SMALL MOLECULE INHIBITORS OF KRAS G12C MUTANT

Abstract

Compounds of Formula (I) or (Ia) or their pharmaceutically acceptable salts can inhibit the G12C mutant of Kirsten rat sarcoma (KRAS) protein and are expected to have utility as therapeutic agents, for example, for treating cancer. The disclosure also provides pharmaceutical compositions which comprise compounds of Formula (I) or (Ia) or pharmaceutically acceptable salts thereof. The disclosure also relates to methods for use of the compounds or their pharmaceutically acceptable salts in the therapy and prophylaxis of cancer and for preparing pharmaceuticals for this purpose.

Claims

1. A compound of the Formula (I) ##STR00579## wherein: R.sup.1 is selected from the group consisting of H and C.sub.1-C.sub.6 alkyl; R.sup.2 and R.sup.3 are independently selected from the group consisting of: (i) H; (ii) C.sub.1-C.sub.6 alkyl, wherein the C.sub.1-C.sub.6 alkyl is unsubstituted or substituted by 1 to 2 R.sup.a substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkoxy, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkylsulfonyl, C.sub.2-C.sub.4 acyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxycarbonyl, C.sub.1-C.sub.3 hydroxycarbonyl, oxo (?O), C.sub.3-C.sub.8 cycloalkyl, and 4- to 10-membered mono- or bicyclic heterocycloalkyl; wherein the C.sub.3-C.sub.8 cycloalkyl or the 4- to 10-membered mono- or bicyclic heterocycloalkyl of R.sup.a is unsubstituted or substituted by 1 to 2 substituents selected from the group consisting of halo, hydroxy, amino, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, and C.sub.1-C.sub.3 alkoxy; and (iii) a 3- to 8-membered monocyclic, bridged bicyclic, or spirocyclic saturated ring system containing 0 to 2 heteroatom groups selected from the group consisting of N, O, S, S(O), S(O).sub.2, P, P(O), and P(O).sub.2; wherein the 3- to 8-membered monocyclic, bridged bicyclic, or spirocyclic saturated ring system is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkylsulfonyl, C.sub.2-C.sub.4 acyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, carboxy, and C.sub.1-C.sub.3 alkoxycarbonyl; or alternatively, R.sup.2 and R.sup.3 together with the N atom to which they are attached form a 4- to 9-membered monocyclic, fused bicyclic, bridged bicyclic, or spirocyclic saturated ring system containing 0 to 2 additional heteroatoms selected from the group consisting of N, O, and S; wherein the 4- to 9-membered monocyclic, fused bicyclic, bridged bicyclic, or spirocyclic saturated ring system is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.4 hydroxyalkyl, C.sub.3-C.sub.5 hydroxycycloalkyl, (CH.sub.3).sub.2N(C?O)CH.sub.2, CH.sub.3(C?O)NHCH.sub.2, and C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl; or alternatively, one of R.sup.2 and R.sup.3 together with the N atom to which it is attached and an adjacent C atom form a 3- to 6-membered monocyclic saturated ring system containing 0 to 2 additional heteroatoms selected from the group consisting of N, O, and S; wherein the 3- to 6-membered monocyclic saturated ring system is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 hydroxyalkyl, and C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl; at each occurrence R.sup.4 is independently selected from the group consisting of halo, cyano, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, and C.sub.1-C.sub.4 cyanoalkyl; E.sup.1, E.sup.2, E.sup.3, and E.sup.4 are independently selected from the group consisting of N and C, with the proviso that no more than three of E.sup.1, E.sup.2, E.sup.3, and E.sup.4 are N; one of B.sup.1 and B.sup.3 is C and the other is N; B.sup.2 is N or C(R.sup.B), wherein R.sup.B is selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl and C.sub.3-C.sub.6 cycloalkyl; at each occurrence R.sup.L is independently selected from the group consisting of fluoro, hydroxy, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 fluoroalkyl, oxo (?O), C.sub.2-C.sub.4 acyl, and methenyl (?CH.sub.2), or alternatively, two geminally substituted R.sup.L substituents together with the carbon atom to which they are attached form a 3- to 6-membered spirocyclic ring containing 0 to 1 heteroatoms selecting from the group consisting of N, O, and S; ring A.sup.a is present or absent, and if present, is a 5- to 6-membered heteroaryl containing 1 to 3 heteroatoms selected from the group consisting of N, O, and S; X.sup.1, X.sup.2, X.sup.3, X.sup.4, and X.sup.5 are independently selected from the group consisting of N and C, with the proviso that no more than two of X.sup.1, X.sup.2, X.sup.3, X.sup.4, and X.sup.5 are N; at each occurrence R.sup.5 is independently selected from the group consisting of C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 acyl, halo, hydroxy, amino, cyano, oxo (?O), C.sub.1-C.sub.4 cyanoalkyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, and a group of the formula ##STR00580## at each occurrence R.sup.6 is independently selected from the group consisting of C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, halo, hydroxy, oxo (?O), cyano, carbamoyl, C.sub.1-C.sub.4 cyanoalkyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, C.sub.3-C.sub.6 cycloalkyl, and C.sub.1-C.sub.4 carbamoylalkyl; each occurrence of R.sup.7 is independently selected from the group consisting of halo, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, and C.sub.1-C.sub.3 alkoxy; A.sup.1 is selected from the group consisting of CH.sub.2, CH.sub.2N(R.sup.L), C(?O)N(R.sup.L), CH.sub.2O, C(H)(R.sup.L), N(H), N(R.sup.L), S, S(?O), and O; Z is selected from the group consisting of H and halo; subscript m is 0, 1, 2, or 3; subscript n is 0, 1, 2, or 3; subscript p is 0, 1, 2, 3, or 4; subscript q is 0, 1, 2, or 3; subscript r is 0, 1, 2, or 3; and subscript s is 0, 1, 2, or 3, or a pharmaceutically acceptable salt thereof.

2. The compound of claim 1 or the pharmaceutically acceptable salt thereof, wherein: the C.sub.1-C.sub.6 alkyl is unsubstituted or substituted by 1 to 2 R.sup.a substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkoxy, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkylsulfonyl, C.sub.2-C.sub.4 acyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxycarbonyl, C.sub.1-C.sub.3 hydroxycarbonyl, C.sub.3-C.sub.8 cycloalkyl, and 4- to 10-membered mono- or bicyclic heterocycloalkyl; R.sup.2 and R.sup.3 together with the N atom to which they are attached form the 4- to 8-membered saturated heterocycloalkyl having 0 to 2 additional heteroatoms selected from the group consisting of N, O, and S; wherein the 4- to 8-membered heterocycloalkyl is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 hydroxyalkyl, and C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl; at each occurrence R.sup.L is independently selected from the group consisting of fluoro, hydroxy, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 fluoroalkyl, oxo (?O), and methenyl (?CH.sub.2), the ring A.sup.a is present or absent, and if present, is the 5- to 6-membered heteroaryl containing 1 to 2 heteroatoms selected from the group consisting of N, O, and S; at each occurrence R.sup.5 is independently selected from the group consisting of C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 acyl, halo, hydroxy, amino, cyano, oxo (?O), C.sub.1-C.sub.4 cyanoalkyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, and the group of the formula ##STR00581## at each occurrence R.sup.6 is independently selected from the group consisting of C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, halo, hydroxy, oxo (?O), cyano, carbamoyl, C.sub.1-C.sub.4 cyanoalkyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, and C.sub.1-C.sub.4 carbamoylalkyl; A.sup.1 is selected from the group consisting of CH.sub.2, C(H)(R.sup.L), N(H), N(R.sup.L), and O; Z is H; and subscript q is 0, 1, or 2.

3. The compound of claim 1 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00582##

4. The compound of claim 3 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00583##

5. The compound of claim 4 or the pharmaceutically acceptable salt thereof, wherein R.sup.B is H or methyl, and the subscript s is 0.

6. The compound of claim 1 or the pharmaceutically acceptable salt thereof, wherein: X.sup.1 is N or C; and X.sup.2, X.sup.3, X.sup.4, and X.sup.5 are C.

7. The compound of claim 1 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00584##

8. The compound of claim 7 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00585##

9. The compound of claim 7 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00586## R.sup.5 is C.sub.1-C.sub.3 alkyl or C.sub.1-C.sub.3 fluoroalkyl; and R.sup.6 is C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, or C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl.

10. The compound of claim 1 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00587##

11. The compound of claim 1 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00588##

12. The compound of claim 10 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00589##

13. The compound of claim 12 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00590##

14. The compound of claim 1 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00591##

15. The compound of claim 1 or the pharmaceutically acceptable salt thereof, wherein R.sup.2 and R.sup.3 are independently H, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.6 fluoroalkyl.

16. The compound of claim 14 or the pharmaceutically acceptable salt thereof, wherein the group ##STR00592##

17. The compound of claim 1 or the pharmaceutically acceptable salt thereof, wherein: (i) the group is ##STR00593## and R.sup.B is H and the subscript s is 0; (ii) the group is ##STR00594## wherein R.sup.5 and R.sup.6 are independently C.sub.1-C.sub.3 alkyl or C.sub.1-C.sub.3 fluoroalkyl; (iii) the group is ##STR00595## (iv) the group ##STR00596## and (v) the group ##STR00597##

18. The compound or the pharmaceutically acceptable salt thereof of claim 1 selected from Examples 1-300.

19. A pharmaceutical composition comprising the compound of claim 1, or the pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable carrier.

20. A pharmaceutical composition comprising the compound of claim 1, or the pharmaceutically acceptable salt thereof, an additional anti-cancer agent, and a pharmaceutically acceptable carrier.

21. A method of inhibiting KRAS G12C protein comprising contacting KRAS G12C protein with the compound of claim 1, or the pharmaceutically acceptable salt thereof, to inhibit the activity of the KRAS G12C protein.

22. A method of treating cancer comprising administering a therapeutically effective amount of the compound of claim 1, or the pharmaceutically acceptable salt thereof, to a subject in need of such treatment.

23. The method of claim 22, further comprising administering an additional active agent to the subject.

24.-30. (canceled)

Description

DETAILED DESCRIPTION OF THE INVENTION

Compounds of the Disclosure

[0009] In one embodiment, the present disclosure provides a compound having structural Formula (I), or a pharmaceutically acceptable salt thereof, as shown above, wherein: [0010] R.sup.1 is selected from the group consisting of H and C.sub.1-C.sub.6 alkyl; [0011] R.sup.2 and R.sup.3 are independently selected from the group consisting of: [0012] (i) H; [0013] (ii) C.sub.1-C.sub.6 alkyl, wherein the C.sub.1-C.sub.6 alkyl is unsubstituted or substituted by 1 to 2 R.sup.a substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkoxy, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkylsulfonyl, C.sub.2-C.sub.4 acyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxycarbonyl, C.sub.1-C.sub.3 hydroxycarbonyl, oxo (?O). C.sub.3-C.sub.8 cycloalkyl, and 4- to 10-membered mono- or bicyclic heterocycloalkyl; [0014] wherein the C.sub.3-C.sub.8 cycloalkyl or the 4- to 10-membered mono- or bicyclic heterocycloalkyl of R.sup.a is unsubstituted or substituted by 1 to 2 substituents selected from the group consisting of halo, hydroxy, amino, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, and C.sub.1-C.sub.3 alkoxy; and [0015] (iii) a 3- to 8-membered monocyclic, bridged bicyclic, or spirocyclic saturated ring system containing 0 to 2 heteroatom groups selected from the group consisting of N, O, S, S(O), S(O).sub.2, P, P(O), and P(O).sub.2; wherein the 3- to 8-membered monocyclic, bridged bicyclic, or spirocyclic saturated ring system is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkylsulfonyl, C.sub.2-C.sub.4 acyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, carboxy, and C.sub.1-C.sub.3 alkoxycarbonyl; or alternatively, R.sup.2 and R.sup.3 together with the N atom to which they are attached form a 4- to 9-membered monocyclic, fused bicyclic, bridged bicyclic, or spirocyclic saturated ring system containing 0 to 2 additional heteroatoms selected from the group consisting of N, O, and S; wherein the 4- to 9-membered monocyclic, fused bicyclic, bridged bicyclic, or spirocyclic saturated ring system is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.4 hydroxyalkyl, C.sub.3-C.sub.5 hydroxycycloalkyl, (CH.sub.3).sub.2N(C?O)CH.sub.2, CH.sub.3(C?O)NHCH.sub.2, and C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl; or alternatively, one of R.sup.2 and R.sup.3 together with the N atom to which it is attached and an adjacent C atom form a 3- to 6-membered monocyclic saturated ring system containing 0 to 2 additional heteroatoms selected from the group consisting of N, O, and S; wherein the 3- to 6-membered monocyclic saturated ring system is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 hydroxyalkyl, and C.sub.1-C.sub.3 alkoxy (C.sub.1-C.sub.3)alkyl; [0016] at each occurrence R.sup.4 is independently selected from the group consisting of halo, cyano, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, and C.sub.1-C.sub.4 cyanoalkyl; E.sup.1, E.sup.2, E.sup.3, and E.sup.4 are independently selected from the group consisting of N and C, with the proviso that no more than three of E.sup.1, E.sup.2, E.sup.3, and E.sup.4 are N; [0017] one of B.sup.1 and B.sup.3 is C and the other is N; [0018] B.sup.2 is N or C(R.sup.B), wherein R.sup.B is selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl and C.sub.3-C.sub.6 cycloalkyl; [0019] at each occurrence R.sup.L is independently selected from the group consisting of fluoro, hydroxy, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 fluoroalkyl, oxo (?O), C.sub.2-C.sub.4 acyl, and methenyl (?CH.sub.2), or [0020] alternatively, two geminally substituted R.sup.L substituents together with the carbon atom to which they are attached form a 3- to 6-membered spirocyclic ring containing 0 to 1 heteroatoms selecting from the group consisting of N, O, and S; [0021] ring A.sup.a is present or absent, and if present, is a 5- to 6-membered heteroaryl containing 1 to 3 heteroatoms selected from the group consisting of N, O, and S; [0022] X.sup.1, X.sup.2, X.sup.3, X.sup.4, and X.sup.5 are independently selected from the group consisting of N and C, with the proviso that no more than two of X.sup.1, X.sup.2, X.sup.3, X.sup.4, and X.sup.5 are N; [0023] at each occurrence R.sup.5 is independently selected from the group consisting of C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 acyl, halo, hydroxy, amino, cyano, oxo (?O), C.sub.1-C.sub.4 cyanoalkyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, and a group of the formula

##STR00002## [0024] at each occurrence R.sup.6 is independently selected from the group consisting of C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, halo, hydroxy, oxo (?O), cyano, carbamoyl, C.sub.1-C.sub.4 cyanoalkyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, C.sub.3-C.sub.6 cycloalkyl, and C.sub.1-C.sub.4 carbamoylalkyl; [0025] each occurrence of R.sup.7 is independently selected from the group consisting of halo, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, and C.sub.1-C.sub.3 alkoxy; [0026] A.sup.1 is selected from the group consisting of CH.sub.2, CH.sub.2N(R.sup.L), C(?O)N(R.sup.L), CH.sub.2O, C(H)(R.sup.L), N(H), N(R.sup.L), S, S(?O), and O; [0027] Z is selected from the group consisting of H and halo; [0028] subscript m is 0, 1, 2, or 3; [0029] subscript n is 0, 1, 2, or 3; [0030] subscript p is 0, 1, 2, 3, or 4; [0031] subscript q is 0, 1, 2, or 3; [0032] subscript r is 0, 1, 2, or 3; and [0033] subscript s is 0, 1, 2, or 3.

[0034] In one embodiment, the C.sub.1-C.sub.6 alkyl is unsubstituted or substituted by 1 to 2 R.sup.a substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkoxy, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkylsulfonyl, C.sub.2-C.sub.4 acyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxycarbonyl, C.sub.1-C.sub.3 hydroxycarbonyl, C.sub.3-C.sub.8 cycloalkyl, and 4- to 10-membered mono- or bicyclic heterocycloalkyl; R.sup.2 and R.sup.3 together with the N atom to which they are attached form the 4- to 8-membered saturated heterocycloalkyl having 0 to 2 additional heteroatoms selected from the group consisting of N, O, and S; wherein the 4- to 8-membered heterocycloalkyl is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 hydroxyalkyl, and C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl; at each occurrence R.sup.L is independently selected from the group consisting of fluoro, hydroxy, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 fluoroalkyl, oxo (?O), and methenyl (?CH.sub.2); the ring A.sup.a is present or absent, and if present, is the 5- to 6-membered heteroaryl containing 1 to 2 heteroatoms selected from the group consisting of N, O, and S; at each occurrence R.sup.5 is independently selected from the group consisting of C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 acyl, halo, hydroxy, amino, cyano, oxo (?O), C.sub.1-C.sub.4 cyanoalkyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, and the group of the formula

##STR00003##

at each occurrence R.sup.6 is independently selected from the group consisting of C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, halo, hydroxy, oxo (?O), cyano, carbamoyl, C.sub.1-C.sub.4 cyanoalkyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, and C.sub.1-C.sub.4 carbamoylalkyl; A.sup.1 is selected from the group consisting of CH.sub.2, C(H)(R.sup.L), N(H), N(R.sup.L), and O; Z is H; and subscript q is 0, 1, or 2.

