NSG (NOD-Prkdcscid IL2rgtm1/Bcgen) mice were used in this study. Each mouse received an i.p. injection of 2?10.sup.6 SK-OV-3-luc cells.
[0067] The SK-OV-3-luc cells were obtained by engineering design of SK-OV-3 cells, which can express luciferase and display tumor growth through fluorescence signals in a subsequent tumor bioluminescence imaging experiment.
[0068] Tumors were allowed to grow for 3 days, and then each mouse received an i.p. injection of 1?10.sup.7 CAR-T cells (hH8-BBz, hHD-Dz or mock). After 3 additional days, another i.p. injection of the CAR-T cells was given to individual mouse. Bioluminescent imaging (BLI) for tumors was performed on scheduled days (day 3, day 10, day 17, day 24, day 31 and day 55) by IVIS (in vivo imaging system). Tumor fluxes (photon/s/cm.sup.2/steradian) were quantified by measuring the photon signal within a delineated region of interest (ROI) encompassing. Living Image software (v2.50, Xenogen; Caliper Life Sciences) was used to demonstrate the BLI data. The data for survival analysis was established at the death of each mouse.
9. Statistics
[0069] Statistical plotting and analysis were performed using GraphPad Prism v6.01 (GraphPad Software Inc.) and SPSS V17. Data were expressed as the mean?SD. One-way ANOVA was used for comparison of three groups in a single condition.
[0070] Kaplan-Meier survival data were analyzed using a log rank (Mantel-Cox) test. Data were transformed when needed to normalize variance. Symbols indicate statistical significance as follows: * P<0.05; ** P<0.01 and *** P<0.001.
Embodiment 2
[0071] 1. Novel CAR Constructs with the Dectin-1 Costimulatory Signaling Domain
[0072] In the present invention, novel 2nd generation CAR constructs were designed through the combination of scFv domains targeting either CD19 or HER2 epitope with the dectin-1 TM, dectin-1 and CD3? ICDs (
2. Impacts on Effector Functions of Novel CAR-T Cells Through Dectin-1 Costimulation
[0073] Typically, a later effector function by CAR-T cells can be assessed by cytokine secretion. Therefore, the impacts of dectin-1 as a costimulatory signaling molecule on cytokine release from the new CAR-T cells were evaluated following exposure to tumor cells that express either HER2 or CD19.
[0074] The released effector cytokines, including IFN-?, TNF-? and IL-6, by anti-HER2 or anti-CD19 CAR-T cells increased significantly with incorporating the dectin-1 signaling domain in the target positive cell lines (SK-OV-3 and NALM6) (
[0075] The cytotoxic function of anti-HER2 CAR-T cells was further investigated to illustrate antigen engagement and CAR-T cell activation. After co-culture of anti-HER2 CAR-T cells with either SK-OV-3 or MDA-MB-468 tumor cell lines, it was observed that both hHD-Dz and hH8-BBz CAR-T cells effectively lysed the SK-OV-3 tumor cells, and hHD-Dz CAR-T cells showed a much different lytic cytotoxicity function from the hH8-BBz CAR-T cells (
3. Phenotype and Exhaustion Marker Expression of Anti-HER2 CAR-T Cells
[0076] The phenotype and exhaustion marker expression of both anti-HER2 CAR-T cells and mock T cells were analyzed after a 7-day period of cell expansion (
[0077] The hHD-Dz, hH8-BBz CAR-T and mock T cells showed similar percentage of CD4.sup.+ or CD8.sup.+ T cells (
[0078] The expression pattern of inhibitory receptors, including PD-1, CTLA-4, TIM3 and LAG3, was assessed for the anti-HER2 CAR-T cells (
[0079] It was showed that there were ?10% less PD-1 or LAG3 positive cells in the hHD-Dz CAR-T cells than in the hH8-BBz CAR-T cells. In terms of TIM3 and CTLA-4 positive cells, a similar percentage was observed in the hHD-Dz and the hH8-BBz CAR-T cells (
[0080] The time-course of anti-HER2 CAR expression was further explored in the present invention. Although there was a decrease of CAR expression within 96 h, the CAR expression reached to >90% after additional 48 h (
[0081] Overall, the above results suggested that the dectin-1 signaling domain in the novel CAR-T cells may result in distinct phenotype and exhaustion marker expression, and discrete T cell proliferation potential.