[0035] In one embodiment, the present disclosure provides a compound having structural Formula (Ia), or a pharmaceutically acceptable salt thereof, as shown below,

##STR00004##

wherein: [0036] R.sup.1 is selected from the group consisting of H and C.sub.1-C.sub.6 alkyl; [0037] R.sup.2 and R.sup.3 are independently selected from the group consisting of: [0038] (i) H; [0039] (ii) C.sub.1-C.sub.6 alkyl, wherein the C.sub.1-C.sub.6 alkyl is unsubstituted or substituted by 1 to 2 R.sup.a substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkoxy, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkylsulfonyl, C.sub.2-C.sub.4 acyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxycarbonyl, C.sub.1-C.sub.3 hydroxycarbonyl, C.sub.3-C.sub.8 cycloalkyl, and 4- to 10-membered mono- or bicyclic heterocycloalkyl, wherein the C.sub.3-C.sub.8 cycloalkyl or the 4- to 10-membered mono- or bicyclic heterocycloalkyl of R.sup.a is unsubstituted or substituted by 1 to 2 substituents selected from the group consisting of halo, hydroxy, amino, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, and C.sub.1-C.sub.3 alkoxy; and [0040] (iii) a 3- to 8-membered monocyclic, bridged bicyclic, or spirocyclic saturated ring system containing 0 to 2 heteroatom groups selected from the group consisting of N, O, S, S(O), S(O).sub.2, P, P(O), and P(O).sub.2, wherein the 3- to 8-membered monocyclic, bridged bicyclic, or spirocyclic saturated ring system is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.1-C.sub.3alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkylsulfonyl, C.sub.2-C.sub.4 acyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, carboxy and C.sub.1-C.sub.3 alkoxycarbonyl, or alternatively, R.sup.2 and R.sup.3 together with the N atom to which they are attached form a 4- to 8-membered saturated heterocycloalkyl having 0 to 2 additional heteroatoms selected from the group consisting of N, O, and S, and wherein the 4- to 8-membered heterocycloalkyl is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 hydroxyalkyl, and C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl; [0041] at each occurrence R.sup.4 is independently selected from the group consisting of halo, cyano, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy and C.sub.1-C.sub.4 cyanoalkyl; E.sup.1, E.sup.2, E.sup.3, and E.sup.4 are independently selected from the group consisting of N and C, with the proviso that no more than three of E.sup.1, E.sup.2, E.sup.3, and E.sup.4 are N; one of B.sup.1 and B.sup.3 is C and the other is N, and B.sup.2 is N or C(R.sup.B), wherein R.sup.B is selected from the group consisting of H, C.sub.1-C.sub.6 alkyl, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl and C.sub.3-C.sub.6 cycloalkyl; [0042] at each occurrence R.sup.L is independently selected from the group consisting of fluoro, hydroxy, C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 fluoroalkyl, oxo (?O), and methenyl (?CH.sub.2), and alternatively, two geminally substituted R.sup.L substituents together with the carbon atom to which they are attached form a 3- to 6-membered spirocyclic ring containing 0 to 1 heteroatoms selected from the group consisting of N, O, and S; [0043] ring A.sup.a is present or absent, and if present, is a 5- to 6-membered heteroaryl containing 1 to 2 heteroatoms selected from the group consisting of N, O, and S; X.sup.1, X.sup.2, X.sup.3, X.sup.4, and X.sup.5 are independently selected from the group consisting of N and C, with the proviso that no more than two of X.sup.1, X.sup.2, X.sup.3, X.sup.4 and X.sup.5 are N; at each occurrence R.sup.5 is independently selected from the group consisting of C.sub.1-C.sub.6 alkyl, C.sub.1-C.sub.6 fluoroalkyl, C.sub.1-C.sub.1 alkoxy, C.sub.1-C.sub.3 acyl, halo, hydroxy, amino, cyano, oxo (?O), C.sub.1-C.sub.4 cyanoalkyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkoxy (C.sub.1-C.sub.3)alkyl, and a group of the formula

##STR00005## [0044] at each occurrence R.sup.6 is independently selected from the group consisting of C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, halo, hydroxy, oxo (?O), cyano, carbamoyl, C.sub.1-C.sub.4 cyanoalkyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, and C.sub.1-C.sub.4 carbamoylalkyl; [0045] at each occurrence R.sup.6 is independently selected from the group consisting of halo, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, and C.sub.1-C.sup.3 alkoxy; [0046] A.sup.1 is selected from the group consisting of CH.sub.2, C(H)(R.sup.L), N(H), N(R.sup.L), and O; [0047] subscript m is 0, 1, 2, or 3; [0048] subscript n is 0, 1, 2, or 3; [0049] subscript p is 0, 1, 2, 3, or 4; [0050] subscript q is 0, 1, or 2; [0051] subscript r is 0, 1, 2, or 3; and [0052] subscript s is 0, 1, 2, or 3.

[0053] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00006##

[0054] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00007##

[0055] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein R.sup.B is H or methyl, and the subscript s is 0.

[0056] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein X.sup.1 is N or C; and X.sup.2, X.sup.3, X.sup.4, and X.sup.5 are C.

[0057] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00008##

[0058] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00009##

[0059] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00010##

R.sup.5 is C.sub.1-C.sub.3 alkyl or C.sub.1-C.sub.3 fluoroalkyl; and R.sup.6 is C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, or C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl.

[0060] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00011##

[0061] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00012##

[0062] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00013##

[0063] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00014##

[0064] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00015##

[0065] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein R.sup.2 and R.sup.3 are independently H, C.sub.1-C.sub.6 alkyl, or C.sub.1-C.sub.6 fluoroalkyl.

[0066] In another embodiment, the present disclosure provides a compound of Formula (I) or (Ia), wherein the group

##STR00016##

[0067] In some embodiments, the present disclosure provides a compound of Formula (I) or (Ia), wherein: [0068] the group

##STR00017##

and R.sup.B is H and the subscript s is 0; [0069] the group

##STR00018##

wherein R.sup.5 and R.sup.6 are independently C.sub.1-C.sub.3 alkyl or C.sub.1-C.sub.3 fluoroalkyl; [0070] the group

##STR00019## [0071] the group

##STR00020##

and [0072] the group

##STR00021##

[0073] In specific embodiments, the present disclosure provides a compound or a pharmaceutically acceptable salt thereof as described in any one of Examples 1-300 as set forth below.

[0074] The present disclosure includes the pharmaceutically acceptable salts of the compounds defined herein, including the pharmaceutically acceptable salts of all structural formulas, embodiments and classes defined herein.

Definitions

[0075] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as is commonly understood by one of skill in the art to which this invention belongs.

[0076] As used throughout this disclosure, a compound of Formula (I) is to be understood to include a compound of Formula (I) or a pharmaceutically acceptable salt thereof. Likewise a compound of Formula (I), compound(s) disclosed herein, compound(s) described herein, compound(s) of the disclosure, etc., are used interchangeably and include both the compound, as well as a pharmaceutically acceptable salt thereof.

[0077] Alkyl, as well as other groups having the prefix alk, such as alkoxy, and the like, means carbon chains which may be linear or branched, or combinations thereof, containing the indicated number of carbon atoms. For instance, a C.sub.1-C.sub.6 alkyl means an alkyl group having one (i.e., methyl) up to 6 carbon atoms (i.e., hexyl). In particular embodiments, linear alkyl groups have 1-6 carbon atoms and branched alkyl groups have 3-7 carbon atoms. Examples of alkyl groups include methyl, ethyl, propyl, isopropyl, butyl, sed- and tert-butyl, pentyl, hexyl, heptyl, octyl, nonyl and the like.

[0078] Alkoxy and alkyl-O are used interchangeably and refer to an alkyl group linked to oxy gen.

[0079] Alkoxyalkyl means an alkoxy-alkyl group in which the alkoxy and alkyl groups are as previously defined. The bond to the parent moiety is through a carbon atom of the alkyl component. Non-limiting examples of suitable alkyoxyalkyl groups include methoxymethyl and methoxyethyl.

[0080] Alkoxycarbonyl means a carbonyl having an alkoxy group as previously defined, i.e., C(O)-alkoxy, Non-limiting examples of suitable alkoxycarbonyl groups include (C.sub.1-C.sub.10 alkoxy)carbonyl, such as methoxycarbonyl, ethoxycarbonyl, propoxycarbonyl, isopropoxycarbonyl, butoxycarbonyl, isobutoxycarbonyl, tert-butoxycarbonyl, pentyloxycarbonyl, isopentyloxycarbonyl, hexyloxycarbonyl, and tert-butoxycarbonyl.

[0081] Alkenyl means an aliphatic hydrocarbon group containing at least one carbon-carbon double bond and which may be straight or branched. Branched means that one or more alkyl groups such as methyl, ethyl or propyl, are attached to a linear alkenyl chain. Non-limiting examples of alkenyl groups include ethenyl, propenyl, n-butenyl, 3-methylbut-2-enyl, and n-pentenyl.

[0082] Alkynyl means an aliphatic hydrocarbon group containing at least one carbon-carbon triple bond and which may be straight or branched. Non-limiting examples include ethynyl, propynyl, and butynyl.

[0083] Arylcarbonyl means a carbonyl having an aromatic hydrocarbon ring including phenyl, naphthyl, tetrahydronaphthyl or anthracenyl, i.e., aryl-C(O). Non-limiting examples of suitable arylcarbonyl groups include phenylcarbonyl, naphthylcarbonyl, fluorenylcarbonyl, anthrylcarbonyl, biphenylylcarbonyl, tetrahydronaphthylcarbonyl, chromanylcarbonyl, 2,3-dihydro-1,4-dioxanaphthalenylcarbonyl, indanylcarbonyl, and phenanthrylcarbonyl

[0084] Acyl means an alkylcarbonyl as previously defined or arylcarbonyl as previously defined.

[0085] Aminoalkyl means -alkyl-NH.sub.2 group in which the alkyl is as previously defined. The bond to the parent moiety is through a carbon atom of the alkyl component. Non-limiting examples of suitable aminoalkyl groups include aminomethyl and aminoethyl. Alkylamino means NH-alkyl group in which the alkyl is as previously defined. The bond to the parent moiety is through the nitrogen of the amino component.

[0086] Alkylsulfonyl means an alkyl-SO.sub.2 group in which the alkyl group is previously defined. i.e., S(O).sub.2-alkyl. The bond to the parent moiety is through the sulfur atom of the sulfonyl moiety. Non-limiting examples of suitable alkylsulfonyl groups include methylsulfonyl and ethylsulfonyl.

[0087] Bicyclic ring system refers to two joined rings. The rings may be fused, i.e., share two adjacent atoms, bridged. i.e., share more than two adjacent atoms, or spirocyclic, i.e., share only a single atom.

[0088] Carbamoyl means a H.sub.2NC(O) group, which is the univalent group formed by loss of OH group of carbamic acid. The bond to the parent group is through the carbon atom of the carbonyl component.

[0089] Carbamoylalkyl means a carbamoyl-alkyl- group in which the carbamoyl and alkyl groups are previously defined. The bond to the parent moiety is through the alkyl group.

[0090] Cyanoalkyl means an -alkyl-CN group in which the alkyl is as previously defined. The bond to the parent moiety is through a carbon atom of the alky 1 component. Non-limiting examples of suitable cyanoalkyl groups include cyanomethyl and 3-cyanopropyl.

[0091] Cycloalkyl means a saturated cyclic hydrocarbon radical. In particular embodiments, the cycloalkyl group has 3-12 carbon atoms, forming 1-3 carbocyclic rings that are fused. Examples of cycloalkyl include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, adamantyl, and the like.

[0092] Dialkylamino means an alkylamino as previously defined, wherein the amino atom is substituted by two alkyl substituents, which substitutions can be the same or different, e.g., N(CH.sub.3).sub.2 or N(CH.sub.3)(CH.sub.2CH.sub.3).

[0093] Fluoroalkyl includes mono-substituted as well as multiple fluoro-substituted alkyl groups, up to perfluoro substituted alkyl. For example, fluoromethyl, 1,1-difluoroethyl, trifluoromethyl or 1,1,1,2,2-pentafluorobutyl are included.

[0094] Geminally means two substituents, which may be the same or different, substituted on one carbon.

[0095] Halogen or halo, unless otherwise indicated, includes fluorine (fluoro), chlorine (chloro), bromine (bromo) and iodine (iodo). In one embodiment, halo is fluoro (F) or chloro (Cl).

[0096] Heterocycloalkyl means a non-aromatic monocyclic, bicyclic or tricyclic ring system comprising about 3 to about 10 ring atoms, preferably about 5 to about 10 ring atoms, in which one or more of the atoms in the ring system is an element other than carbon, for example, nitrogen, oxygen, phosphorus or sulfur, alone or in combination. There are no adjacent oxygen and/or sulfur atoms present in the ring system. In some embodiments, heterocycloalkyls contain about 5 to about 6 ring atoms. The prefix aza, oxa, phospha or thia before the heterocyclyl root name means that at least a nitrogen, oxygen, phosphorus or sulfur atom respectively is present as a ring atom. In some embodiments, the nitrogen or sulfur atom of the heterocycloalkyl can be optionally oxidized to the corresponding N-oxide, S-oxide or S,S-dioxide. Non-limiting examples of suitable monocyclic heterocyclyl rings include piperidyl, pyrrolidinyl, piperazinyl, morpholinyl, thiomorpholinyl, thiazolidinyl, 1,4-dioxanyl, tetrahydrofuranyl, tetrahydrothiophenyl, phosphorinane, phosphinane, 1-oxophosphinan-1-ium and the like.

[0097] Heteroaryl refers to aromatic monocyclic, bicyclic and tricyclic ring structures in which one or more atoms in the ring, the heteroatom(s), is an element other than carbon. Heteroatoms are typically O, S, or N atoms. Examples of heteroaromatic groups include pyridinyl, pyrimidinyl, pyrrolyl, pyridazinyl, isoxazolyl, thiazolyl, oxazolyl, indolyl, benzoxazolyl, benzothiazolyl, and imidazolyl.

[0098] Hydroxyalkyl means a HO-alkyl- group in which alkyl is as previously defined. Preferred hydroxyalkyls contain lower alkyl. Non-limiting examples of suitable hydroxyalkyl groups include hydroxymethyl and 2-hydroxyethyl.

[0099] Hydroxycarbonyl means a HOC(O) group.

[0100] Hydroxycycloalkyl means a cycloalkyl substituted by one or more HO groups.

[0101] Oxo means a O? group.

[0102] When any variable (e.g., R.sup.4) occurs more than one time in any constituent or in Formula (I) or (Ia) or other generic formulas herein, its definition on each occurrence is independent of its definition at every other occurrence. Combinations of substituents and/or variables are permissible only if such combinations result in stable compounds. In choosing compounds of the present disclosure, one of ordinary skill in the art will recognize that the various substituents, e.g., R.sup.4 are to be chosen in conformity with well-known principles of chemical structure connectivity and stability. Unless expressly stated to the contrary, substitution by a named substituent is permitted on any atom in a ring (e.g., aryl, a heteroaryl ring, or a saturated heteroaryl ring) provided such ring substitution is chemically allowed and results in a stable compound. A stable compound is a compound which can be prepared and isolated and whose structure and properties remain or can be caused to remain essentially unchanged for a period of time sufficient to allow use of the compound for the purposes described herein (e.g., therapeutic or prophylactic administration to a subject).

[0103] The term substituted shall be deemed to include multiple degrees of substitution by a named substituent. Where multiple substituent moieties are disclosed or claimed, the substituted compound can be independently substituted by one or more of the disclosed or claimed substituent moieties, singly or plurally. By independently substituted, it is meant that the (two or more) substituents can be the same or different.

[0104] Unless expressly depicted or described otherwise, variables depicted in a structural formula with a floating bond, such as R.sup.4, are permitted on any available carbon atom in the ring to which the variable is attached. When a moiety is noted as being optionally substituted in Formula (I) or (Ia) or any embodiment thereof, it means that Formula (I) or (Ia) or the embodiment thereof encompasses compounds that contain the noted substituent (or substituents) on the moiety and also compounds that do not contain the noted substituent (or substituents) on the moiety.

[0105] The wavy line , used herein, indicates a point of attachment to the rest of the compound.

[0106] The compounds of Formula (I) or (Ia) may contain a terminal amine group covalently bonded to the (E)-but-2-enamide moiety and additionally substituted by R.sup.2 and R.sup.3.

[0107] In one embodiment, R.sup.2 and R.sup.3 can independently be H. In one embodiment, R.sup.2 and R.sup.3 can independently be a C.sub.1-C.sub.6 alkyl (e.g., Example 79). The C.sub.1-C.sub.6 alkyl is unsubstituted or substituted by 1 to 2 R.sup.a substituents independently selected from halo, hydroxy, C.sub.1-C.sub.3 alkoxy, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkylsulfonyl, C.sub.2-C.sub.4 acyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxycarbonyl, C.sub.1-C.sub.3 hydroxycarbonyl, oxo (?O), C.sub.3-C.sub.8 cycloalkyl, or 4- to 10-membered mono- or bicyclic heterocycloalkyl. The C.sub.3-C.sub.8 cycloalkyl or 4- to 10-membered mono- or bicyclic heterocycloalkyl of R.sup.a is unsubstituted or substituted by 1 to 2 substituents selected from the group consisting of halo, hydroxy, amino, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, and C.sub.1-C.sub.3 alkoxy. In one embodiment, R.sup.2 and R.sup.3 can independently be a 3- to 8-membered monocyclic (e.g., Example 51), bridged bicyclic (e.g., Example 73), or spirocyclic (e.g., Example 84) saturated ring system containing 0 to 2 heteroatom groups selected from the group consisting of N, O, S, S(O), S(O).sub.2, P, P(O), and P(O).sub.2. The 3- to 8-membered monocyclic, bridged bicyclic, or spirocyclic saturated ring system is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.2-C.sub.6 alkenyl, C.sub.2-C.sub.6 alkynyl, C.sub.1-C.sub.3 alkylamino, C.sub.1-C.sub.3 dialkylamino, C.sub.1-C.sub.3 alkylsulfonyl, C.sub.2-C.sub.4 acyl, C.sub.1-C.sub.3 hydroxyalkyl, C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl, carboxy, and C.sub.1-C.sub.3 alkoxycarbonyl.

[0108] In one embodiment, R.sup.2 and R.sup.3 together with the N atom to which they are attached form a 4- to 9-membered monocyclic (e.g., Example 114), fused bicyclic (e.g., Example 163), bridged bicyclic (e.g., Example 142), or spirocyclic (e.g., Example 253) saturated ring system containing 0 to 2 additional heteroatoms selected from the group consisting of N, O, and S, the 4- to 9-membered monocyclic, fused bicyclic, bridged bicyclic, or spirocyclic saturated ring system is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.4 hydroxyalkyl, C.sub.3-C.sub.5 hydroxycycloalkyl, (CH.sub.3).sub.2N(C?O)CH.sub.2, CH.sub.3(C?O)NHCH.sub.2, and C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl.

[0109] In one embodiment, one of R.sup.2 and R.sup.3 together with the N atom to which it is attached and an adjacent C atom form a 3- to 6-membered monocyclic saturated ring system containing 0 to 2 additional heteroatoms selected from the group consisting of N, O, and S (e.g., Example 250). The 3- to 6-membered monocyclic saturated ring system is unsubstituted or substituted by 1 to 4 substituents independently selected from the group consisting of halo, hydroxy, C.sub.1-C.sub.3 alkyl, C.sub.1-C.sub.3 fluoroalkyl, C.sub.1-C.sub.3 alkoxy, C.sub.1-C.sub.3 hydroxyalkyl, and C.sub.1-C.sub.3 alkoxy(C.sub.1-C.sub.3)alkyl.

[0110] The compounds of Formula (I) or (Ia) may contain one or more asymmetric centers and can thus occur as racemates and racemic mixtures, single enantiomers, diastereoisomeric mixtures and individual diastereoisomers. Centers of asymmetry that are present in the compounds of Formula (I) or (Ia) can all independently of one another have S configuration or R configuration. The compounds of Formula (I) or (Ia) include all possible enantiomers and diastereomers and mixtures of two or more stereoisomers, for example, mixtures of enantiomers and/or diastereomers, in all ratios. Thus, enantiomers are a subject of the disclosure in enantiomerically pure form, both as levorotatory and as dextrorotatory antipodes, in the form of racemates and in the form of mixtures of the two enantiomers in all ratios. In the case of a cis/trans isomerism, the disclosure includes both the cis form and the trans form as well as mixtures of these forms in all ratios. The present disclosure is meant to comprehend all such stereoisomeric forms of the compounds of Formula (I) or (Ia). Where a structural formula or chemical name specifies a particular configuration at a stereocenter, the enantiomer or stereoisomer of the compound resulting from that specified stereocenter is intended. Where a structural formula of the compounds of Formula (I) or (Ia) indicates a straight line at a chiral center, the structural formula includes both the S and R stereoisomers associated with the chiral center and mixtures thereof.

[0111] The compounds of Formula (I) or (Ia) may be separated into their individual diastereoisomers by, for example, fractional crystallization from a suitable solvent, for example, methanol or ethyl acetate or a mixture thereof, or via chiral chromatography using an optically active stationary phase. Absolute stereochemistry may be determined by X-ray crystallography of crystalline products or crystalline intermediates which are derivatized, if necessary, with a reagent containing an asymmetric center of known absolute configuration. Vibrational circular dichroism (VCD) may also be used to determine the absolute stereochemistry. Alternatively, any stereoisomer or isomers of the compounds of Formula (I) or (Ia) may be obtained by stereospecific synthesis using optically pure starting materials or reagents of known absolute configuration.

[0112] If desired, racemic mixtures of the compounds may be separated so that the individual enantiomers are isolated. The separation can be carried out by methods well known in the art, such as the coupling of a racemic mixture of compounds to an enantiomerically pure compound to form a diastereoisomeric mixture, followed by separation of the individual diastereoisomers by standard methods, such as fractional crystallization or chromatography. The coupling reaction is often the formation of salts using an enantiomerically pure acid or base. The diasteromeric derivatives may then be converted to the pure enantiomers by cleavage of the added chiral residue. The racemic mixture of the compounds can also be separated directly by chromatographic methods utilizing chiral stationary phases, which methods are well known in the art.

[0113] The compounds of Formula (I) or (Ia) which contain olefinic double bonds, unless specified otherwise, they are meant to include both E and Z geometric isomers.

[0114] Some of the compounds described herein may exist as tautomers which have different points of attachment of hydrogen accompanied by one or more double bond shifts. For example, a ketone and its enol form are keto-enol tautomers. The individual tautomers as well as mixtures thereof are encompassed by the compounds of Formula (I).

[0115] Some of the compounds of Formula (I) or (Ia) described herein may exist as atropisomers when the rotational energy barrier around a single bond is sufficiently high to prevent free rotation at a given temperature, thus allowing isolation of individual conformers with distinct properties. A typical example of stable atropisomers are exemplified by Examples 1-1 and 1-2 (described below), which can be resolved by chiral chromatography separation. The individual atropisomers as well as mixtures thereof are encompassed with compounds of Formula (I) or (Ia) of the present disclosure. When resolved, individual atropisomers can be designated by established conventions such as those specified by the International Union of Pure Applied Chemistry (IUPAC) 2013 Recommendations.

[0116] In the compounds of Formula (I), the atoms may exhibit their natural isotopic abundances, or one or more of the atoms may be artificially enriched in a particular isotope having the same atomic number, but an atomic mass or mass number different from the atomic mass or mass number predominantly found in nature. The present disclosure as described and claimed herein is meant to include all suitable isotopic variations of the compounds of Formula (I) or (Ia) and embodiments thereof. For example, different isotopic forms of hydrogen (H) include protium (.sup.1H) and deuterium (.sup.2H, also denoted herein as D). Protium is the predominant hydrogen isotope found in nature. Enriching for deuterium may afford certain therapeutic advantages, such as increasing in vivo half-life or reducing dosage requirements or may provide a compound useful as a standard for characterization of biological samples. Isotopically-enriched compounds can be prepared without undue experimentation by conventional techniques well known to those skilled in the art or by processes analogous to those described in the Schemes and Examples herein using appropriate isotopically-enriched reagents and/or intermediates.

[0117] The term pharmaceutically acceptable salts refers to salts prepared from pharmaceutically acceptable non-toxic bases or acids. When a compound of Formula (I) or (Ia) is acidic, its corresponding salt can be conveniently prepared from pharmaceutically acceptable non-toxic bases, including inorganic bases and organic bases. Salts derived from such inorganic bases include aluminum, ammonium, calcium, copper (ic and ous), ferric, ferrous, lithium, magnesium, manganese (ic and ous), potassium, sodium, zinc and the like salts. Preferred are the ammonium, calcium, magnesium, potassium and sodium salts. Salts prepared from pharmaceutically acceptable organic non-toxic bases include salts of primary, secondary, and tertiary amines derived from both naturally occurring and synthetic sources. Pharmaceutically acceptable organic non-toxic bases from which salts can be formed include, for example, arginine, betaine, caffeine, choline, N,N-dibenzylethylenediamine, diethylamine, 2-diethylaminoethanol, 2-dimethylaminoethanol, ethanolamine, ethylenediamine, N-ethyl-morpholine, N-ethylpiperidine, glucamine, glucosamine, histidine, hydrabamine, isopropylamine, dicyclohexylamine, lysine, methylglucamine, morpholine, piperazine, piperidine, polyamine resins, procaine, purines, theobromine, triethylamine, trimethylamine, tripropylamine, tromethamine and the like.

[0118] When a compound of Formula (I) or (Ia) is basic, its corresponding salt can be conveniently prepared from pharmaceutically acceptable non-toxic inorganic and organic acids. Such acids include, for example, acetic, benzenesulfonic, benzoic, camphorsulfonic, citric, ethanesulfonic, fumaric, gluconic, glutamic, hydrobromic, hydrochloric, isethionic, lactic, maleic, malic, mandelic, methanesulfonic, mucic, nitric, pamoic, pantothenic, phosphoric, succinic, sulfuric, tartaric, p-toluenesulfonic acid and the like. Preferred are citric, hydrobromic, hydrochloric, maleic, phosphoric, sulfuric, and tartaric acids. If a compound of Formula (I) or (Ia) simultaneously contain acidic and basic groups in the molecule, the disclosure also includes, in addition to the salt forms mentioned, inner salts or betaines (zwitterions). Salts can be obtained from the compounds of Formula (I) or (Ia) by customary methods which are known to the person skilled in the art, for example, by combination with an organic or inorganic acid or base in a solvent or dispersant, or by anion exchange or cation exchange from other salts. The present disclosure also includes all salts of the compounds of Formula (I) or (Ia) which, owing to low physiological compatibility, are not directly suitable for use in pharmaceuticals but which can be used, for example, as intermediates for chemical reactions or for the preparation of pharmaceutically acceptable salts.

[0119] Furthermore, the compounds of Formula (I) or (Ia) may exist in amorphous form and/or one or more crystalline forms, and as such all amorphous and crystalline forms and mixtures thereof of the compounds of Formula (I) or (Ia), including the Examples, are intended to be included within the scope of the present disclosure. In addition, some of the compounds of Formula (I) or (Ia) may form solvates with water (i.e., a hydrate) or common organic solvents such as but not limited to ethyl acetate. Such solvates and hydrates, particularly the pharmaceutically acceptable solvates and hydrates, of the instant compounds are likewise encompassed within the scope of this disclosure, along with un-solvated and anhydrous forms.

[0120] Any pharmaceutically acceptable pro-drug modification of a compound of Formula (I) or (Ia) which results in conversion in vivo to a compound within the scope of this disclosure is also within the scope of this disclosure.

[0121] The terms therapeutically effective (or efficacious) amount and similar descriptions such as an amount efficacious for treatment or an effective dose are intended to mean that amount of a compound of Formula (I) or (Ia) that will elicit the biological or medical response of a tissue, a system, animal or human that is being sought by a researcher, veterinarian, medical doctor or other clinician. In a preferred embodiment, the term therapeutically effective amount means an amount of a compound of Formula (I) or (Ia) that alleviates at least one clinical symptom in a human patient. The terms prophylactically effective (or efficacious) amount and similar descriptions such as an amount efficacious for prevention are intended to mean that amount of a compound of Formula (I) or (Ia) that will prevent or reduce the risk of occurrence of the biological or medical event that is sought to be prevented in a tissue, a system, animal or human by a researcher, veterinarian, medical doctor or other clinician.

Dosages of the Compounds of Formula (I) or (Ia)

[0122] The dosage regimen utilizing a compound of Formula (I) or (Ia) is selected in accordance with a variety of factors including type, species, age, weight, sex and medical condition of the patient; the severity of the condition to be treated; the potency of the compound chosen to be administered; the route of administration; and the renal and hepatic function of the patient. A consideration of these factors is well within the purview of the ordinarily skilled clinician for the purpose of determining the therapeutically effective or prophylactically effective dosage amount needed to prevent, counter, or arrest the progress of the condition. It is understood that a specific daily dosage amount can simultaneously be both a therapeutically effective amount, e.g., for treatment of an oncological condition, and a prophylactically effective amount, e.g., for prevention of an oncological condition.

[0123] While individual needs vary, determination of optimal ranges of effective amounts of the compounds of Formula (I) or (Ia) is within the skill of the art. For administration to a human in, for example, the curative or prophylactic treatment of the conditions and disorders identified herein, the typical dosages of the compounds of Formula (I) or (Ia) can be about 0.05 mg/kg/day to about 50 mg/kg/day, or at least 0.05 mg/kg, or at least 0.08 mg/kg, or at least 0.1 mg/kg, or at least 0.2 mg/kg, or at least 0.3 mg/kg, or at least 0.4 mg/kg, or at least 0.5 mg/kg, and any amount therebetween, to about 50 mg/kg or less, or about 40 mg/kg or less, or about 30 mg/kg or less, or about 20 mg/kg or less, or about 10 mg/kg or less and any amount therebetween, which can be, for example, about 2.5 mg/day (0.5 mg/kg?5 kg) to about 5000 mg/day (50 mg/kg?100 kg). For example, dosages of the compounds can be about 0.1 mg/kg/day to about 50 mg/kg/day, or about 0.05 mg/kg/day to about 10 mg/kg/day, or about 0.05 mg/kg/day to about 5 mg/kg/day, or about 0.05 mg/kg/day to about 3 mg/kg/day, or about 0.07 mg/kg/day to about 3 mg/kg/day, or about 0.09 mg/kg/day to about 3 mg/kg/day, or about 0.05 mg/kg/day to about 0.1 mg/kg/day, or about 0.1 mg/kg/day to about 1 mg/kg/day, or about 1 mg/kg/day to about 10 mg/kg/day, or about 1 mg/kg/day to about 5 mg/kg/day, or about 1 mg/kg/day to about 3 mg/kg/day, or about 3 mg/day to about 500 mg/day, or about 5 mg/day to about 250 mg/day, or about 10 mg/day to about 100 mg/day, or about 3 mg/day to about 10 mg/day, or about 100 mg/day to about 250 mg/day. Such doses may be administered in a single dose or may be divided into multiple doses.

Pharmaceutical Compositions

[0124] The compounds of Formula (I) or (Ia) and their pharmaceutically acceptable salts can be administered to animals, preferably to mammals, and in particular to humans, as pharmaceuticals by themselves, in mixtures with one another or in the form of pharmaceutical compositions. The term subject or patient includes animals, preferably mammals and especially humans, who use the instant active agents for the prevention or treatment of a medical condition. Administering of the drug to the subject includes both self-administration and administration to the patient by another person. The subject may be in need of, or desire, treatment for an existing disease or medical condition, or may be in need of or desire prophylactic treatment to prevent or reduce the risk of occurrence of said disease or medical condition. As used herein, a subject in need of treatment of an existing condition or of prophylactic treatment encompasses both a determination of need by a medical professional as well as the desire of a patient for such treatment.

[0125] The present disclosure therefore also provides the compounds of Formula (I) or (Ia) and their pharmaceutically acceptable salts for use as pharmaceuticals, their use for modulating the activity of mutant KRAS, HRAS and/or NRAS proteins and in particular their use in the therapy and prophylaxis of the below-mentioned diseases or disorders as well as their use for preparing medicaments for these purposes. In certain embodiments, the compounds of Formula (I) or (Ia) and their pharmaceutically acceptable salts inhibit the KRAS G12C protein.

[0126] Furthermore, the present disclosure provides pharmaceutical compositions which comprise as active component an effective dose of at least one compound of Formula (I) or (Ia) and/or a pharmaceutically acceptable salt thereof and a customary pharmaceutically acceptable carrier. i.e., one or more pharmaceutically acceptable carrier substances and/or additives.

[0127] Thus, the present disclosure provides, for example, said compound and its pharmaceutically acceptable salts for use as pharmaceutical compositions which comprise as active component an effective dose of at least one compound of Formula (I) or (Ia) and/or a pharmaceutically acceptable salt thereof and a customary pharmaceutically acceptable carrier, and the uses of said compound and/or a pharmaceutically acceptable salt thereof in the therapy or prophylaxis of the below-mentioned diseases or disorders, e.g., cancer, as well as their use for preparing medicaments for these purposes.

[0128] The pharmaceutical compositions according to the disclosure can be administered orally, for example, in the form of pills, tablets, lacquered tablets, sugar-coated tablets, granules, hard and soft gelatin capsules, aqueous, alcoholic or oily solutions, syrups, emulsions or suspensions, or rectally, for example, in the form of suppositories. Administration can also be carried out parenterally, for example subcutaneously, intramuscularly or intravenously in the form of solutions for injection or infusion.

[0129] Other suitable administration forms are, for example, percutaneous or topical administration, for example, in the form of ointments, tinctures, sprays or transdermal therapeutic systems, or, for example, microcapsules, implants or rods. The preferred administration form depends, for example, on the disease to be treated and on its severity.

[0130] The amount of active compound of a compound described herein and/or its pharmaceutically acceptable salts in the pharmaceutical composition normally is from 0.01 to 200 mg, or from 0.1 to 200 mg, or from 1 to 200 mg, per dose, but depending on the type of the pharmaceutical composition, it can also be higher. In some embodiments, the amount of active compound of a compound of Formula (I) or (Ia) and/or its pharmaceutically acceptable salts in the pharmaceutical composition is from 0.01 to 10 mg per dose. The pharmaceutical compositions usually comprise 0.5 to 90 percent by weight of at least one compound of Formula (I) or (Ia) and/or its pharmaceutically acceptable salts. The preparation of the pharmaceutical compositions can be carried out in a manner known per se. For this purpose, one or more compounds of Formula (I) or (Ia) and/or their pharmaceutically acceptable salts, together with one or more solid or liquid pharmaceutical carrier substances and/or additives (or auxiliary substances) and, if desired, in combination with other pharmaceutically active compounds having therapeutic or prophylactic action, are brought into a suitable administration form or dosage form which can then be used as a pharmaceutical in human or veterinary medicine.

[0131] For the production of pills, tablets, sugar-coated tablets and hard gelatin capsules, it is possible to use, for example, lactose, starch, for example, maize starch, or starch derivatives, talc, stearic acid or its salts, etc. Carriers for soft gelatin capsules and suppositories are, for example, fats, waxes, semisolid and liquid polyols, natural or hardened oils, etc. Suitable carriers for the preparation of solutions, for example, of solutions for injection, or of emulsions or syrups are, for example, water, physiologically acceptable sodium chloride solution, alcohols such as ethanol, glycerol, polyols, sucrose, invert sugar, glucose, mannitol, vegetable oils, etc. It is also possible to lyophilize the compounds of Formula (I) or (Ia) and their pharmaceutically acceptable salts and to use the resulting lyophilisates, for example, for preparing preparations for injection or infusion. Suitable carriers for microcapsules, implants or rods are, for example, copolymers of glycolic acid and lactic acid.

[0132] Besides the active compounds and carriers, the pharmaceutical compositions can also contain customary additives, for example, fillers, disintegrants, binders, lubricants, wetting agents, stabilizers, emulsifiers, dispersants, preservatives, sweeteners, colorants, flavorings, aromatizers, thickeners, diluents, buffer substances, solvents, solubilizers, agents for achieving a depot effect, salts for altering the osmotic pressure, coating agents and/or antioxidants.

Methods of Using the Compounds of Formula (I) or (Ia)

[0133] The present application provides a method of inhibiting RAS-mediated cell signaling comprising contacting a cell with a compound of Formula (I) or (Ia) or a pharmaceutically acceptable salt thereof. Inhibition of RAS-mediated signal transduction can be assessed and demonstrated by a wide variety of ways known in the art. Non-limiting examples include (a) a decrease in GTPase activity of RAS; (b) a decrease in GTP binding affinity or an increase in GDP binding affinity; (c) an increase in K.sub.off of GTP or a decrease in K.sub.off of GDP; (d) a decrease in the levels of signaling transduction molecules downstream in the RAS pathway, such as a decrease in pMEK, pERK, or pAKT levels; and/or (e) a decrease in binding of RAS complex to downstream signaling molecules including but not limited to Raf. Kits and commercially available assays can be utilized for determining one or more of the above.

[0134] The present application also provides methods of using the compounds of Formula (I) or (Ia) (or their pharmaceutically acceptable salts) or pharmaceutical compositions containing such compounds to treat disease conditions, including but not limited to, conditions implicated by mutant KRAS, HRAS and/or NRAS proteins (e.g., cancer), and in some embodiments the KRAS G12C mutant.

[0135] In some embodiments, a method for treatment of cancer is provided, the method comprising administering a therapeutically effective amount a compound of Formula (I) or (Ia) (or a pharmaceutically acceptable salt thereof) or any of the foregoing pharmaceutical compositions comprising such a compound to a subject in need of such treatment. In some embodiments, the cancer is mediated by a KRAS, HRAS or NRAS mutation, e.g., the KRAS G12C mutation. In various embodiments, the cancer is pancreatic cancer, colorectal cancer or lung cancer. In some embodiments, the cancer is gall bladder cancer, thyroid cancer, or bile duct cancer.