4. In Vivo Antitumor Activity of Anti-HER2 CAR-T Cells
[0082] Using NSG mice bearing xenograft SK-OV-3-LUc tumor cells, in vivo antitumor activity of the anti-HER2 CAR-T cells (the hH8-BBz or hHD-Dz CAR-T cells) was further investigated in the present invention. Overall survival and tumor volume were evaluated (
Embodiment 3
[0083] The embodiment further provides a costimulatory signaling domain of a chimeric antigen receptor, wherein the costimulatory signaling domain comprises an RD-1 intracellular domain.
[0084] Further, the costimulatory signaling domain comprises CD35.
[0085] Further, the RD-1 intracellular domain comprises an amino acid sequence of SEQ ID NO: 1 or an amino acid sequence having not less than 90% identity with SEQ ID NO:1.
[0086] Further, the costimulatory signaling domain further comprises one or more of CD3, CD4, CD8, FcR, DAP10, DAP12, CD27, CD28, CD137, CD134, ICOS, OX40, CD30, CD40, PD-1, LFA-1, CD2, CD7, LIGHI, NKG2C, B7-H3, CD83-specific binding ligand, CDS, ICAM-1, GITR, BAFFR, HVEM (IGHTR), SLAMF7, NKp80 KLRE1, CD160, CD19, CD83, IL-2R?, IL-R?, IL-7R?, ITGA4, VLA1, CD49?, ITGA4, IA4, CD49D, ITGA6, LA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11?, LFA-1, ITGAM, CDIIB, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7 TAFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96(Tactile), CEACAM1 CRTAM, Ly9 (CD229), D160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108 SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAME8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76 PAG/Cbp, NKp4, NWKp30, NKp46 and NKG2D.
[0087] The embodiment further provides a chimeric antigen receptor comprising the above-mentioned costimulatory signaling domain.
[0088] Further, the chimeric antigen receptor comprises an antigen recognition domain, a CD8? hinge region, a transmembrane domain, an RD-1 intracellular domain and CD3? which are connected in sequence.
[0089] Further, an amino acid sequence comprised in the transmembrane domain is capable of anchoring the chimeric antigen receptor to a cell membrane.
[0090] Further, the transmembrane domain comprises an RD-1 transmembrane domain.
[0091] Further, the RD-1 transmembrane domain comprises an amino acid sequence of SEQ ID NO:2 or an amino acid sequence having not less than 90% identity with SEQ ID NO:2.
[0092] Preferably, the antigen recognition domain is a HER2 binding domain.
[0093] Further, the chimeric antigen receptor comprises an amino acid sequence of SEQ ID NO:5.
[0094] Preferably, the antigen recognition domain is a CD19 binding domain.
[0095] Further, the chimeric antigen receptor comprises an amino acid sequence of SEQ ID NO:6.
[0096] The embodiment further provides a synthesis method of the above-mentioned chimeric antigen receptor, wherein the method comprises the following steps: step (1) synthesizing a gene sequence of RD-1-CD3?; step (2) synthesizing a gene sequence of the chimeric antigen receptor.
[0097] Further, the step (2) specifically comprises: first using primers F1 and R1 to expand a bound gene sequence of the antigen recognition domain and the CD8? hinge region, then using primers F2 and R2 to expand the gene sequence of RD-1-CD3?, and finally using the bound gene sequence of the antigen recognition domain and the CD8? hinge region as well as the gene sequence of RD-1-CD3? as templates and using F1 and R2 as primers to synthesize the gene sequence of the chimeric antigen receptor.
[0098] Further, the primer F1 is shown in SEQ ID NO:7, R1 is shown in SEQ ID NO:8, F2 is shown in SEQ ID NO:9, and R2 is shown in SEQ ID NO: 10.
[0099] An amino acid sequence of the synthesized (anti-HER2 scFV)-(CD8? hinge)-(RD-1TM+Cytoplasmic)-(CD3?) is SEQ ID NO:5.
[0100] The embodiment further provides a recombinant plasmid vector constructed by the above-mentioned chimeric antigen receptor and an expression vector.
[0101] Further, the expression vector is a pCLK vector.
[0102] The embodiment further provides a construction method of the above-mentioned recombinant plasmid vector, wherein the construction method comprises: using Mlu I and Spe I as restriction sites to connect genes of the chimeric antigen receptor with the expression vector, and thus to obtain the recombinant plasmid vector.
[0103] The embodiment further provides an immune cell modified by the above-mentioned chimeric antigen receptor.
[0104] Further, the immune cell is T lymphocyte.
[0105] Further, the immune cell also includes one or more of B lymphocyte, K lymphocyte and NK lymphocyte.