[0136] In some embodiments the present disclosure provides a method of treating a disorder in a subject in need thereof, wherein said method comprises determining if the subject has a KRAS, HRAS or NRAS mutation (e.g., KRAS G12C mutation) and if the subject is determined to have the KRAS, HRAS or NRAS mutation, then administering to the subject a therapeutically effective amount of a compound of Formula (I) or (Ia) or a pharmaceutically acceptable salt thereof.

[0137] The disclosed compounds inhibit anchorage-independent cell growth and therefore have the potential to inhibit tumor metastasis. Accordingly, another embodiment of the present disclosure provides a method for inhibiting tumor metastasis, the method comprising administering an effective amount a compound of Formula (I) or (Ia).

[0138] KRAS, HRAS or NRAS mutations have also been identified in hematological malignancies (e.g., cancers that affect blood, bone marrow and/or lymph nodes). Accordingly, certain embodiments are directed to administration of the compounds of Formula (I) or (Ia) (e.g., in the form of a pharmaceutical composition) to a subject in need of treatment of a hematological malignancy. Such malignancies include, but are not limited to leukemias and lymphomas. For example, the presently disclosed compounds can be used for treatment of diseases such as acute lymphoblastic leukemia (ALL), acute myelogenous leukemia (AML), chronic lymphocytic leukemia (CLL), small lymphocytic lymphoma (SLL), chronic myelogenous leukemia (CML), acute monocytic leukemia (AMoL) and/or other leukemias. In other embodiments, the compounds are useful for treatment of lymphomas such as Hodgkins lymphoma or non-Hodgkins lymphoma. In various embodiments, the compounds are useful for treatment of plasma cell malignancies such as multiple myeloma, mantle cell lymphoma, and Waldenstrom's macroglubunemia.

[0139] Determining whether a tumor or cancer comprises a KRAS, HRAS or NRAS mutation (e.g., the KRAS G12C mutation) can be undertaken by assessing the nucleotide sequence encoding the KRAS, HRAS or NRAS protein, by assessing the amino acid sequence of the KRAS, HRAS or NRAS protein, or by assessing the characteristics of a putative KRAS, HRAS or NRAS mutant protein. The sequences of wild-type human KRAS, HRAS or NRAS are known in the art.

[0140] Methods for detecting a mutation in a KRAS, HRAS or NRAS nucleotide sequence are also known by those of skill in the art. These methods include, but are not limited to, polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) assays, polymerase chain reaction-single strand conformation polymorphism (PCR-SSCP) assays, real-time PCR assays, PCR sequencing, mutant allele-specific PCR amplification (MASA) assays, direct sequencing, primer extension reactions, electrophoresis, oligonucleotide ligation assays, hybridization assays. TaqMan assays, SNP genotyping assays, high resolution melting assays and microarray analyses. In some embodiments, samples are evaluated for KRAS, HRAS or NRAS mutations (e.g., the KRAS G12C mutation) by real-time PCR. In real-time PCR, fluorescent probes specific for the KRAS, HRAS or NRAS mutation are used. When a mutation is present, the probe binds and fluorescence is detected. In some embodiments, the KRAS, HRAS or NRAS mutation is identified using a direct sequencing method of specific regions (e.g., exon 2 and/or exon 3) in the KRAS, HRAS or NRAS gene.

[0141] Methods for detecting a mutation in a KRAS, HRAS or NRAS protein (e.g., the KRAS G12C mutation) are known by those of skill in the art. These methods include, but are not limited to, detection of a KRAS, HRAS or NRAS mutant using a binding agent (e.g., an antibody) specific for the mutant protein, protein electrophoresis and Western blotting, and direct peptide sequencing.

[0142] A number of tissue samples can be assessed for determining whether a tumor or cancer comprises a KRAS, HRAS or NRAS mutation (e.g., the KRAS G12C mutation). In some embodiments, the sample is taken from a subject having a tumor or cancer. In some embodiments, the sample is a fresh tumor/cancer sample. In some embodiments, the sample is a frozen tumor/cancer sample. In some embodiments, the sample is a formalin-fixed paraffin-embedded sample. In some embodiments, the sample is a circulating tumor cell (CTC) sample. In some embodiments, the sample is processed to a cell lysate. In some embodiments, the sample is processed to DNA or RNA.

[0143] The present application also provides a method of treating a hyperproliferative disorder comprising administering a therapeutically effective amount of a compound of Formula (I) or (Ia), or a pharmaceutically acceptable salt thereof to a subject in need thereof. In some embodiments, said method relates to the treatment of a subject who suffers from a cancer such as acute myeloid leukemia, cancer in adolescents, adrenocortical carcinoma childhood, AIDS-related cancers (e.g., Lymphoma and Kaposi's Sarcoma), anal cancer, appendix cancer, astrocytomas, atypical teratoid, basal cell carcinoma, bile duct cancer, bladder cancer, bone cancer, brain stem glioma, brain tumor, breast cancer, bronchial tumors, Burkitt lymphoma, carcinoid tumor, atypical teratoid, embryonal tumors, germ cell tumor, primary lymphoma, cervical cancer, childhood cancers, chordoma, cardiac tumors, chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), chronic myleoproliferative disorders, colon cancer, colorectal cancer, craniopharyngioma, cutaneous T-cell lymphoma, extrahepatic ductal carcinoma in situ (DCIS), embryonal tumors, CNS cancer, endometrial cancer, ependymoma, esophageal cancer, esthesioneuroblastoma, Ewing sarcoma, extracranial germ cell tumor, extragonadal germ cell tumor, eye cancer, fibrous histiocytoma of bone, gall bladder cancer, gastric cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumors (GIST), germ cell tumor, gestational trophoblastic tumor, hairy cell leukemia, head and neck cancer, heart cancer, liver cancer, Hodgkin lymphoma, hypopharyngeal cancer, intraocular melanoma, islet cell tumors, pancreatic neuroendocrine tumors, kidney cancer, laryngeal cancer, lip and oral cavity cancer, liver cancer, lobular carcinoma in situ (LCIS), lung cancer, lymphoma, metastatic squamous neck cancer with occult primary, midline tract carcinoma, mouth cancer; multiple endocrine neoplasia syndromes, multiple myeloma/plasma cell neoplasm, mycosis fungoides, myelodysplasia syndromes, myelodysplastic/myeloproliferative neoplasms, multiple myeloma, Merkel cell carcinoma, malignant mesothelioma, malignant fibrous histiocytoma of bone and osteosarcoma, nasal cavity and paranasal sinus cancer, nasopharyngeal cancer, neuroblastoma, Non-Hodgkin lymphoma, non-small cell lung cancer (NSCLC), oral cancer, lip and oral cavity cancer, oropharyngeal cancer, ovarian cancer, pancreatic cancer, papillomatosis, paraganglioma, paranasal sinus and nasal cavity cancer, parathyroid cancer, penile cancer, pharyngeal cancer, pleuropulmonary blastoma, primary central nervous system (CNS) lymphoma, prostate cancer, rectal cancer, transitional cell cancer, retinoblastoma, rhabdomyosarcoma, salivary gland cancer, skin cancer, stomach (gastric) cancer, small cell lung cancer; small intestine cancer, soft tissue sarcoma. T-Cell lymphoma, testicular cancer, throat cancer, thymoma and thymic carcinoma, thyroid cancer, transitional cell cancer of the renal pelvis and ureter, trophoblastic tumor, unusual cancers of childhood, urethral cancer, uterine sarcoma, vaginal cancer, vulvar cancer, or viral-induced cancer. In some embodiments, said method relates to the treatment of a non-cancerous hyperproliferative disorder such as benign hyperplasia of the skin (e.g., psoriasis), restenosis, or prostate (e.g., benign prostatic hypertrophy (BPH)).

[0144] In some embodiments, the methods for treatment are directed to treating lung cancers, and the methods comprise administering a therapeutically effective amount of the compounds of Formula (I) or (Ia) (or pharmaceutical composition comprising such compounds) to a subject in need thereof. In certain embodiments, the lung cancer is a non-small cell lung carcinoma (NSCLC), for example, adenocarcinoma, squamous-cell lung carcinoma or large-cell lung carcinoma. In some embodiments, the lung cancer is a small cell lung carcinoma. Other lung cancers which the compounds of Formula (I) or (Ia) may provide therapeutic benefit for include, but are not limited to, glandular tumors, carcinoid tumors and undifferentiated carcinomas.

[0145] The present disclosure also provides methods of modulating a mutant KRAS, HRAS or NRAS protein activity (e.g., activity resulting from the KRAS G12C mutation) by contacting the protein with an effective amount of a compound of Formula (I) or (Ia). Modulation can be inhibiting or activating protein activity. In some embodiments, the present disclosure provides methods of inhibiting protein activity by contacting the mutant KRAS, HRAS or NRAS protein (e.g., KRAS G12C mutant) with an effective amount of a compound of Formula (I) or (Ia) in solution. In some embodiments, the present disclosure provides methods of inhibiting the mutant KRAS, HRAS or NRAS protein activity by contacting a cell, tissue, or organ that expresses the protein of interest. In some embodiments, the disclosure provides methods of inhibiting protein activity in subjects including, but not limited to, rodents and mammals (e.g., humans) by administering into the subjects an effective amount of a compound of Formula (I) or (Ia).

Combination Therapies

[0146] One or more additional pharmacologically active agents may be administered in combination with a compound of Formula (I) or (Ia) (or a pharmaceutically acceptable salt thereof). An additional active agent (or agents) is intended to mean a pharmaceutically active agent (or agents) that is active in the body, including pro-drugs that convert to pharmaceutically active form after administration, which are different from the compound of Formula (I) or (Ia). The additional active agents also include free-acid, free-base and pharmaceutically acceptable salts of said additional active agents. Generally, any suitable additional active agent or agents, including chemotherapeutic agents or therapeutic antibodies, may be used in any combination with the compound of Formula (I) or (Ia) in a single dosage formulation (e.g., a fixed dose drug combination), or in one or more separate dosage formulations which allows for concurrent or sequential administration of the active agents (co-administration of the separate active agents) to subjects. In addition, the compounds of Formula (I) or (Ia) (or pharmaceutically acceptable salts thereof) can be administered in combination with radiation therapy, hormone therapy, surgery or immunotherapy.

[0147] The present application also provides methods for combination therapies in which the additional active agent is known to modulate other pathways, or other components of the same pathway, or even overlapping sets of target enzymes which are used in combination with a compound of Formula (I) or (Ia), or a pharmaceutically acceptable salt thereof. In one embodiment, such therapy includes, but is not limited to, the combination of one or more compounds of Formula (I) or (Ia) with chemotherapeutic agents, immunotherapeutic agents, hormonal and anti-hormonal agents, targeted therapy agents, and anti-angiogenesis agents, to provide a synergistic or additive therapeutic effect. In another embodiment, such therapy includes radiation treatment to provide a synergistic or additive therapeutic effect.

[0148] Examples of additional active agents (i.e., additional anti-cancer agents) include chemotherapeutic agents (e.g., cytotoxic agents), immunotherapeutic agents, hormonal and anti-hormonal agents, targeted therapy agents, and anti-angiogenesis agents, Many anti-cancer agents can be classified within one or more of these groups. While certain anti-cancer agents have been categorized within a specific group(s) or subgroup(s) herein, many of these agents can also be listed within one or more other group(s) or subgroup(s), as would be presently understood in the art. It is to be understood that the classification herein of a particular agent into a particular group is not intended to be limiting, Many anti-cancer agents are presently known in the art and can be used in combination with the compounds of the present disclosure.

[0149] Further, an agent can be an agonist, antagonist, allosteric modulator, toxin or, more generally, may act to inhibit or stimulate its target (e.g., receptor or enzyme activation or inhibition). For example, suitable for use are one or more agents (e.g., antibodies, antigen binding regions, or soluble receptors) that specifically bind and inhibit the activity of growth factors, such as antagonists of hepatocyte growth factor (HGF, also known as Scatter Factor), and antibodies or antigen binding regions that specifically bind its receptor c-met.

[0150] In an embodiment, the additional anti-cancer agent is a chemotherapeutic agent, an immunotherapeutic agent, a hormonal agent, an anti-hormonal agent, a targeted therapy agent, or an anti-angiogenesis agent (or angiogenesis inhibitor). In an embodiment, the additional anti-cancer agent is selected from the group consisting of a chemotherapeutic agent, a mitotic inhibitor, a plant alkaloid, an alkylating agent, an anti-metabolite, a platinum analog, an enzyme, a topoisomerase inhibitor, a retinoid, an aziridine, an antibiotic, a hormonal agent, an anti-hormonal agent, an anti-estrogen, an anti-androgen, an anti-adrenal, an androgen, a targeted therapy agent, an immunotherapeutic agent, a biological response modifier, a cytokine inhibitor, a tumor vaccine, a monoclonal antibody, an immune checkpoint inhibitor, an anti-PD-1 agent, an anti-PD-L1 agent, a colony-stimulating factor, an immunomodulator, an immunomodulatory imide (IMiD), an anti-CTLA4 agent, an anti-LAG1 agent, an anti-OX40 agent, a GITR agonist, a CAR-T cell, a BiTE, a signal transduction inhibitor, a growth factor inhibitor, a tyrosine kinase inhibitor, an EGFR inhibitor, a histone deacetylase (HDAC) inhibitor, a proteasome inhibitor, a cell-cycle inhibitor, an anti-angiogenesis agent, a matrix-metalloproteinase (MMP) inhibitor, a hepatocyte growth factor inhibitor, a TOR inhibitor, a KDR inhibitor, a VEGF inhibitor, a HIF-1? inhibitor, a HIF-2a inhibitor, a fibroblast growth factor (FGF) inhibitor, a RAF inhibitor, a MEK inhibitor, an ERK inhibitor, a PI3K inhibitor, an AKT inhibitor, an MCL-1 inhibitor, a BCL-2 inhibitor, an SHP2 inhibitor, a HER-2 inhibitor, a BRAF-inhibitor, a gene expression modulator, an autophagy inhibitor, an apoptosis inducer, an antiproliferative agent, and a glycolysis inhibitor.

[0151] In one embodiment, the additional anti-cancer agent(s) is a chemotherapeutic agent. Non-limiting examples of chemotherapeutic agents include mitotic inhibitors and plant alkaloids, alkylating agents, anti-metabolites, platinum analogs, enzymes, topoisomerase inhibitors, retinoids, aziridines, and antibiotics.

[0152] Non-limiting examples of mitotic inhibitors and plant alkaloids include taxanes such as cabazitaxel, docetaxel, larotaxel, ortataxel, paclitaxel, and tesetaxel; demecolcine; epothilone; eribulin; etoposide (VP-16); etoposide phosphate; navelbine; noscapine; teniposide; thaliblastine; vinblastine; vincristine; vindesine; vinflunine; and vinorelbine

[0153] Non-limiting examples of alkylating agents include nitrogen mustards such as chlorambucil, chlornaphazine, cholophosphamide, cytophosphane, estramustine, ifosfamide, mannomustine, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, tris(2-chloroethyl)amine, trofosfamide, and uracil mustard; alkyl sulfonates such as busulfan, improsulfan, and piposulfan; nitrosoureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, ranimustine, streptozotocin, and TA-07; ethylenimines and methylamelamines such as altretamine, thiotepa, triethylenemelamine, triethylenethiophosphaoramide, trietylenephosphoramide, and trimethylolomelamine; ambamustine; bendamustine: dacarbazine; etoglucid; irofulven; mafosfamide; mitobronitol; mitolactol; pipobroman; procarbazine; temozolomide; treosulfan; and triaziquone.

[0154] Non-limiting examples of anti-metabolites include folic acid analogues such as aminopterin, denopterin, edatrexate, methotrexate, pteropterin, raltitrexed, and trimetrexate; purine analogs such as 6-mercaptopurine, 6-thioguanine, fludarabine, forodesine, thiamiprine, and thioguanine; pyrimidine analogs such as 5-fluorouracil (5-FU), 6-azauridine, ancitabine, azacytidine, capecitabine, carmofur, cytarabine, decitabine, dideoxyuridine, doxifiuridine, doxifluridine, enocitabine, floxuridine, galocitabine, gemcitabine, and sapacitabine; 3-aminopyridine-2-carboxaldehyde thiosemicarbazone; broxuridine; cladribine; cyclophosphamide; cytarabine; emitefur; hydroxyurea; mercaptopurine; nelarabine; pemetrexed; pentostatin; tegafur; and troxacitabine.

[0155] Non-limiting examples of platinum analogs include carboplatin, cisplatin, dicycloplatin, heptaplatin, lobaplatin, nedaplatin, oxaliplatin, satraplatin, and triplatin tetranitrate.

[0156] Non-limiting examples of enzymes include asparaginase and pegaspargase.

[0157] Non-limiting examples of topoisomerase inhibitors include acridine carboxamide, amonafide, amsacrine, belotecan, elliptinium acetate, exatecan, indolocarbazole, irinotecan, lurtotecan, mitoxantrone, razoxane, rubitecan, SN-38, sobuzoxane, and topotecan.

[0158] Non-limiting examples of retinoids include alitretinoin, bexarotene, fenretinide, isotretinoin, liarozole, RII retinamide, and tretinoin.

[0159] Non-limiting examples of aziridines include benzodopa, carboquone, meturedopa, and uredopa.

[0160] Non-limiting examples of antibiotics include intercalating antibiotics; anthracenediones; anthracycline antibiotics such as aclarubicin, amrubicin, daunomycin, daunorubicin, doxorubicin, epirubicin, idarubicin, menogaril, nogalamycin, pirarubicin, and valrubicin; 6-diazo-5-oxo-L-norleucine; aclacinomysins; actinomycin; authramycin; azaserine; bleomycins; cactinomycin; calicheamicin; carabicin; carminomycin; carzinophilin; chromomycins; dactinomycin; detorubicin; esorubicin; esperamicins; geldanamycin; marcellomycin; mitomycins; mitomycin C; mycophenolic acid; olivomycins; novantrone; peplomycin; porfiromycin; potfiromycin; puromycin; quelamycin; rebeccamycin; rodorubicin; streptonigrin; streptozocin; tanespimycin; tubercidin; ubenimex; zinostatin; zinostatin stimalamer, and zorubicin.

[0161] In one embodiment, the additional anti-cancer agent(s) is a hormonal and/or anti-hormonal agent (i.e., hormone therapy). Non-limiting examples of hormonal and anti-hormonal agents include anti-androgens such as abiraterone, apalutamide, bicalutamide, darolutamide, enzalutamide, flutamide, goserelin, leuprolide, and nilutamide; anti-estrogens such as 4-hydroxy tamoxifen, aromatase inhibiting 4(5)-imidazoles, EM-800, fosfestrol, fulvestrant, keoxifene, LY 117018, onapristone, raloxifene, tamoxifen, toremifene, and trioxifene; anti-adrenals such as aminoglutethimide, dexaminoglutethimide, mitotane, and trilostane; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, and testolactone; abarelix; anastrozole; cetrorelix; deslorelin; exemestane; fadrozole; finasteride; formestane; histrelin (RL 0903); human chorionic gonadotropin; lanreotide; LDI 200 (Milkhaus); letrozole; leuprorelin; mifepristone; nafarelin; nafoxidine; osaterone; prednisone; thyrotropin alfa; and triptorelin.

[0162] In one embodiment, the additional anti-cancer agent(s) is an immunotherapeutic agent (i.e., immunotherapy). Non-limiting examples of immunotherapeutic agents include biological response modifiers, cytokine inhibitors, tumor vaccines, monoclonal antibodies, immune checkpoint inhibitors, colony-stimulating factors, and immunomodulators.

[0163] Non-limiting examples of biological response modifiers, including cytokine inhibitors (cytokines) such as interferons and interleukins, include interferon alfa/interferon alpha such as interferon alfa-2, interferon alfa-2a, interferon alfa-2b, interferon alfa-n1, interferon alfa-n3, interferon alfacon-1, peginterferon alfa-2a, peginterferon alfa-2b, and leukocyte alpha interferon; interferon beta such as interferon beta-la, and interferon beta-1b; interferon gamma such as natural interferon gamma-1a, and interferon gamma-lb; aldesleukin; interleukin-1 beta; interleukin-2; oprelvekin; sonermin; tasonermin; and virulizin.

[0164] Non-limiting examples of tumor vaccines include APC 8015, AVICINE, bladder cancer vaccine, cancer vaccine (Biomira), gastrin 17 immunogen, Maruyama vaccine, melanoma lysate vaccine, melanoma oncolysate vaccine (New York Medical College), melanoma vaccine (New York University), melanoma vaccine (Sloan Kettering Institute), TICE? BCG (Bacillus Calmette-Guerin), and viral melanoma cell lysates vaccine (Royal Newcastle Hospital).

[0165] Non-limiting examples of monoclonal antibodies include abagovomab, adecatumumab, aflibercept, alemtuzumab, blinatumomab, brentuximab vedotin, CA 125 MAb (Biomira), cancer MAb (Japan Pharmaceutical Development), daclizwnab, daratumumab, denosumab, edrecolomab, gemtuzumab zogamicin, HER-2 and Fc MAb (Medarex), ibritumomab tiuxetan, idiotypic 105AD7 MAb (CRC Technology), idiotypic CEA MAb (Trilex), ipilimumab, lintuzumab, LYM-1-iodine 131 MAb (Techni clone), mitumomab, moxetumomab, ofatumumab, polymorphic epithelial mucin-yttrium 90 MAb (Antisoma), ranibizumab, rituximab, and trastuzumab.

[0166] Non-limiting examples of immune checkpoint inhibitors include anti-PD-1 agents or antibodies such as cemiplimab, nivolumab, and pembrolizumab; anti-PD-L1 agents or antibodies such as atezolizumab, avelumab, and durvalumab; anti-CTLA4 agents or antibodies such as ipilumumab; anti-LAG1 agents; and anti-OX40 agents.

[0167] Non-limiting examples of colony-stimulating factors include darbepoetin alfa, epoetin alfa, epoetin beta, filgrastim, granulocyte macrophage colony stimulating factor, lenograstim, leridistim, mirimostim, molgramostim, nartograstim, pegfilgrastim, and sargramostim.

[0168] Non-limiting examples of additional immunotherapeutic agents include BiTEs, CAR-T cells, GITR agonists, imiquimod, immunomodulatory imides (IMiDs), mismatched double stranded RNA (Ampligen), resiquimod, SRL 172, and thymalfasin.

[0169] In one embodiment, the additional anti-cancer agent(s) is a targeted therapy agent (i.e., targeted therapy). Targeted therapy agents include, for example, monoclonal antibodies and small molecule drugs. Non-limiting examples of targeted therapy agents include signal transduction inhibitors, growth factor inhibitors, tyrosine kinase inhibitors, EGFR inhibitors, histone deacetylase (HDAC) inhibitors, proteasome inhibitors, cell-cycle inhibitors, angiogenesis inhibitors, matrix-metalloproteinase (MMP) inhibitors, hepatocyte growth factor inhibitors, TOR inhibitors, KDR inhibitors, VEGF inhibitors, fibroblast growth factors (FGF) inhibitors, MEK inhibitors, ERK inhibitors, PI3K inhibitors, AKT inhibitors, MCL-1 inhibitors, BCL-2 inhibitors, SHP2 inhibitors, HER-2 inhibitors, BRAF-inhibitors, gene expression modulators, autophagy inhibitors, apoptosis inducers, antiproliferative agents, and glycolysis inhibitors.

[0170] Non-limiting examples of signal transduction inhibitors include tyrosine kinase inhibitors, multiple-kinase inhibitors, anlotinib, avapritinib, axitinib, dasatinib, dovitinib, imatinib, lenvatinib, lonidamine, nilotinib, nintedanib, pazopanib, pegvisomant, ponatinib, vandetanib, and EGFR inhibitory agents.

[0171] Non-limiting examples of EGFR inhibitory agents include small molecule antagonists of EGFR such as afatinib, brigatinib, erlotinib, gefitinib, lapatinib, and osimertinib; and antibody-based EGFR inhibitors, including any anti-EGFR antibody or antibody fragment that can partially or completely block EGFR activation by its natural ligand. Antibody-based EGFR inhibitory agents may include, for example, those described in Modjtahedi, H., et al., 1993, Br. J. Cancer 67:247-253; Teramoto, T., et al., 1996, Cancer 77:639-645; Goldstein et al, 1995, Clin. Cancer Res. 1: 1311-1318; Huang, S. M., et al., 1999, Cancer Res. 15:59(8): 1935-40; and Yang, X., et al., 1999, Cancer Res. 59: 1236-1243; monoclonal antibody Mab E7.6.3 (Yang, 1999 supra); Mab C225 (ATCC Accession No. HB-8508), or an antibody or antibody fragment having the binding specificity thereof; specific antisense nucleotide or siRNA; afatinib, cetuximab; matuzumab; necitumumab; nimotuzumab; panitumumab; and zalutumumab.

[0172] Non-limiting examples of histone deacetylase (HDAC) inhibitors include belinostat, panobinostat, romidepsin, and vorinostat.

[0173] Non-limiting examples of proteasome inhibitors include bortezomib, carfilzomib, ixazomib, marizomib (salinosporamide a), and oprozomib.

[0174] Non-limiting examples of cell-cycle inhibitors, including CDK inhibitors, include abemaciclib, alvocidib, palbociclib, and ribociclib.

[0175] In one embodiment, the additional anti-cancer agent(s) is an anti-angiogenic agent (or angiogenesis inhibitor) including, but not limited to, matrix-metalloproteinase (MMP) inhibitors; VEGF inhibitors; EGFR inhibitors; TOR inhibitors such as everolimus and temsirolimus; PDGFR kinase inhibitory agents such as crenolanib; HIF-1? inhibitors such as PX 478; HIF-2a inhibitors such as belzutifan and the HIF-2? inhibitors described in WO 2015/035223; fibroblast growth factor (FGF) or FGFR inhibitory agents such as B-FGF and RG 13577; hepatocyte growth factor inhibitors; KDR inhibitors; anti-Ang1 and anti-Ang2 agents; anti-Tie2 kinase inhibitory agents; Tek antagonists (US 2003/0162712; U.S. Pat. No. 6,413,932); anti-TWEAK agents (U.S. Pat. No. 6,727,225); ADAM distintegrin domain to antagonize the binding of integrin to its ligands (US 2002/0042368); anti-eph receptor and/or anti-ephrin antibodies or antigen binding regions (U.S. Pat. Nos. 5,981,245; 5,728,813; 5,969,110; 6,596,852; 6,232,447; and 6,057,124); and anti-PDGF-BB antagonists as well as antibodies or antigen binding regions specifically binding to PDGF-BB ligands.

[0176] Non-limiting examples of matrix-metalloproteinase (MMP) inhibitors include MMP-2 (matrix-metalloproteinase 2) inhibitors, MMP-9 (matrix-metalloproteinase 9) inhibitors, prinomastat, RO 32-3555, and RS 13-0830. Examples of useful matrix metalloproteinase inhibitors are described, for example, in WO 96/33172, WO 96/27583, EP 1004578, WO 98/07697, WO 98/03516, WO 98/34918, WO 98/34915, WO 98/33768, WO 98/30566, EP 0606046, EP 0931788, WO 90/05719, WO 99/52910, WO 99/52889, WO 99/29667, WO 1999/007675, EP 1786785, EP 1181017, US 2009/0012085, U.S. Pat. Nos. 5,863,949, 5,861,510, and EP 0780386. Preferred MMP-2 and MMP-9 inhibitors are those that have little or no activity inhibiting MMP-1. More preferred, are those that selectively inhibit MMP-2 and/or MMP-9 relative to the other matrix-metalloproteinases (i.e., MAP-1, MMP-3, MMP-4, MMP-5, MMP-6, MMP-7, MMP-8, MMP-10, MMP-11, MMP-12, and MMP-13).

[0177] Non-limiting examples of VEGF and VEGFR inhibitory agents include bevacizumab, cediranib, CEP 7055, CP 547632, KRN 633, orantinib, pazopanib, pegaptanib, pegaptanib octasodium, semaxanib, sorafenib, sunitinib, VEGF antagonist (Borean, Denmark), and VEGF-TRAP?.

[0178] The additional anti-cancer agent(s) may also be another anti-angiogenic agent including, but not limited to, 2-methoxyestradiol, AE 941, alemtuzumab, alpha-D148 Mab (Amgen, US), alphastatin, anecortave acetate, angiocidin, angiogenesis inhibitors, (SUGEN, US), angiostatin, anti-Vn Mab (Crucell, Netherlands), atiprimod, axitinib, AZD 9935, BAY RES 2690 (Bayer, Germany, BC 1 (Genoa Institute of Cancer Research, Italy), beloranib, benefin (Lane Labs, US), cabozantinib, CDP 791 (Celltech Group, UK), chondroitinase AC, cilengitide, combretastatin A4 prodrug, CP 564959 (OSI, US), CV247, CYC 381 (Harvard University, US), E 7820, EHT 0101, endostatin, enzastaurin hydrochloride, ER-68203-00 (IVAX, US), fibrinogen-E fragment, Flk-1 (ImClone Systems, US), forms of FLT 1 (VEGFR 1), FR-111142, GCS-100, GW 2286 (GlaxoSmithKline, UK), IL-8, ilomastat, IM-862, irsogladine, KM-2550 (Kyowa Hakko, Japan), lenalidomide, lenvatinib, MAb alpha5beta3 integrin, second generation (Applied Molecular Evolution, USA and MedImmune, US), MAb VEGF (Xenova, UK), marimastat, maspin (Sosei, Japan), metastatin, motuporamine C, M-PGA, ombrabulin, OXI4503, PI 88, platelet factor 4, PPI 2458, ramucirumab, rBPI 21 and BPI-derived antiangiogenic (XOMA, US), regorafenib, SC-236, SD-7784 (Pfizer, US), SDX 103 (University of California at San Diego, US), SG 292 (Telios, US), SU-0879 (Pfizer, US), TAN-1120, TBC-1635, tesevatinib, tetrathiomolybdate, thalidomide, thrombospondin 1 inhibitor. Tie-2 ligands (Regeneron, US), tissue factor pathway inhibitors (EntreMed, US), tumor necrosis factor-alpha inhibitors, tumstatin, TZ 93, urokinase plasminogen activator inhibitors, vadimezan, vandetanib, vasostatin, vatalanib, VE-cadherin-2 antagonists, xanthorrhizol, XL 784 (Exelixis, US), ziv-aflibercept, and ZD 6126.

[0179] In embodiments, the additional anti-cancer agent(s) is an additional active agent that disrupts or inhibits RAS-RAF-ERK or PI3K-AKT-TOR signaling pathways or is a PD-1 and/or PD-L1 antagonist. In embodiments, the additional anti-cancer agent(s) is a RAF inhibitor, EGFR inhibitor, MEK inhibitor, ERK inhibitor, PI3K inhibitor, AKT inhibitor, TOR inhibitor, MCL-1 inhibitor, BCL-2 inhibitor, SHP2 inhibitor, proteasome inhibitor, or immune therapy, including monoclonal antibodies, immunomodulatory imides (IMiDs), anti-PD-1, anti-PDL-1, anti-CTLA4, anti-LAG1, and anti-OX40 agents, GITR agonists, CAR-T cells, and BiTEs.

[0180] Non-limiting examples of RAF inhibitors include dabrafenib, encorafenib, regorafenib, sorafenib, and vemurafenib.

[0181] Non-limiting examples of MEK inhibitors include binimetinib, CI-1040, cobimetinib, PD318088, PD325901, PD334581, PD98059, refametinib, selumetinib, and trametinib.

[0182] Non-limiting examples of ERK inhibitors include LY3214996, LTT462, MK-8353, SCH.sub.772984, ravoxertinib, ulixertinib, and an ERKi as described in WO 2017/068412.

[0183] Non-limiting examples of PI3K inhibitors include 17-hydroxywortmannin analogs (e.g., WO 06/044453); AEZS-136; alpelisib; AS-252424; buparlisib; CAL263; copanlisib; CUDC-907; dactolisib (WO 06/122806); demethoxyviridin; duvelisib; GNE-477; GSK05%15; IC87114; idelalisib; INK1117; LY294002; Palomid 529; paxalisib; perifosine; PI-103; PI-103 hydrochloride; pictilisib (e.g., WO 09/036,082; WO 09/055.730); PIK 90; PWT33597; SF1126; sonolisib; TGI 00-115; TGX-221; XL147; XL-765; wortmannin; and ZSTK474.

[0184] Non-limiting examples of AKT inhibitors include Akt-1-1 (inhibits Aktl) (Barnett et al. (2005) Biochem. J., 385 (Pt. 2), 399-408); Akt-1-1,2 (Barnett et al. (2005) Biochem. J. 385 (Pt. 2), 399-408); API-59CJ-Ome (e.g., Jin et al. (2004) Br. J. Cancer 91, 1808-12); 1-H-imidazo[4,5-c]pyridinyl compounds (e.g, WO05011700); indole-3-carbinol and derivatives thereof (e.g., U.S. Pat. No. 6,656,963; Sarkar and Li (2004) J Nutr. 134(12 Suppl), 34935-3498S); perifosine, Dasmahapatra et al. (2004) Clin. Cancer Res. 10(15), 5242-52, 2004); phosphatidylinositol ether lipid analogues (e.g., Gills and Dennis (2004) Expert. Opin. Investig. Drugs 13, 787-97); triciribine (Yang et al. (2004) Cancer Res. 64, 4394-9); imidazooxazone compounds including trans-3-amino-1-methyl-3-[4-(3-phenyl-5H-imidazo[1,2-c]pyrido[3,4-e][1,3]oxazin-2-yl)phenyl]-cyclobutanol hydrochloride (WO 2012/137870); afuresertib; capivascrtib; MK2206; patasertib, and those disclosed in WO 2011/082270 and WO 2012/177844.

[0185] Non-limiting examples of TOR inhibitors include deforolimus; ATP-competitive TORC1/TORC2 inhibitors, including PI-103, PP242, PP30, and Torin 1; TOR inhibitors in FKBP12 enhancer, rapamycins and derivatives thereof, including temsirolimus, everolimus, WO 9409010; rapalogs, e.g. as disclosed in WO 98/02441 and WO 01/14387, e.g. AP23573, AP23464, or AP23841; 40-(2-hydroxyethyl)rapamycin, 40-[3-hydroxy(hydroxymethyl)methylpropanoate]-rapamycin; 40-epi-(tetrazolyl)-rapamycin (also called ABT578); 32-deoxorapamycin; 16-pentynyloxy-32(S)-dihydrorapanycin, and other derivatives disclosed in WO 05/005434; derivatives disclosed in U.S. Pat. No. 5,258,389, WO 94/090101, WO 92/05179, U.S. Pat. Nos. 5,118,677, 5,118,678, 5,100,883, 5,151,413, 5,120,842, WO 93/111130, WO 94/02136, WO 94/02485, WO 95/14023, WO 94/02136, WO 95/16691, WO 96/41807, WO 96/41807 and U.S. Pat. No. 5,256,790; and phosphorus-containing rapamycin derivatives (e.g., WO 05/016252).

[0186] Non-limiting examples of MCL-1 inhibitors include AMG-176, MIK665, and S63845.

[0187] Non-limiting examples of SHP2 inhibitors include SHP2 inhibitors described in WO 2019/167000 and WO 2020/022323.