[0106] The embodiment further provides a method for obtaining the above-mentioned immune cell, wherein the method comprises the following steps: using Mlu I and Spe I as restriction sites to connect genes of the chimeric antigen receptor with an expression vector, and thus to obtain a recombinant plasmid vector; transfecting the recombinant plasmid vector and packaging plasmids together into cultured cells for culturing, thus to obtain recombinant virus particles; and using the recombinant virus particles to modify the immune cell.
[0107] Further, method of the modification comprises: using a virus vector system or non-virus vector system.
[0108] Further, the virus vector system includes one or more of a retroviral vector, a lentiviral vector, an adenovirus vector, an adeno-associated virus vector and a sendai virus vector.
[0109] Further, the non-virus vector system includes one or more of a transposon system, a CRISPR gene editing system, a TALEN system, a liposome transfection system and an electrotransfection system.
[0110] The purpose of the present invention is to further provide an application of the above-mentioned immune cell in preparation of an antitumor drug composition.
[0111] Further, the antitumor drug composition further comprises a chemical drug.
[0112] Further, the chemical drug includes cyclophosphamide and/or fludarabine.
[0113] Further, the antitumor drug composition is an antitumor drug against breast cancer and/or ovarian cancer.
[0114] The embodiment further provides a composition comprising the above-mentioned chimeric antigen receptor, wherein the composition further comprises one or more of a ?-glucan receptor, Syk, CR3 and CD11b bound to the costimulatory signaling domain.
[0115] The primers used for obtaining CAR genes in the embodiment are shown in Table 1:
TABLE-US-00001 TABLE1 PrimersusedforobtainingCARgenes SequenceID Primer Number Sequence F1 SEQIDNO:7 CGACGCGTatggccttaccagtga R1 SEQIDNO:8 TGCACACGAGGGGGCTGGACTTCGCCTG TGATggtctggtcgtggctatagtgctg atagtatt F2 SEQIDNO:9 aatactatcagcactatagccacgacca gaccATCACAGGCGAAGTCCAGCCCCCT CGTGTGCA R2 SEQIDNO:10 GGACTAGTttaGCGAGGGGG
Embodiment 4
[0116] Obtaining CAR Genes with a Full-Length Antigen of HER2 by PCR: [0117] (1) Step 1, gene synthesis: synthesizing a full length of an RD-1(TM+cytoplasmic)-CD3? fragment. [0118] (2) Step 2, synthesizing primers, and obtaining a fused fragment of (anti-HER2 scFV)-(CD8? hinge)-(RD-1TM+Cytoplasmic)-(CD3?) by an overlapping PCR method, which specifically comprises the following two steps: [0119] (2.1) Expanding (anti-HER2 scFV)-(CD8? hinge) using primers F1 and R1; and expanding (RD-1TM+Cytoplasmic)-(CD3) using primers F2 and R2. [0120] (2.2) Using (anti-HER2 scFV)-(CD8? hinge) and (RD-1TM+Cytoplasmic)-(CD3?) as templates and using F1 and R2 as primers to obtain full-length CAR genes by PCR.
[0121] An amino acid sequence of the synthesized (anti-HER2 scFV)-(CD8? hinge)-(RD-1TM+Cytoplasmic)-(CD3?) is SEQ ID NO:5.
Construction of a Recombinant Plasmid Vector for CAR with an Antigen of HER2: [0122] (1) Step 1, gene synthesis: synthesizing a full length of an RD-1(TM+cytoplasmic)-CD3 fragment. [0123] (2) Step 2, designing primers, and obtaining a fused fragment of (anti-HER2 scFV)-(CD8? hinge)-(RD-1TM+Cytoplasmic)-(CD3?) by an overlapping PCR method, which specifically comprises the following two steps: [0124] (2.1) Expanding (anti-HER2 scFV)-(CD8? hinge) using primers F1 and R1; and expanding (RD-1TM+Cytoplasmic)-(CD3?) using primers F2 and R2; [0125] (2.2) Using (anti-HER2 scFV)-(CD8? hinge) and (RD-1TM+Cytoplasmic)-(CD3?) as templates and using F1 and R2 as primers to obtain full-length CAR genes by PCR. [0126] (3) Step 3, using Mlu I and Spe I as restriction sites to connect the CAR genes synthesized by the above steps with a PCLK vector, and thus to obtain a CAR-PCLK plasmid vector.
Virus Transfection of T Lymphocyte and Expression Assay of Target Genes:
[0127] (1) Loading novel 2nd generation CAR genes (anti-HER2 scFV)-(CD8? hinge)-(RD-1TM+Cytoplasmic)-(CD3?) with chimeric antigen receptor genes (the structural schematic diagram is shown in
[0130]
[0131]
[0132] It is confirmed by flow cytometry assays that both novel and conventional 2nd generation CAR molecules are efficiently expressed on surface of lymphocytes under the same MOI (multiplicity of infection) virus transfection effect.
Killing Effect on Tumor Cells Expressing HER2:
[0133] Conventional 2nd generation CAR-T cells: (anti-HER2 scFV)-(CD8? hinge+TM)-(4-1BB)-(CD3?)-T cells
[0134] Novel 2nd generation CAR-T cells: (anti-HER2 scFV)-(CD8? hinge)-(RD-ITM+Cytoplasmic)-(CD3?)-T cells [0135] (1) Respectively measuring the killing effect of the two kinds of T cells on HER2 positive tumor cells SKOV3 (human ovarian cancer cells) by RTCA (RealTime Cellular Analysis), and the measurement results are shown in
CONCLUSION
[0137] A typical CAR mainly consists of three key components, including a single-chain fragment variable (scFv) to recognize antigen, a hinge and transmembrane domain (TM), such as CD3, CD28 or CD8 protein, and intracellular signaling domains (ICDs), such as CD3? or FcR?. The CAR includes one or more intracellular costimulatory signaling domains, such as CD28, 4-1BB, CD27, OX40, ICOS, DAP10, IL-15R?, MyD88/CD40 and TLR2, to transmit activation signals.
[0138] It has been showed that different TMs and/or ICDs affect T cell expansion, persistence and other functions. Recently, several 2nd generation CARs have been tested in patients with solid tumors, such as metastatic colorectal cancers and sarcomas. The results from these trials were far from exciting compared with that achieved in treating hematological malignancies. Therefore, exploring different costimulatory domains may provide a new approach to improve antitumor effects of CAR-T cells in the solid tumors.
[0139] In the present invention, CD19 or HER2-targeting scFv domains were coupled to 4-1BB or dectin-1 signaling ICDs by our experiment team to construct four different 2nd generation CARs. Experiment data revealed that the novel CAR design influenced T cell functions through dectin-1 costimulation in both in vitro and in vivo experiments, such as enhanced cytokine secretion and lytic capacity, reduced exhaustion potential, and increased cell expansion and distinct antitumor activity.
[0140] In the present invention, we confirmed previous study results showing enhanced CAR-T cell functions with 4-1BB costimulatory signaling domains. Interestingly, in vitro T cell functions (e.g. increased cytokine production) of the hHD-Dz CAR-T cells are comparable to the 4-1BB based, and both are superior to the mock T cells. As to the HER2 specific CAR-T cells, the IFN-? secretion of the hHD-Dz CAR-T cells was higher than the hH8-BBz, suggesting possible predominantly Th1 phenotype; while the Hh8-bbz CAR-T cells released more TNF-?, consistent with Th1/Th2 phenotype. Similar cytokine production pattern by the anti-CD19 CAR-T cells indicated comparable phenotype irrespective to the specific costimulatory signaling domain employed. In the RTCA (real-time cytotoxicity assays), we illustrated the cytotoxic ability of the hHD-Dz CAR-T cells, superior to the hH8-BBz CAR-T cells. The above results may suggest that the dectin-1 costimulation provides a new mechanistic approach in CAR-T cell immunotherapy in treating solid tumors.
[0141] Due to the immune resistance and T cell exhaustion, one of the biggest challenges in CAR-T cell therapy for solid tumors is the inhibition of tumor microenvironment. However, it has been shown in studies that different T cell phenotype may play an important role in the antitumor immunity, for example, T.sub.CM cells are more important than T.sub.EM cells in the adoptive immunotherapies. In the present invention, we have found that more T.sub.CM and distinct exhaustion marker expression in the hHD-Dz CAR-T cells may suggest that the new CAR-T cells can be less influenced by the tumor immunosuppressive microenvironment through the dectin-1 costimulatory signaling in the solid tumors.
[0142] In addition, we demonstrated the distinct antitumor effects of the 2nd generation CAR-T cells through either dectin-1 or 4-1BB costimulation in the established tumor xenograft model. However, the CARs with the different costimulatory signaling domains here showed discrete antitumor activity trend on in vivo survival rate. The hHD-Dz CAR-T cells showed increased effector functions at early time points, and the hH8-BBz CAR-T cells demonstrated a later antitumor activity. These observations suggested that different costimulatory signaling domains may result in distinct T cell phenotype.