[0188] Additional non-limiting examples of anti-cancer agents that are suitable for use include 2-ethylhydrazide, 2,2,2-trichlorotriethylamine, ABVD, aceglatone, acemannan, aldophosphamide glycoside, alpharadin, amifostine, aminolevulinic acid, anagrelide, ANCER, ancestim, anti-CD22 immunotoxins, antitumorigenic herbs, apaziquone, arglabin, arsenic trioxide, azathioprine, BAM 002 (Novelos), bcl-2 (Genta), bestrabucil, biricodar, bisantrene, bromocriptine, brostallicin, bryostatin, buthionine sulfoximine, calyculin, cell-cycle nonspecific antineoplastic agents, celmoleukin, clodronate, clotrimazole, cytarabine ocfosfate, DA 3030 (Dong-A), defofamine, denileukin diftitox, dexrazoxane, diaziquone, dichloroacetic acid, dilazep, discodermolide, docosanol, doxercalciferol, edelfosine, eflornithine, EL532 (Elan), elfomithine, elsamitrucin, eniluracil, etanidazole, exisulind, ferruginol, folic acid replenisher such as frolinic acid, gacytosine, gallium nitrate, gimeracil/oteracil/tegafur combination (S-1), glycopine, histamine dihydrochloride, HIT diclofenac, HLA-B7 gene therapy (Vical), human fetal alpha fetoprotein, ibandronate, ibandronic acid, ICE chemotherapy regimen, imexon, iobenguane, IT-101 (CRLX101), laniquidar, LC 9018 (Yakult), leflunomide, lentinan, levamisole+fluorouracil, lovastatin, lucanthone, masoprocol, melarsoprol, metoclopramide, miltefosine, miproxifene, mitoguazone, mitozolomide, mopidamol, motexafin gadolinium, MX6 (Galderma), naloxone+pentazocine, nitracrine, nolatrexed, NSC 631570 octreotide (Ukrain), olaparib, P-30 protein, PAC-1, palifermin, pamidronate, pamidronic acid, pentosan polysulfate sodium, phenamet, picibanil, pixantrone, platinum, podophyllinic acid, porfimer sodium, PSK (Polysaccharide-K), rabbit antithymocyte poly-clonal antibody, rasburiembodiment, retinoic acid, rhenium Re 186 etidronate, romurtide, samarium (153 Sm) lexidronam, sizofiran, sodium phenylacetate, sparfosic acid, spirogermanium, strontium-89 chloride, suramin, swainsonine, talaporfin, tariquidar, tazarotene, tegafur-uracil, temoporfin, tenuazonic acid, tetrachlorodecaoxide, thrombopoietin, tin ethyl etiopurpurin, tirapazamine, TLC ELL-12, tositumomab-iodine 131, trifluridine and tipiracil combination, troponin I (Harvard University, US), urethan, valspodar, verteporfin, zoledronic acid, and zosuquidar.

[0189] The present disclosure further provides a method for using the compounds of Formula (I) or (Ia) or pharmaceutical compositions provided herein, in combination with radiation therapy to treat cancer. Techniques for administering radiation therapy are known in the art, and these techniques can be used in the combination therapy described herein. The administration of the compound of Formula (I) or (Ia) in this combination therapy can be determined as described herein.

[0190] Radiation therapy can be administered through one of several methods, or a combination of methods, including, without limitation, external-beam therapy, internal radiation therapy, implant radiation, stereotactic radiosurgery, systemic radiation therapy, radiotherapy and permanent or temporary interstitial brachy therapy. The term brachytherapy, as used herein, refers to radiation therapy delivered by a spatially confined radioactive material inserted into the body at or near a tumor or other proliferative tissue disease site. The term is intended, without limitation, to include exposure to radioactive isotopes (e.g., At-211, I-131, I-125, Y-90, Re-186, Re-188, Sm-153, Bi-212, P-32, and radioactive isotopes of Lu). Suitable radiation sources for use as a cell conditioner of the present disclosure include both solids and liquids. By way of non-limiting example, the radiation source can be a radionuclide, such as I-125, I-131. Yb-169, Ir-192 as a solid source, I-125 as a solid source, or other radionuclides that emit photons, beta particles, gamma radiation, or other therapeutic rays. The radioactive material can also be a fluid made from any solution of radionuclide(s), e.g., a solution of I-125 or I-131, or a radioactive fluid can be produced using a slurry of a suitable fluid containing small particles of solid radionuclides, such as Au-198, Y-90. Moreover, the radionuclide(s) can be embodied in a gel or radioactive microspheres.

[0191] The present disclosure also provides methods for combination therapies in which the additional active agent is known to modulate other pathways, or other components of the same pathway, or even overlapping sets of target enzymes which are used in combination with a compound of Formula (I) or (Ia), or a pharmaceutically acceptable salt thereof. In one embodiment, such therapy includes, but is not limited to, the combination of one or more compounds of Formula (I) or (Ia) with chemotherapeutic agents, immunotherapeutic agents, hormonal therapy agents, therapeutic antibodies, targeted therapy agents, and radiation treatment, to provide a synergistic or additive therapeutic effect.

[0192] The compounds of the disclosure can be used in combination with the agents disclosed herein or other suitable agents, depending on the condition being treated. Hence, in some embodiments the one or more compounds of the disclosure will be co-administered with other agents as described above. When used in combination therapy, the compounds described herein are administered with the second agent simultaneously or separately. This administration in combination can include simultaneous administration of the two agents in the same dosage form, simultaneous administration in separate dosage forms, and separate administration. That is, a compound of Formula (I) or (Ia) and any of the agents described above can be formulated together in the same dosage form and administered simultaneously. Alternatively, a compound of Formula (I) or (Ia) and any of the agents described above can be simultaneously administered, wherein both the agents are present in separate formulations. In another alternative, a compound of Formula (I) or (Ia) can be administered just followed by and any of the agents described above, or vice versa. In some embodiments of the separate administration protocol, a compound of Formula (I) or (Ia) and any of the agents described above are administered a few minutes apart, or a few hours apart, or a few days apart.

[0193] As one aspect of the present disclosure contemplates the treatment of the disease/conditions with a combination of pharmaceutically active compounds that may be administered separately, the disclosure further relates to combining separate pharmaceutical compositions in kit form. The kit comprises two separate pharmaceutical compositions: a compound of Formula (I) or (Ia), and a second pharmaceutical compound. The kit comprises a container for containing the separate compositions such as a divided bottle or a divided foil packet. Additional examples of containers include syringes, boxes, and bags. In some embodiments, the kit comprises directions for the use of the separate components. The kit form is particularly advantageous when the separate components are preferably administered in different dosage forms (e.g., oral and parenteral), are administered at different dosage intervals, or when titration of the individual components of the combination is desired by the prescribing health care professional.

[0194] The present disclosure also provides for the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, for use in therapy, or use of the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, in therapy. The present disclosure also provides for the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, for use in treating cancer, or use of a compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, for treating cancer. The present disclosure also provides for the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, for the preparation of a medicament for the treatment of cancer, or use of the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, for the preparation of a medicament for the treatment of cancer. The present disclosure also provides for the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, and an additional anti-cancer agent, for use in the treatment of cancer, or use of the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, and the additional anti-cancer agent for treating cancer. The disclosure also provides the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, and an additional anti-cancer agent, for the preparation of a medicament for the treatment of cancer, or use of the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, and the additional anti-cancer agent, for the preparation of a medicament for the treatment of cancer. The present disclosure also provides for a pharmaceutical composition comprising the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, for use in the treatment of cancer, or use of the pharmaceutical composition comprising the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, for treating cancer. The present disclosure also provides for a pharmaceutical composition comprising the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, and an additional anti-cancer agent, for use in the treatment of cancer, or use of the pharmaceutical composition comprising the compound of Formula (I) or (Ia), or the pharmaceutically acceptable salt thereof, and the additional anti-cancer agent, for treating cancer.

Methods of Preparing the Compounds of the Disclosure

[0195] The compounds described herein can be prepared according to the procedures of the following schemes and examples, using appropriate materials and are further exemplified by the following specific examples. The examples further illustrate details for the preparation of the compounds of the present disclosure. Those skilled in the art will readily understand that known variations of the conditions and processes of the following preparative procedures can be used to prepare these compounds. For instance, in some cases, the order of carrying out the steps of reaction schemes may be varied to facilitate the reaction or to avoid unwanted reaction products. These examples are provided for the purpose of further illustration only and are not intended to be limitations on the disclosure.

[0196] Disclosure of a compound likewise discloses a pharmaceutically acceptable salt of the compound, and disclosure of a pharmaceutically acceptable salt of a compound likewise discloses the compound, i.e., the non-salt or un-ionized form of the compound, or an alternative pharmaceutically acceptable salt of the compound, as would be readily understood by one of ordinary skill in the art.

[0197] Throughout the synthetic schemes and examples, abbreviations and acronyms may be used with the following meanings unless otherwise indicated: aq.: aqueous, c./con./conc.: concentrated, sat.: saturated, s: singlet, d: doublet, t: triplet, q: quartet, sep: septet, dd: double doublet, dt: double triplet, td: triple doublet, tt: triple triplet, ddd: double double doublet, ddt: double double triplet, dtd: double triple doublet, tdd: triple double doublet, m: multiplet, br: broad, brs: broad singlet, tert: tertiary, Ac: acetyl, AcOH: acetic acid, AIBN: azobisisobutyronitrile, Boc.sub.2O: Di-tert-butyl dicarbonate, Bu: butyl, CDCl.sub.3: deuterated chloroform, CD.sub.3OD: deuterated methanol, CELITE: diatomaceous earth, DCM: dichloromethane, DIAD: diisopropyl azodicarboxylate, DIEA: N,N-diisopropylethylamine, DIPEA: N,N-diisopropylethylamine, DMA: dimethylacetamide, DMB: 2,4-dimethoxybenzyl, DME: 1,2-dimethoxyethane, DMF: N,N-dimethylformamide, DMP: Dess-Martin periodinane, DMSO: dimethyl sulfoxide, DMSO-d: deuterated dimethyl sulfoxide, Et: ethyl, EtOAc: ethyl acetate, EtOH: ethanol, Et.sub.3N: triethylamine, EtOvinyl-B: 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane, HATU: 1-[Bis(dimethylamino)methylene]-1H-1,2,3-triazolo[4,5-b]pyridinium 3-Oxide Hexafluorophosphate, HPLC: High pressure liquid chromatography, Indolizine-B: (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone, IPE: diisopropyl ether, iPr: isopropyl, KOAc: potassium acetate, Me: methyl, MeOH: methanol, MTBE: methyl tert-butyl ether, NBS: N-bromosuccinimide=1-bromopyrrolidine-2,5-dione, NIS: N-iodosuccinimide, NMP: N-methylpyrrolidone, Pd(dppf)Cl.sub.2: [1,1-Bis(diphenylphosphino)ferrocene]dichloropalladium(II), Ph: phenyl, RT: room temperature, SFC: supercritical fluid chromatography, SPhos Pd G3: (2-Dicyclohexylphosphino-2,6-dimethoxybiphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate, TEA: tridthylamine, TFA: trifluoroacetic acid, TFAA: trifluoroacetic anhydride, THF: tetrahydrofuran, TLC: thin layer chromatography, TMAD: N,N,N,N-tetramethylazodicarboxamide, T3P: propanephosphonic acid anhydride.

[0198] The reagents used in the Examples are commercially available products unless indicated otherwise. Prepacked columns manufactured by Shoko Scientific Co., Ltd., or Biotage were used in silica gel column chromatography and basic silica gel column chromatography. AVANCE NEO 400 spectrometer (400 MHz; BRUKER) and AVANCE III HD 500 spectrometer (500 MHz; BRUKER) were used for NMR spectra. For a deuterated solvent containing tetramethylsilane, tetramethylsilane was used as the internal reference. For other cases, measurement was performed using an NMR solvent as the internal reference. All ? values are indicated in ppm. Microwave reaction was performed using an Initiator (trademark) manufactured by Biotage. XSelect CSH C18 OBD Prep Columns manufactured by Waters were used for preparative reversed-phase HPLC.

Synthetic Procedure A

Example 1-1 and 1-2

(E)-N-(4-(10-chloro-4,5-dihydrobenzo[7,8][1,4]oxazocino[6,5,4-hi]indole-1-carbonyl)-2,6-difluorophenyl-4-(((1r,4r)-4-methoxycyclohexyl)amino)but-2-enamide

Step 1:

[0199] ##STR00022##

[0200] 2-(2-bromoethoxy)tetrahydropyran (715 ?L, 4.72 mmol) was added to a suspension of 3-chloro-2-iodo-phenol (1.00 g, 3.52 mmol) and K.sub.2CO.sub.3 (815 mg, 5.90 mmol) in DMF (7.9 mL). After stirring at 60? C. for 4.5 h, the reaction mixture was diluted with EtOAc, washed with H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining 2-(2-(3-chloro-2-iodophenoxy)ethoxy)tetrahydro-2H-pyran (1.31 g, 87%).

Step 2:

[0201] ##STR00023##

[0202] A solution of 2-(2-(3-chloro-2-iodophenoxy)ethoxy)tetrahydro-2H-pyran (360 mg, 0.941 mmol), (7-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (474 mg, 1.22 mmol), Pd(PPh.sub.3).sub.4 (109 mg, 0.0941 mmol) in 1,4-Dioxane (4.9 mL) and 2M Na.sub.2CO.sub.3 aq. (917 ?L, 1.83 mmol) was evacuated and N.sub.2 back-filled before heating to 100? C. for 14.5 h. After cooling, the reaction mixture was diluted with CHCl.sub.3, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining (7-(2-chloro-6-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethoxy)phenyl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (383 mg, 77%).

Step 3:

[0203] ##STR00024##

[0204] TFA (5.2 mL, 71 mmol) was added to a solution of (7-(2-chloro-6-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethoxy)phenyl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (374 mg, 0.706 mmol) in CHCl.sub.3 (1.4 mL). After stirring at RT for 1 h, the reaction mixture was evaporated and purified by column chromatography on NH silica gel (hexane/EtOAc), thereby obtaining (7-(2-chloro-6-(2-hydroxyethoxy)phenyl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (278 mg, 88%).

Step 4:

[0205] ##STR00025##

[0206] DIAD (543 ?L, 2.76 mmol) was added to a solution of (7-(2-chloro-6-(2-hydroxyethoxy)phenyl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (246 mg, 0.552 mmol) and PPh.sub.3 (724 mg, 2.76 mmol) in DMF (28 mL) at 0? C. After stirring at RT for 20 min, the reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. A seed of diisopropyl hydrazine-1,2-dicarboxylate compound with triphenylphosphine oxide (1:1) was added to the residue, and the resulting solid was suspended in MTBE (2.5 mL) and heptane (7.5 mL) at RT. The resulting suspension was filtered, rinsing with heptane, and the filtrate was evaporated and purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining (10-chloro-4,5-dihydrobenzo[7,8][1,4]oxazocino[6,5,4-hi]indol-1-yl)(3,4,5-trifluorophenyl)methanone (115 mg, 51%).

Step 5:

[0207] ##STR00026##

[0208] 28% NH; aq. (11.5 mL, 82.7 mmol) was added to (10-chloro-4,5-dihydrobenzo[7,8][1,4]oxazocino[6,5,4-hi]indol-1-yl)(3,4,5-trifluorophenyl)methanone (118 mg, 0.276 mmol) in 1,4-Dioxane (1.2 mL). The reaction mixture was heated at 130? C., by microwave irradiation for 14 h. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining (4-amino-3,5-difluorophenyl)(10-chloro-4,5-dihydrobenzo[7,8][1,4]oxazocino[6,5,4-hi]indol-1-yl)methanone (98.2 mg, 84%).

Step 6:

[0209] ##STR00027##

[0210] A solution of (4-amino-3,5-difluorophenyl)(10-chloro-4,5-dihydrobenzo[7,8][1,4]oxazocino[6,5,4-hi]indol-1-yl)methanone (98.2 mg, 0.231 mmol), 4-chlorocrotonic acid (36 mg, 0.30 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 217 ?L, 0.347 mmol) in DMF (770 ?L) was stirred at RT for 15 min. Then Et3N (80.6 ?L, 0.578 mmol) was added thereto, and the mixture was stirred at RT for 2.5 h. The reaction mixture was diluted with H.sub.2O and sat. NaHCO.sub.3 aq. then stirred at RT. The resulting solid was collected by filtration and vacuum-dried at RT, thereby obtaining crude (E)-4-chloro-N-(4-(10-chloro-4,5-dihydrobenzo[7.8][1,4]oxazocino[6,5,4-hi]indole-1-carbonyl)-2,6-difluorophenyl)but-2-enamide (99.8 mg, 82%).

Step 7:

[0211] ##STR00028##

[0212] A solution of crude (E)-4-chloro-N-(4-(10-chloro-4,5-dihydrobenzo[7,8][1,4]oxazocino[6,5,4-hi]indole-1-carbonyl)-2,6-difluorophenyl)but-2-enamide (99.8 mg, 0.189 mmol), trans-4-methoxycyclohexanamine hydrochloride (94 mg, 0.57 mmol), KI (94 mg, 0.57 mmol) and K.sub.3PO.sub.4 (281 mg, 1.32 mmol) in DMF (630 ?L) was stirred at RT for 2 h. The reaction mixture was diluted with H.sub.2O then stirred at RT for 1 h. The resulting solid was collected by filtration and vacuum-dried at RT. The obtained solid was purified by column chromatography on silica gel (CHCl.sub.3 (1% Et.sub.3N)/MeOH), thereby obtaining the racemic title compound (74.2 mg, 63%). The racemate (70 mg) was separated by CHIRALPAK IE (hexane-EtOH (0.1% Et.sub.3N)) to give the title compound (Example 1-1, 27.6 mg, 40%; single isomer, 1st-eluting isomer and Example 1-2, 27.3 mg, 39%; single isomer, 2nd-eluting isomer). .sup.1H NMR: (500 MHz, CHLOROFORM-D) ? 8.48 (dd, J=7.6, 1.5 Hz, 1H), 7.53 (s, 1H), 7.47-7.40 (m, 5H), 7.37 (t, J=8.0 Hz, 1H), 7.20-7.07 (m, 31H), 6.26 (d, J=15.6 Hz, 1H), 4.61-4.55 (m, 1H), 4.41-4.32 (m, 1H), 4.12 (dd, J=11.6, 2.4 Hz, 1H), 3.91 (dd, 1=15.1, 2.3 Hz, 1H), 3.52 (dd, J=5.2, 1.2 Hz, 2H), 3.35 (s, 3H), 3.18-3.12 (m, 1H), 2.58-2.51 (m, 1H), 2.09 (d, J=10.1 Hz, 2H), 1.9) (d, J=11.9 Hz, 2H), 1.33-1.11 (m, 4H); ESI [M+H].sup.+: 620.5.

Synthetic Procedure B

Example 12-1 and 12-2

[0213] (E)-N-(4-(8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzol[1,2:7,8][1,4]oxazocino[6,5,4-hi]indole-2-carbonyl)-2,6-difluorophenyl)-4-(((1r,4r)-4-methoxycyclohexyl)amino)but-2-enamide

Step 1:

[0214] ##STR00029##

[0215] BBr.sub.3 (1.0 M in CH.sub.2Cl.sub.2, 13.3 mL, 13.3 mmol) was added to a solution of 5-iodo-4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazole (493 mg, 1.33 mmol) in CH.sub.2Cl.sub.2 (6.2 mL) at 0? C. After stirring at RT for 16 h, the reaction mixture was cooled to 0? C., then CHCl.sub.3/MeOH and sat. NaHCO.sub.3 aq. were added to the reaction mixture slowly. The insoluble solid was filtered, washed with H.sub.2O and CHCl.sub.3, and vacuum-dried at 60? C. The organic layer was dried over NaSO.sub.4 and evaporated. The residue and filter cake were suspended in CHCl.sub.3 (7 mL), stirred at RT. The solid was collected by filtration, washed with further CHCl.sub.3 and vacuum-dried at 60? C., thereby obtaining 5-iodo-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-ol (455 mg, 96%).