[0143] The embodiments of the present invention are described above in combination with drawings, but the present invention is not limited to the aforementioned specific embodiments. The aforementioned embodiments are merely illustrative and not limiting. For those of ordinary skill in the art, many forms can be made under the teaching of present invention without departing from the spirit of the present invention and the scope of the claims, all of which shall fall within the protection scope of the present invention.
REFERENCE
[0144] Kochenderfer J N, Dudley M E, Kassim S H, Somerville R P, Carpenter R O, Stetler-Stevenson M, etal. Chemotherapy-refractory diffuse large B-cell lymphoma and indolent B-cell malignancies can be effectively treated with autologous T cells expressing an anti-CD19 chimeric antigen receptor. Journal of clinical oncology: official journal of the American Society of Clinical Oncology 2015, 33(6): 540-549. [0145] Chimeric Antigen Receptor-Modified T Cells in Chronic Lymphoid Leukemia; Chimeric Antigen Receptor-Modified T Cells for Acute Lymphoid Leukemia; Chimeric Antigen Receptor T Cells for Sustained Remissions in Leukemia. The New England journal of medicine 2016, 374(10): 998. [0146] Elsallab M, Levine B L, Wayne A S, Abou-El-Enein M. CAR T-cell product performance in haematological malignancies before and after marketing authorisation. The LancetOncology 2020, 21(2): e104-el16. [0147] Cohen A D, Garfall A L, Stadtmauer E A, Melenhorst J J, Lacey S F, Lancaster E, et al. B cell maturation antigen-specific CAR T cells are clinically active in multiple myeloma. The Journal of clinical investigation 2019, 129(6): 2210-2221. [0148] Raje N, Berdeja J, Lin Y, Siegel D, Jagannath S, Madduri D, et al. Anti-BCMA CART-Cell Therapy bb2121 in Relapsed or Refractory Multiple Myeloma. The NewEngland journal of medicine 2019, 380(18): 1726-1737. [0149] Yan Z, Cao J, Cheng H, Qiao J, Zhang H, Wang Y, et al. A combination of humanizedanti-CD19 and anti-BCMA CAR T cells in patients with relapsed or refractory multiple myeloma: a single-arm, phase 2 trial. The Lancet Haematology 2019, 6(10):e521-e529. [0150] Neelapu S S, Locke F L, Bartlett N L, Lekakis L J, Miklos D B, Jacobson C A, et al. Axicabtagene Ciloleucel CAR T-Cell Therapy in Refractory Large B-Cell Lymphoma. The New England journal of medicine 2017, 377(26): 2531-2544. [0151] Schuster S J, Svoboda J, Chong E A, Nasta S D, Mato A R, Anak O, et al. Chimeric Antigen Receptor T Cells in Refractory B-Cell Lymphomas. The New England journal of medicine 2017, 377(26): 2545-2554. [0152] Locke F L, Ghobadi A, Jacobson C A, Miklos D B, Lekakis L J, Oluwole O O, et al. Long-term safety and activity of axicabtagene ciloleucel in refractory large B-cell lymphoma (ZUMA-1): a single-arm, multicentre, phase 1-2 trial. The Lancet Oncology 2018. [0153] Locke F L, Ghobadi A, Jacobson C A, Miklos D B, Lekakis L J, Oluwole O O, et al. Long-term safety and activity of axicabtagene ciloleucel in refractory large B-cell lymphoma (ZUMA-1): a single-arm, multicentre, phase 1-2 trial. The Lancet Oncology 2019, 20(1): 31-42. [0154] Yu S, Li A, Liu Q, Li T, Yuan X, Han X, et al. Chimeric antigen receptor T cells: a novel therapy for solid tumors. Journal of hematology & oncology 2017, 10(1): 78. [0155] Wang Y, Luo F, Yang J, Zhao C, Chu Y. New Chimeric Antigen Receptor Design for Solid Tumors. Frontiers in immunology 2017, 8: 1934. [0156] Robbins P F, Dudley M E, Wunderlich J, El-Gamil M, Li Y F, Zhou J, et al. Cutting edge: persistence of transferred lymphocyte clonotypes correlates with cancer regression inpatients receiving cell transfer therapy. Journal of immunology 2004, 173(12):7125-7130. [0157] Ying Z, Huang X F, Xiang X, Liu Y, Kang X, Song Y, et al. A safe and potent anti-CD19CAR T cell therapy. Nature medicine 2019, 25(6): 947-953. [0158] Long A H, Haso W M, Shern J F, Wanhainen K M, Murgai M, Ingaramo M, et al. 4-1BBcostimulation ameliorates T cell exhaustion induced by tonic signaling of chimeric antigen receptors. Nature medicine 2015, 21(6): 581-590. [0159] Zimara N, Chanyalew M, Aseffa A, van Zandbergen G, Lepenies B, Schmid M, et al. Dectin-1 Positive Dendritic Cells Expand after Infection with Leishmania major Parasites and Represent Promising Targets for Vaccine Development. Frontiers inimmunology 2018, 9: 263. [0160] Ariizumi K, Shen G L, Shikano S, Xu S, Ritter R, 3rd, Kumamoto T, et al. [0161] Identification of a novel, dendritic cell-associated molecule, dectin-1, by subtractive cDNA cloning. The Journal of biological chemistry 2000, 275(26): 20157-20167. [0162] Taylor P R, Brown G D, Reid D M, Willment J A, Martinez-Pomares L, Gordon S, et al. The beta-glucan receptor, dectin-1, is predominantly expressed on the surface of cells of the monocyte/macrophage and neutrophil lineages. Journal of immunology 2002,169(7): 3876-3882. [0163] Adams E L, Rice P J, Graves B, Ensley H E, Yu H, Brown G D, et al. Differential high-affinity interaction of dectin-1 with natural or synthetic glucans is dependent upon primary structure and is influenced by polymer chain length and side-chain branching. The Journal of pharmacology and experimental therapeutics 2008, 325(1): 115-123. [0164] Kochenderfer J N, Feldman S A, Zhao Y, Xu H, Black M A, Morgan R A, et al. Construction and preclinical evaluation of an anti-CD19 chimeric antigen receptor. Journal of immunotherapy 2009, 32(7): 689-702. [0165] Kochenderfer J N, Dudley M E, Feldman S A, Wilson W H, SpanerDE, Maric I, et al. B-cell depletion and remissions of malignancy along with cytokine-associated toxicity in a clinical trial of anti-CD19 chimeric-antigen-receptor-transduced T cells. Blood 2012, 119(12): 2709-2720. [0166] Carter P, Presta L, Gorman C M, Ridgway J B, Henner D, Wong W L, et al. Humanization of an anti-p185HER2 antibody for human cancer therapy. Proceedings of the National Academy of Sciences of the United States of America 1992, 89(10): 4285-4289. [0167] Huang Y, Li D, Zhang P F, Liu M, Liang X, Yang X, et al. IL-18R-dependent and independent pathways account for IL-18-enhanced antitumor ability of CAR-T cells. FASEB journal: official publication of the Federation of American Societies for Experimental Biology 2020, 34(1): 1768-1782. [0168] Cerignoli F, Abassi Y A, Lamarche B J, Guenther G, Santa Ana D, Guimet D, et al. In vitro immunotherapy potency assays using real-time cell analysis. PloS one 2018, 13(3): e0193498. [0169] Geijtenbeek T B, Gringhuis S I. Signalling through C-type lectin receptors: shaping immune responses. Nature reviews Immunology 2009, 9(7): 465-479. [0170] Li D, Li X, Zhou W L, Huang Y, Liang X, Jiang L, et al. Genetically engineered T cells for cancer immunotherapy. Signal transduction and targeted therapy 2019, 4: 35. [0171] Ying Z, He T, Wang X, Zheng W, Lin N, Tu M, et al. Parallel Comparison of 4-1BB or CD28 Co-stimulated CD19-Targeted CAR-T Cells for B Cell Non-Hodgkin's Lymphoma. Molecular therapy oncolytics 2019, 15: 60-68. [0172] Li S, Tao Z, Xu Y, Liu J, An N, Wang Y, et al. CD33-Specific Chimeric Antigen Receptor T Cells with Different Co-Stimulators Showed Potent Anti-Leukemia Efficacy and Different Phenotype. Human gene therapy 2018, 29(5): 626-639. [0173] Xia A L, Wang X C, Lu Y J, Lu X J, Sun B. Chimeric-antigen receptor T (CAR-T) cell therapy for solid tumors: challenges and opportunities. Oncotarget 2017, 8(52):90521-90531. [0174] Sadelain M, Brentjens R, Riviere I. The basic principles of chimeric antigen receptor