Step 2:

[0216] ##STR00030##

[0217] 2-(2-bromoethoxy)tetrahydropyran (290 ?L, 1.92 mmol) was added to a suspension of 5-iodo-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-ol (455 mg, 1.28 mmol) and K.sub.2CO.sub.3 (265 mg, 1.92 mmol) in DMF (6.4 mL). After stirring at 60? C. for 2.5 h, the reaction mixture was diluted with EtOAc, washed with H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining 5-iodo-1,2-dimethyl-4-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethoxy)-6-(trifluoromethyl)-1H-benzo[d]imidazole (334 mg, 54%).

Step 3:

[0218] ##STR00031##

[0219] A solution of 5-iodo-1,2-dimethyl-4-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethoxy)-6-(trifluoromethyl)-1H-benzo[d]imidazole (169 mg, 0.349 mmol), (7-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (270 mg, 0.698 mmol). Pd(PPh.sub.3).sub.4 (40 mg, 0.035 mmol) in 1,4-Dioxane (3.5 mL) and 2M Na.sub.2CO.sub.3 aq. (523 ?L, 1.05 mmol) was evacuated and N.sub.2 back-filled before heating to 120? C. by microwave irradiation for 5 h. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining (7-(1,2-dimethyl-4-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethoxy)-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (121 mg, 55%).

Step 4:

[0220] ##STR00032##

[0221] TFA (2.6 mL, 35 mmol) was added to a solution of (7-(1,2-dimethyl-4-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethoxy)-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (217 mg, 0.344 mmol) in CHCl.sub.3 (688 ?L). After stirring at RT for 30 min, the reaction mixture was evaporated and purified by column chromatography on NH silica gel (CHCl.sub.3/MeOH), thereby obtaining (7-(4-(2-hydroxyethoxy)-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (182 mg, 97%).

Step 5:

[0222] ##STR00033##

[0223] DIAD (467 ?L, 2.37 mmol) was added to a solution of (7-(4-(2-hydroxyethoxy)-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (173 mg, 0.316 mmol) and PPh.sub.3 (622 mg, 2.37 mmol) in DMF (16 mL) at 0? C. After stirring at RT for 10 min, the reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq., H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was suspended in isopropyl ether, stirred at RT. The resulting solid was removed by filtration, washing with further isopropyl ether, and the filtrate was evaporated. A seed of diisopropyl hydrazine-1,2-dicarboxylate compound with triphenylphosphine oxide (1:1) was added to a solution of the residue in isopropyl ether at RT. The resulting suspension was filtered, rinsing with isopropyl ether, and the filtrate was evaporated and purified by column chromatography on silica gel (CHCl.sub.3/MeOH). The obtained gum was dissolved in isopropyl ether, and a seed of diisopropyl hydrazine-1,2-dicarboxylate compound with triphenylphosphine oxide (1:1) was added, stirred at RT. The resulting solid was removed by filtration, washing with further isopropyl ether, and the filtrate was evaporated, thereby obtaining crude (8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indol-2-yl)(3,4,5-trifluorophenyl)methanone (330 mg, 197%).

Step 6:

[0224] ##STR00034##

[0225] 28% NH.sub.3 aq. (13.2 mL, 94.8 mmol) was added to crude (8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indol-2-yl)(3,4,5-trifluorophenyl)methanone (330 mg) in 1,4-Dioxane (1.7 mL). The reaction mixture was heated at 130? C. by microwave irradiation for 12 h. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining crude (4-amino-3,5-difluorophenyl)(8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indol-2-yl)methanone (118 mg, 71%).

Step 7:

[0226] ##STR00035##

[0227] A solution of crude (4-amino-3,5-difluorophenyl)(8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indol-2-yl)methanone (118 mg), 4-chlorocrotonic acid (47 mg, 0.39 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 246 ?L, 0.393 mmol) in DMF (1.1 mL) was stirred at RT for 25 min. Then Et.sub.3N (110 ?L, 0.786 mmol) was added thereto, and the mixture was stirred at RT for 2 h. Further 4-chlorocrotonic acid (47 mg, 0.39 mmol), propylphosphonic anhydride solution (50 wt % in THF, 246 ?L, 0.393 mmol) and Et.sub.3N (110 ?L, 0.786 mmol) were added and stirring continued for 30 min. The reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq., H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining crude (E)-4-chloro-N-(4-(8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indole-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (97.6 mg, 69%).

Step 8:

[0228] ##STR00036##

[0229] A solution of crude (E)-4-chloro-N-(4-(8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indole-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (97.6 mg), trans-4-methoxycyclohexanamine hydrochloride (77 mg, 0.47 mmol). KI (77 mg, 0.47 mmol) and K.sub.3PO.sub.4 (198 mg, 0.931 mmol) in DMF (775 ?L) was stirred at RT for 1.5 h. The reaction mixture was diluted with EtOAc, washed with H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by preparative HPLC (water:acetonitrile (0.1% formic acid)). The purified fractions were washed with sat. NaHCO.sub.3 aq., extracted with CHCl.sub.3/MeOH then dried over Na.sub.2SO.sub.4 and evaporated, thereby obtaining the racemic title compound (37.0 mg, 33%). The racemate (28 mg) was separated by CHIRAL ART SB(YMC) (hexane-EtOH (0.1% Et.sub.3N)) to give the title compound (Example 12-1, 8.60 mg, 31%; single isomer, 1st-eluting isomer and Example 12-2, 8.94 mg, 32%, single isomer, 2nd-eluting isomer). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 8.48 (dd, J=8.0, 1.3 Hz, 1H), 7.69 (s, 1H), 7.54 (s, 1H), 7.45-7.35 (m, 3H), 7.31-7.25 (m, 1H), 7.11 (dt, 3=15.3, 5.3 Hz, 1H), 6.26 (dt, J=15.3, 1.6 Hz, 1H), 4.59-4.38 (m, 3H), 3.93-3.82 (m, 4H), 3.50 (dd, J=5.3, 1.8 Hz, 2H), 3.35 (s, 3H), 3.18-3.11 (m, 1H), 2.69 (s, 3H), 2.58-2.48 (m, 1H), 2.15-1.90 (m, 4H), 1.32-1.09 (m, 4H); ESI-MS [M+H].sup.+: 722.6

Synthetic Procedure C

Example 26

(E)-N-(4-(13,13-difluoro-6,8,9-trimethyl-13,14-dihydro-8H,12H-imidazo[4,5:3,4]benzol[1,2:8,9][1,5]oxazonino[7,6,5-hi]indole-2-carbonyl)-2,6-difluorophenyl)-4-(((1r,4r)-4-methoxy cyclohexyl)amino)but-2-enamide

Step 1:

[0230] ##STR00037##

[0231] To a mixture of 5-iodo-4-methoxy-1,2,6-trimethyl-1H-benzo[d]imidazole (900 mg, 2.85 mmol), [7-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)-1H-indol-3-yl]-(3,4,5-trifluorophenyl)methanone (1.27 g, 3.27 mmol) and Pd(PPh.sub.3).sub.4 (329 mg, 0.285 mmol) in 1,2-dimethoxyethane (18.2 mL) was added 2M aqueous sodium carbonate solution (5.69 mL, 11.4 mmol). After reacting by microwave apparatus at 120? C. for 2 hours, the mixture was diluted with EtOAc and water. The organic layer was washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (acetone-hexane), thereby obtaining (7-(4-methoxy-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (1.61 g, 3.47 mmol).

Step 2:

[0232] ##STR00038##

[0233] Sodium hydride (514 mg, 21.4 mmol) was added to a solution of 2,2-difluoropropane-1,3-diol (2.00 g, 17.8 mmol) in THF (60.0 mL) at 0? C. After the reaction mixture was stirred at 0? C. for 15 minutes, tert-Butylchlorodiphenylsilane (4.80 mL, 18.7 mmol) was added and the mixture was stirred at ambient temperature for 1 hour. To the resulting mixture was added saturated aqueous NaHCO.sub.3, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (EtOAc-hexane), thereby obtaining 3-((tert-butyldiphenylsilyl)oxy)-2,2-difluoropropan-1-ol (4.62 g, 13.2 mmol).

Step 3:

[0234] ##STR00039##

[0235] Trifluoromethanesulfonic anhydride (3.76 mL, 26.4 mmol) was added to a mixture of 3-((tert-butyldiphenylsilyl)oxy)-2,2-difluoropropan-1-ol (4.62 g, 13.2 mmol) and 2,6-lutidine (4.58 mL, 39.5 mmol) in CH.sub.2Cl.sub.2 (50.0 mL) at 0? C. The reaction mixture was stirred at ambient temperature for 3 hours. To the resulting mixture was added CHCl.sub.3 and 1M HCL, and extracted with CHCl.sub.3, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (EtOAc-hexane), thereby obtaining 3-((tert-butyldiphenylsilyl)oxy)-2,2-difluoropropyl trifluoromethanesulfonate (4.16 g, 8.62 mmol).

Step 4:

[0236] ##STR00040##

[0237] To a mixture of (7-(4-methoxy-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (200 mg, 0.432 mmol) and potassium carbonate (179 mg, 1.29 mmol) in DMF (2.00 mL) was added 3-((tert-butyldiphenylsilyl)oxy)-2,2-difluoropropyl trifluoromethanesulfonate (400 ?L, 0.863 mmol). After the mixture was stirred at 60? C. for 6 hours, the mixture was diluted with EtOAc and water. The organic layer was washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (EtOAc-hexane), thereby obtaining (1-(3-((tert-butyldiphenylsilyl)oxy)-2,2-difluoropropyl)-7-(4-methoxy-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (259 mg, 0.326 mmol).

Step 5:

[0238] ##STR00041##

[0239] Boron tribromide (1.60 M in CH.sub.2Cl.sub.2. 2.75 mL, 4.39 mmol) was added to (1-(3-((tert-butyldiphenylsilyl)oxy)-2,2-difluoropropyl)-7-(4-methoxy-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (259 mg, 0.325 mmol) in CH.sub.2Cl.sub.2 (2.20 mL). After the mixture was stirred at 35? C. for 2 hours, the mixture was cooled to ambient temperature. The mixture was diluted with CHCl.sub.3 and quenched by NH.sub.3, and extracted with CHCl.sub.3, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was used for the next reaction without further purification.

[0240] Tetra-n-butyl ammonium fluoride (1.00 M in THF, 975 ?L, 0.975 mmol) was added to a solution of (1-(3-((tert-butyldiphenylsilyl)oxy)-2,2-difluoropropyl)-7-(4-hydroxy-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (254 mg, 0.325 mmol) in THE (3.00 mL). After the mixture was stirred at ambient temperature for 30 minutes, the reaction mixture was evaporated. The residue was purified by column chromatography on silica gel (methanol-acetone-hexane), thereby obtaining (1-(2,2-difluoro-3-hydroxypropyl)-7-(4-hydroxy-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (122 mg, 0.224 mmol).

Step 6:

[0241] ##STR00042##

[0242] To a mixture of (1-(2,2-difluoro-3-hydroxypropyl)-7-(4-hydroxy-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (122 mg, 0.224 mmol) and tri-n-butylphosphine (112 ?L, 0.449 mmol) in THF (12.1 mL) was added N,N,N,N-tetramethylazodicarboxamide (77.3 mg, 0.449 mmol). After the mixture was stirred at 40? C. for 2 hours, the reaction mixture was evaporated. The residue was purified by column chromatography on silica gel (acetone-hexane), thereby obtaining (13,13-difluoro-6,8,9-trimethyl-13,14-dihydro-8H,12H-imidazo[4,5:3,4]benzo[1,2:8,9][1,5]oxazonino[7,6,5-hi]indol-2-yl)(3,4,5-trifluorophenyl)methanone (84.4 mg, 0.161 mmol).

Step 7:

[0243] ##STR00043##

[0244] To a mixture of (13,13-difluoro-6,8,9-trimethyl-13,14-dihydro-8H,12H-imidazo[4,5:3,4]benzo[1,2:8,9][1,5]oxazonino[7,6,5-hi]indol-2-yl)(3,4,5-trifluorophenyl)methanone (84.0 mg, 0.160 mmol) in 1,4-dioxane (400 ?L) was added ammonium hydroxide (3.40 mL, 29.0 mmol). After reacting by microwave apparatus at 130? C. for 14 hours, the mixture was diluted with EtOAc and water. The organic layer was washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated, thereby obtaining crude (4-amino-3,5-difluorophenyl)(13,13-difluoro-6,8,9-trimethyl-13,14-dihydro-8H,12H-imidazo[4,5:3,4]benzo[1,2:8,9][1,5]oxazonino[7,6,5-hi]indol-2-yl)methanone (113 mg, 0.220 mmol).

Step 8:

[0245] ##STR00044##

[0246] A solution of (4-amino-3,5-difluorophenyl)(13,13-difluoro-6,8,9-trimethyl-13,14-dihydro-8H,12H-imidazo[4,5:3,4]benzo[1,2:8,9][1,5]oxazonino[7,6,5-hi]indol-2-yl)methanone (69.0 mg, 0.132 mmol), 4-chlorocrotonic acid (23.9 mg, 0.198 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 248 ?L, 0.396 mmol) in DMF (1.00 mL) was stirred at ambient temperature for 20 minutes. Then triethylamine (110 ?L, 0.792 mmol) was added thereto, and the mixture was stirred at 35? C. for 30 minutes. To the resulting mixture was added saturated aqueous NaHCO.sub.3, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was used for the next reaction without further purification.

[0247] A solution of (E)-4-chloro-N-(4-(13,13-difluoro-6,8,9-trimethyl-13,14-dihydro-8H,12H-imidazo[4,5:3,4]benzo[1,2:8,9][1,5]oxazonino[7,6,5-hi]indole-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (82.5 mg, 0.132 mmol), trans-4-methoxycyclohexanamine hydrochloride (43.7 mg, 0.264 mmol). KI (65.7 mg, 0.396 mmol) and K.sub.3PO.sub.4 (112 mg, 0.528 mmol) in DMF (1.00 mL) was stirred at 35? C. for 1 hour. To the resulting mixture was added saturated aqueous NaHCO.sub.3, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by preparative HPLC (water:acetonitrile (0.1% formic acid)) to give the title compound (38.7 mg, 0.0539 mmol). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 8.46 (dd, J=8.0, 1.3 Hz, 1H), 7.60 (d, J=2.0 Hz, 1H), 7.52-7.47 (m, 2H), 7.41 (t, J=7.8 Hz, 1H), 7.16-7.09 (m, 3H), 6.25 (d, J=15.3 Hz, 1H), 5.81-5.70 (m, 1H), 4.81 (dd, J=26.1, 14.6 Hz, 1H), 4.56 (td, J=14.5, 9.9 Hz, 1H), 4.09-4.01 (m, 1H), 3.75 (s, 3H), 3.52 (dd, J=5.3, 1.5 Hz, 2H), 3.35 (s, 3H), 3.19-3.12 (m, 1H), 2.64 (s, 3H), 2.58-2.51 (m, 1H), 2.34 (s, 3H), 2.10-1.98 (m, 4H), 1.34-1.10 (m, 4H); ESI-MS [M+H]+: 718.4.

Synthetic Procedure D

Example 27

(E)-N-(2,6-difluoro-4-(6,8,9-trimethyl-8,11,12,13-tetrahydroimidazo[4,5:3,4]benzo[1,2:4,5]azocino[3,2,1-hi]indole-2-carbonyl)phenyl)-4-(((1r,4r)-4-methoxycyclohexyl)amino)but-2-enamide

Step 1:

[0248] ##STR00045##

[0249] Methylamine (2M THF solution, 22.4 mL, 44.9 mmol) was added to a solution of 1-bromo-3-fluoro-5-methyl-2-nitrobenzene (3.50 g, 15.0 mmol) in DMSO (30.0 mL). After stirring at ambient temperature for 5 hours, EtOAc and saturated aqueous NaHCO.sub.3 were added to the reaction mixture, then extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. Thereby obtaining crude 3-bromo-N,5-dimethyl-2-nitroaniline (3.75 g, 15.3 mmol).

Step 2:

[0250] ##STR00046##

[0251] N-Iodosuccinimide (3.54 g, 15.7 mmol) was added to a solution of 3-bromo-N,5-dimethyl-2-nitroaniline (3.67 g, 15.0 mmol) in acetic acid (70.0 mL). After the mixture was stirred at 50? C. for 10 minutes, the mixture was cooled to ambient temperature and water (150 mL) was added to the reaction mixture. The resulting solid was collected by filtration, and vacuum-dried at 50? C. for 1 day, thereby obtaining crude 3-bromo-4-iodo-N,5-dimethyl-2-nitroaniline (5.14 g, 13.9 mmol)

Step 3:

[0252] ##STR00047##

[0253] Acetic anhydride (6.23 mL, 64.7 mmol) was added to 3-bromo-4-iodo-N,5-dimethyl-2-nitroaniline (3.00 g, 8.09 mmol). After the mixture was stirred at 180? C. for 2 hours, the mixture was cooled to ambient temperature and water (10.0 mL) was added to the reaction mixture. The resulting solid was collected by filtration, and vacuum-dried at 50? C. for 1 day, thereby obtaining crude N-(3-bromo-4-iodo-5-methyl-2-nitrophenyl)-N-methylacetamide (2.69 g, 6.50 mmol).

[0254] Iron (2.53 g, 45.3 mmol) was added to a solution of N-(3-bromo-4-iodo-5-methyl-2-nitrophenyl)-N-methylacetamide (2.69 g, 6.50 mmol) in acetic acid (10.0 mL). After the mixture was stirred at 90? C. for 10 minutes, the mixture was cooled to ambient temperature. EtOAc was added to the reaction mixture and insoluble matter was filtered off through CELITE pad and the mixture was extracted with EtOAc and H.sub.2O, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (methanol-EtOAc-hexane), thereby obtaining 4-bromo-5-iodo-1,2,6-trimethyl-1H-benzo[d]imidazole (1.94 g, 5.31 mmol).