design. Cancer discovery 2013, 3(4): 388-398. [0175] Zolov S N, Rietberg S P, Bonifant C L. Programmed cell death protein 1 activation preferentially inhibits CD28.CAR-T cells. Cytotherapy 2018, 20(10): 1259-1266. [0176] Li G, Boucher J C, Kotani H, Park K, Zhang Y, Shrestha B, et al. 4-1BB enhancement of CAR T function requires NF-kappaB and TRAFs. JCI insight 2018, 3(18). [0177] Kowolik C M, Topp M S, Gonzalez S, Pfeiffer T, Olivares S, Gonzalez N, et al. CD28costimulation provided through a CD19-specific chimeric antigen receptor enhances in vivo persistence and antitumor efficacy of adoptively transferred T cells. Cancer research 2006, 66(22): 10995-11004. [0178] Zhang J P, Zhang R, Tsao S T, Liu Y C, Chen X, Lu D P, et al. Sequential allogeneic and autologous CAR-T-cell therapy to treat an immune-compromised leukemic patient. Blood advances 2018, 2(14): 1691-1695. [0179] Hombach A A, Heiders J, Foppe M, Chmielewski M, Abken H. OX40 costimulation by a chimeric antigen receptor abrogates CD28 and IL-2 induced IL-10 secretion by redirected CD4(+) T cells. Oncoimmunology 2012, 1(4): 458-466. [0180] Shen C J, Yang Y X, Han E Q, Cao N, Wang Y F, Wang Y, et al. Chimeric antigen receptor comprising ICOS signaling domain mediates specific and efficient antitumor effect of T cells against EGFRvIII expressing glioma. Journal of hematology & oncology 2013, 6: 33. [0181] Lonez C, Verma B, Hendlisz A, Aftimos P, Awada A, Van Den Neste E, et al. Study protocol for THINK: a multinational open-label phase I study to assess the safety and clinical activity of multiple administrations of NKR-2 in patients with different metastatic tumour types. BMJ open 2017, 7(11): e017075. [0182] Nair S, Wang J B, Tsao S T, Liu Y, Zhu W, Slayton W B, et al. Functional Improvement of Chimeric Antigen Receptor Through Intrinsic Interleukin-15Ralpha Signaling. Current gene therapy 2018. [0183] Mata M, Gerken C, Nguyen P, Krenciute G, Spencer D M, Gottschalk S. Inducible Activation of MyD88 and CD40 in CAR T Cells Results in Controllable and Potent Antitumor Activity in Preclinical Solid Tumor Models. Cancer discovery 2017, 7(11): 1306-1319. [0184] Lai Y, Weng J, Wei X, Qin L, Lai P, Zhao R, et al. Toll-like receptor 2 costimulation potentiates the antitumor efficacy of CAR T Cells. Leukemia 2018, 32(3): 801-808. [0185] Cheng Z, Wei R, Ma Q, Shi L, He F, Shi Z, et al. In Vivo Expansion and Antitumor Activity of Coinfused CD28- and 4-1BB-Engineered CAR-T Cells in Patients with B Cell Leukemia. Molecular therapy: the journal of the American Society of Gene Therapy 2018, 26(4): 976-985. [0186] Zhang C C, Wang Z, Yang Z, Wang M L, Li S Q, Li Y Y, et al. Phase I Escalating-Dose Trial of CAR-T Therapy Targeting CEA(+) Metastatic Colorectal Cancers. Molecular Therapy 2017, 25(5): 1248-1258. [0187] Ahmed N, Brawley V S, Hegde M, Robertson C, Ghazi A, Gerken C, et al. Human Epidermal Growth Factor Receptor 2 (HER2)-Specific Chimeric Antigen Receptor-Modified T Cells for the Immunotherapy of HER2-Positive Sarcoma. Journal of clinical oncology: official journal of the American Society of Clinical Oncology 2015, 33(15): 1688-1696. [0188] Garfall A L, Maus M V, Hwang W T, Lacey S F, Mahnke Y D, Melenhorst J J, et al. Chimeric Antigen Receptor T Cells against CD19 for Multiple Myeloma. The NewEngland journal of medicine 2015,373(11): 1040-1047. [0189] Wei G, Ding L, Wang J, Hu Y, Huang H. Advances of CD19-directed chimeric antigen receptor-modified T cells in refractory/relapsed acute lymphoblastic leukemia. Experimental hematology & oncology 2017, 6: 10. [0190] Sadelain M, Riviere I, Riddell S. Therapeutic T cell engineering. Nature 2017,545(7655): 423-431. [0191] Brown G D, Willment J A, Whitehead L. C-type lectins in immunity and homeostasis. Nature reviews Immunology 2018, 18(6): 374-389. [0192] Kumaresan P R, Manuri P R, Albert N D, Maiti S, Singh H, MIT, et al. Bioengineering Tcells to target carbohydrate to treat opportunistic fungal infection. Proceedings of the National Academy of Sciences of the U.S. Pat. No. 2,014,111(29):10660-10665. [0193] Brown G D, Crocker P R. Lectin Receptors Expressed on Myeloid Cells. Microbiologyspectrum 2016, 4(5). [0194] Chiba S, Ikushima H, Ueki H, Yanai H, Kimura Y, Hangai S, et al. Recognition of tumor cells by Dectin-1 orchestrates innate immune cells for anti-tumor responses. eLife 2014, 3: e04177. [0195] Kaisar M M M, Ritter M, Del Fresno C, Jonasdottir H S, van der Ham A J, Pelgrom L R, etal. Dectin-1/2-induced autocrine PGE2 signaling licenses dendritic cells to prime Th2responses. PLOS biology 2018, 16(4): e2005504. [0196] Zhao Y, Chu X, Chen J, Wang Y, Gao S, Jiang Y, et al. Dectin-1-activated dendritic cells trigger potent antitumour immunity through the induction of Th9 cells. Nature communications 2016, 7: 12368. [0197] Rimawi M F, Schiff R, Osborne C K. Targeting HER2 for the treatment of breast cancer. Annual review of medicine 2015, 66: 111-128. [0198] Mardiana S, John L B, Henderson M A, Slaney C Y, von Scheidt B, Giuffrida L, et al. A Multifunctional Role for Adjuvant Anti-4-1BB Therapy in Augmenting Antitumor Response by Chimeric Antigen Receptor T Cells. Cancer research 2017, 77(6): 1296-1309. [0199] Chacon J A, Wu R C, Sukhumalchandra P, Molldrem J J, Sarnaik A, Pilon-Thomas S, etal. Co-stimulation through 4-1B B/CD137 improves the expansion and function of CD8(+) melanoma tumor-infiltrating lymphocytes for adoptive T-cell therapy. PloS one 2013, 8(4): e60031. [0200] Abken H. Driving CARs on the Highway to Solid Cancer: Some Considerations on the Adoptive Therapy with CAR T Cells. Human gene therapy 2017, 28(11): 1047-1060. [0201] Bagley S J, O'Rourke D M. Clinical investigation of CAR T cells for solid tumors: Lessons learned and future directions. Pharmacology & therapeutics 2019: 107419. [0202] Klebanoff C A, Gattinoni L, Torabi-Parizi P, Kerstann K, Cardones A R, Finkelstein S E, et al. Central memory self/tumor-reactive CD8+ T cells confer superior antitumor immunity compared with effector memory T cells. Proceedings of the National Academy of Sciences of the U.S. Pat. No. 2,005,102(27): 9571-9576. [0203] Ma Q, Gomes E M, Lo A S, Junghans R P. Advanced generation anti-prostate specific membrane antigen designer T cells for prostate cancer immunotherapy. The Prostate 2014, 74(3): 286-296. [0204] Till B G, Jensen M C, Wang J, Chen E Y, Wood B L, Greisman H A, et al. Adoptive immunotherapy for indolent non-Hodgkin lymphoma and mantle cell lymphoma using genetically modified autologous CD20-specific T cells. Blood 2008, 112(6):2261-2271. [0205] Till B G, Jensen M C, Wang J, Qian X, Gopal A K, Maloney D G, et al. CD20-specific adoptive immunotherapy for lymphoma using a chimeric antigen receptor with both CD28 and 4-1BB domains: pilot clinical trial results. Blood 2012, 119(17): 3940-3950. [0206] Muranski P, Borman Z A, Kerkar S P, Klebanoff C A, Ji Y, Sanchez-Perez L, et al. Th17cells are long lived and retain a stem cell-like molecular signature. Immunity 2011, 35(6): 972-985. [0207] Zhang P F, Huang Y, Liang X, Li D, Jiang L, Yang X, et al. Enhancement of the antitumor effect of HER2-directed CAR-T cells through blocking epithelial-mesenchymal transition in tumor cells. FASEB journal: official publication of the Federation of American Societies for Experimental Biology 2020, 34(8): 11185-11199. [0208] Gattinoni L, Lugli E, Ji Y, Pos Z, Paulos C M, Quigley M F, et al. A human memory Tcell subset with stem cell-like properties. Nature medicine 2011, 17(10): 1290-1297.