Step 4:

[0255] ##STR00048##

[0256] To a mixture of (7-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (223 mg, 0.58 mmol), 4-bromo-5-iodo-1,2,6-trimethyl-1H-benzo[d]imidazole (150 mg, 0.41 mmol) and Pd(PPh.sub.3).sub.4 (47.5 mg, 0.041 mmol) in 1,2-dimethoxyethane (2.0 mL) was added 2M aqueous sodium carbonate solution (0.411 mL, 0.82 mmol). After reacting by microwave apparatus at 110? C. for 2 hrs, the mixture was diluted with EtOAc and water. The organic layer was washed with brine, dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (CHCl.sub.3-methanol) to give (7-(4-bromo-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (184 mg).

Step 5:

[0257] ##STR00049##

[0258] To a mixture of (7-(4-bromo-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (158 mg), (E)-4,4,5,5-tetramethyl-2-(3-((tetrahydro-2H-pyran-2-yl)oxy)prop-1-en-1-yl)-1,3,2-dioxaborolane (250 mg, 0.93 mmol) and Pd(PPh.sub.3).sub.4 (35.6 mg, 0.031 mmol) in 1,2-dimethoxyethane (4.0 mL) was added 2M aqueous sodium carbonate solution (0.463 mL, 0.93 mmol). After reacting by microwave apparatus at 120? C. for 6 hrs, the mixture was diluted with EtOAc and water. The organic layer was washed with brine, dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (CHCl.sub.1-methanol) to give crude (E)-(3,4,5-trifluorophenyl)(7-(1,2,6-trimethyl-4-(3-((tetrahydro-2H-pyran-2-yl)oxy)prop-1-en-1-yl)-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)methanone (116 mg).

Step 6:

[0259] ##STR00050##

[0260] To a mixture of crude (E)-(3,4,5-trifluorophenyl)(7-(1,2,6-trimethyl-4-(3-((tetrahydro-2H-pyran-2-yl)oxy)prop-1-en-1-yl)-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)methanone (116 mg) in MeOH (3.0 mL) and THF (0.3 mL) was added Palladium on carbon (10 wt. %, 100 mg). The mixture was stirred at RT overnight under hydrogen atmosphere. The reaction mixture was filtered through CELITE, rinsing with CHCl.sub.3 and MeOH, and the filtrate was evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3-methanol) to give (3,4,5-trifluorophenyl)(7-(1,2,6-trimethyl-4-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)methanone (43 mg).

Step 7:

[0261] ##STR00051##

[0262] To a mixture of (3,4,5-trifluorophenyl)(7-(1,2,6-trimethyl-4-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)methanone (43 mg) in CHCl.sub.3 (1.0 mL) was added TFA (0.56 mL). The mixture was stirred at RT for 1 hr and evaporated. The residue was purified by column chromatography on amino silica gel (EtOAc-Hexane) to give (7-(4-(3-hydroxypropyl)-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (26 mg).

Step 8:

[0263] ##STR00052##

[0264] To a mixture of (7-(4-(3-hydroxypropyl)-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (25 mg) and P(n-Bu3) (0.038 mL, 0.15 mmol) in THF (2.5 mL) was added TMAD (26.3 mg, 0.15 mmol) at 0? C. The mixture was stirred at RT for 1 hr, then P(n-Bu3) (0.038 mL, 0.15 mmol) was added at RT, and TMAD (26.3 mg, 0.15 mmol) was added at 0? C. The mixture was stirred at RT for 15 minutes, then additional P(n-Bu3) (0.038 mL, 0.15 mmol) was added at RT, and additional TMAD (26.3 mg, 0.15 mmol) was added at 0? C. The mixture was stirred at RT for 1 hr. The mixture was diluted with EtOAc and water, and extracted with EtOAc. The organic layer was washed with H.sub.2O, sat. NaHCO.sub.3 aq., and brine, dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (EtOAc-Hexane) to give crude (3,4,5-trifluorophenyl)(6,8,9-trimethyl-8,11,12,13-tetrahydroimidazo[4,5:3,4]benzo[1,2:4,5]azocino[3,2,1-hi]indol-2-yl)methanone (27 mg).

Step 9:

[0265] ##STR00053##

[0266] To a mixture of crude (3,4,5-trifluorophenyl)(6,8,9-trimethyl-8,11,12,13-tetrahydroimidazo[4,5:3,4]benzo[1,2:4,5]azocino[3,2,1-hi]indol-2-yl)methanone (27 mg) in 1,4-Dioxane (1 mL) was added 28% NH.sub.3 aq. (1.63 mL) at RT. After reacting by microwave apparatus at 130? C. for 12 hrs, the mixture was diluted with EtOAc and water. The organic layer was washed with H.sub.2O and brine, dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (EtOAc-Hexane, CHCl.sub.3-MeOH, and Acetone-Hexane) to give (4-amino-3,5-difluorophenyl)(6,8,9-trimethyl-8,11,12,13-tetrahydroimidazo[4,5:3,4]benzo[1,2:4,5]azocino[3,2,1-hi]indol-2-yl)methanone (20 mg).

Step 10:

[0267] ##STR00054##

[0268] A solution of (4-amino-3,5-difluorophenyl)(6,8,9-trimethyl-8,11,12,13-tetrahydroimidazo[4,5:3,4]benzo[1,2:4,5]azocino[3,2,1-hi]indol-2-yl)methanone (20 mg), 4-chlorocrotonic acid (6.1 mg, 0.051 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 0.061 mL, 0.097 mmol) in DMF (0.5 mL) was stirred at RT for 50 min. Then triethylamine (0.022 mL, 0.16 mmol) was added thereto, and the mixture was stirred at RT for 3 hrs. To the resulting mixture was added saturated aqueous NaHCO.sub.3 and water, and extracted with EtOAc, and the organic layer was washed successively with H.sub.2O, saturated aqueous NaHCO.sub.3 then brine, dried over sodium sulfate, and evaporated to give crude (E)-4-chloro-N-(2,6-difluoro-4-(6,8,9-trimethyl-8,11,12,13-tetrahydroimidazo[4,5:3,4]benzo[1,2:4,5]azocino[3,2,1-hi]indole-2-carbonyl)phenyl)but-2-enamide (22 mg).

Step 11:

[0269] ##STR00055##

[0270] A solution of crude (E)-4-chloro-N-(2,6-difluoro-4-(6,8,9-trimethyl-8,11,12,13-tetrahydroimidazo[4,5:3,4]benzo[1,2:4,5]azocino[3,2,1-hi]indole-2-carbonyl)phenyl)but-2-enamide (22 mg), trans-4-methoxycyclohexanamine hydrochloride (16 mg, 0.097 mmol), KI (19 mg, 0.12 mmol) and K.sub.3PO.sub.4 (41 mg, 0.19 mmol) in DMF (0.5 mL) was stirred at 30? C. for 3 hrs. To the resulting mixture was added H.sub.2O, and extracted with EtOAc, and the organic layer was washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3-MeOH) to give the title compound (18 mg). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 8.44 (dd, J=7.9, 1.0 Hz, 1H), 8.00-7.75 (brs, 1H), 7.51 (s, 1H), 7.40 (d, J=7.8 Hz, 2H), 7.35 (d, J=7.7 Hz, 1H), 7.18 (s, 1H), 7.14-7.08 (m, 2H), 6.33 (d, J=15.4 Hz, 1H), 3.98-3.83 (m, 2H), 3.75 (s, 3H), 3.71-3.64 (m, 2H), 3.52-3.51 (m, 2H), 3.34 (s, 3H), 3.18-3.11 (m, 1H), 2.63 (s, 3H), 2.60-2.52 (m, 2H), 2.41 (s, 3H), 2.18-1.90 (m, 6H), 1.23-1.12 (m, 4H); ESI-MS [M+H].sup.+: 666.6.

Synthetic Procedure E

Example 30-1 and 30-2

(E)-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-(((1r,4r)-4-methoxy cyclohexyl)amino)but-2-enamide

Step 1:

[0271] ##STR00056##

[0272] A solution of 5-iodo-4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazole (4.62 g, 12.5 mmol), (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (6.28 g, 16.2 mmol). Pd(PPh.sub.3).sub.4 (1.44 g, 1.25 mmol) in 1,4-Dioxane (42 mL) and 2M Na.sub.2CO.sub.3 aq. (12.2 mL, 24.3 mmol) was evacuated and N.sub.2 back-filled before heating to 100? C. for 12 h. After cooling, the reaction mixture was diluted with EtOAc. The resulting suspension was filtered, rinsing with EtOAc, and the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining (8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (5.16 g, 80%).

Step 2:

[0273] ##STR00057##

[0274] N-iodosuccinimide (2.12 g, 9.44 mmol) was added to a solution of (8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (5.16 g, 9.97 mmol) in THF (40 mL) and AcOH (6.7 mL). After stirring at RT for 30 min, the reaction mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining (1-iodo-8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (6.42 g, 100%).

Step 3:

[0275] ##STR00058##

[0276] A solution of (1-iodo-8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (5.00 g, 7.77 mmol), 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (4.94 mL, 23.3 mmol). PdCl.sub.2(dppf).Math.CH.sub.2Cl.sub.2 (635 mg, 0.777 mmol) in 1,4-Dioxane (39 mL) and 2M Na.sub.2CO.sub.3 aq. (17.5 mL, 35.0 mmol) was evacuated and N.sub.2 back-filled before heating to 100? C. for 3 h. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining (E)-(1-(2-ethoxyvinyl)-8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (3.91 g, 86%).

Step 4:

[0277] ##STR00059##

[0278] 6M HCl aq. (11.1 mL, 66.6 mmol) was added to a solution of (E)-(1-(2-ethoxyvinyl)-8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (3.91 g, 6.66 mmol) in THF (33 mL). After stirring at RT for 3 h, further 6M HCl aq. (2.8 mL, 16.7 mmol) was added and stirring continued for 1 h. The reaction mixture was diluted with EtOAc and quenched with sat.NaHCO.sub.3 aq. at 0? C. The organic layer was washed with brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining 2-(8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-3-(3,4,5-trifluorobenzoyl)indolizin-1-yl)acetaldehyde (2.94 g, 79%).

Step 5:

[0279] ##STR00060##

[0280] Sodium triacetoxyborohydride (1.63 g, 7.68 mmol) was added to a solution of 2-(8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-3-(3,4,5-trifluorobenzoyl)indolizin-1-yl)acetaldehyde (2.87 g, 5.12 mmol) and AcOH (440 ?L, 7.68 mmol) in THF (26 mL). After stirring at RT for 1.5 h, further AcOH (147 ?L, 2.56 mmol) and sodium triacetoxyborohydride (542 mg, 2.56 mmol) were added and stirring continued for 1 h. Further AcOH (147 ?L, 2.56 mmol) and sodium triacetoxyborohydride (542 mg, 2.56 mmol) were added and stirring continued at 50? C. for 20 min. The organic layer was washed with brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining (1-(2-hydroxyethyl)-8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (2.20 g, 77%).

Step 6:

[0281] ##STR00061##

[0282] BBr.sub.3 (1.0 M in CH.sub.2Cl.sub.2, 52.8 mL, 52.8 mmol) was added to a solution of (1-(2-hydroxy ethyl)-8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (1.97 g, 3.52 mmol) in CH.sub.2Cl.sub.2 (12 mL) at 0? C. After stirring at 30? C. for 5 h. CHCl.sub.3/MeOH (30%) and sat. NaHCO.sub.3 aq. were added to the reaction mixture at 0? C. The aqueous layer was extracted with CHCl.sub.3/MeOH (10%) and combined organics were washed with brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining (8-(4-hydroxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(2-hydroxyethyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (1.80 g, 94%).

Step 7:

[0283] ##STR00062##

[0284] TMAD (849 mg, 4.93 mmol) was added to a solution of (8-(4-hydroxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(2-hydroxyethyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (1.80 g, 3.29 mmol) and P(n-Bu)3 (1.23 mL, 4.93 mmol) in THF (165 mL) at 0? C. After stirring at RT for 2 h, further P(n-Bu)3 (0.820 mL, 3.29 mmol) and TMAD (568 mg, 3.29 mmol) were added at 0? C., and stirring continued for 1 h at RT. The resulting suspension was filtered, rinsing with EtOAc, and the filtrate was washed with NaHCO.sub.3 aq., H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone) and suspended in MeOH, stirred at 50? C. After cooling, the solid was collected by filtration, washing with further MeOH, and vacuum-dried, thereby obtaining (9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (1.05 g, 60%).

Step 8:

[0285] ##STR00063##

[0286] Ammonolysis reaction of (9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (1.05 g, 1.98 mmol) was carried out in five batches. 28% NH.sub.3 aq. (15.8 mL, 114 mmol) was added to starting material (200 mg, 0.377 mmol) in 1,4-Dioxane (2 mL). The reaction mixture was heated at 130? C. by microwave irradiation for 24 h. The other batches were carried out under similar conditions. After cooling, the mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining (4-amino-3,5-difluorophenyl)(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (989 mg, 95%).

Step 9:

[0287] ##STR00064##

[0288] A solution of (4-amino-3,5-difluorophenyl)(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (748 mg, 1.42 mmol), 4-chlorocrotonic acid (318 mg, 2.64 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 1.65 mL, 2.64 mmol) in DMF (7.1 mL) was stirred at RT for 15 min. Then Et.sub.3N (594 ?L, 4.26 mmol) was added thereto, and the mixture was stirred at RT for 1.5 h. The reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq., H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was suspended in isopropyl ether (20 mL), stirred at RT. The solid was collected by filtration, washing with further isopropyl ether, and vacuum-dried at RT, thereby obtaining (E)-4-chloro-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (794 mg, 89%).

Step 10:

[0289] ##STR00065##

[0290] A solution of (E)-4-chloro-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (254 mg, 0.404 mmol), trans-4-methoxycyclohexanamine hydrochloride (201 mg, 1.21 mmol). KI (201 mg, 1.21 mmol) and K.sub.3PO.sub.4 (429 mg, 2.02 mmol) in DMF (1.3 mL) was stirred at 30? C. for 1 h. The reaction mixture was diluted with EtOAc, washed with H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3 (0.1% Et.sub.3N)/MeOH), thereby obtaining the racemic title compound (250 mg, 86%). The racemate was separated by CHIRAL ART SB(YMC) (hexane-EtOH (0.1% Et.sub.3N)) to give the title compound (Example 30-1, 96.2 mg, 38%; single isomer, 1st-eluting isomer and Example 30-2, 87.8 mg, 35%; single isomer, 2nd-eluting isomer). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.98 (dd, J=7.0, 1.0 Hz, 1H), 7.64 (s, 1H), 7.44-7.39 (m, 2H), 7.17-7.08 (m, 4H), 7.02 (dd, J=7.1, 7.1 Hz, 1H), 6.26 (dt, J=15.3, 1.6 Hz, 1H), 4.73 (dd, J=10.4, 4.4 Hz, 1H), 4.23-4.17 (m, 1H), 3.84 (s, 3H), 3.51 (dd, J=5.1, 1.6 Hz, 2H), 3.35 (s, 3H), 3.18-3.11 (m, 1H), 2.88-2.80 (m, 1H), 2.70 (s, 3H), 2.61-2.50 (m, 2H), 2.13-1.97 (m, 4H), 1.33-1.09 (m, 4H); ESI-MS [M+H].sup.+: 722.5

Example 31-1 and 31-2

(E)-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide

[0291] ##STR00066##

[0292] A solution of (E)-4-chloro-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:56]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (200 mg, 0.318 mmol), 3-methyloxetan-3-amine (141 ?L, 1.59 mmol). KI (106 mg, 0.636 mmol) in DMSO (3.18 mL) was stirred at 30? C. for 6 h. The reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl3/MeOH), thereby obtaining the racemic title compound (210 mg). The racemate was separated by CHIRAL ART SB(YMC) (hexane-EtOH (0.1% Et.sub.3N)) to give the title compound (Example 31-1, 80.1 mg, 37%; single isomer, 1st-eluting isomer and Example 31-2, 87.4 mg, 40%; single isomer, 2nd-eluting isomer). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.99 (dd, J=7.0, 1.0 Hz, 1H), 7.65 (s, 1H), 7.45-7.39 (m, 2H), 7.19-7.10 (m, 4H), 7.02 (dd, J=7.2, 7.2 Hz, 1H), 6.32 (dt, J=15.3, 1.8 Hz, 1H), 4.73 (dd, J=10.5, 4.3 Hz, 1H), 4.58 (d, J=6.3 Hz, 2H), 4.43 (d, J=6.5 Hz, 2H), 4.23-4.17 (m, 1H), 3.84 (s, 3H), 3.53 (dd, J=5.0, 1.8 Hz, 2H), 2.91-2.80 (m, 1H), 2.70 (s, 3H), 2.57 (dd, J=15.3, 2.3 Hz, 1H), 1.51 (s, 3H); ESI-MS [M+H].sup.+: 680.4.

Synthetic Procedure F

Example 42, 42-1, 42-2 and 43

(E)-N-(2,6-difluoro-4-(9,10,13-trimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-(((1r,4r)-4-methoxycyclohexyl)amino)but-2-enamide

Step 1:

[0293] ##STR00067##

[0294] Methymagnesium bromide (3.40 M in THF, 196 ?L, 0.665 mmol) was added to 2-(8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-3-(3,4,5-trifluorobenzoyl)indolizin-1-yl)acetaldehyde (186 mg, 0.332 mmol) in THF (250 ?L) at ?78? C. After the mixture was stirred at ?78? C. for 5 minutes, the mixture was heated to ambient temperature, and was stirred for 30 minutes. The mixture was diluted with EtOAc and quenched by NH.sub.4Cl, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (acetone-hexane), thereby obtaining (1-(2-hydroxypropyl)-8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (182 mg, 0.316 mmol).

Step 2:

[0295] ##STR00068##

[0296] Boron tribromide (1.60 M in CH2Cl2, 4.74 mL, 4.74 mmol) was added to (1-(2-hydroxypropyl)-8-(4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (182 mg, 0.316 mmol) in CH.sub.2Cl.sub.2 (1.00 mL). After the mixture was stirred at 35? C. for 4 hours, the mixture was cooled to ambient temperature. The mixture was diluted with CHCl.sub.h and quenched by NH.sub.3, and extracted with CHCl.sub.3, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (methanol-acetone-hexane), thereby obtaining (8-(4-hydroxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(2-hydroxypropyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (37.3 mg, 0.0664 mmol) and (1-(2-bromopropyl)-8-(4-hydroxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (116 mg, 0.185 mmol).

Step 3:

[0297] ##STR00069##

[0298] Potassium carbonate (103 mg, 0.186 mmol) was added to (1-(2-bromopropyl)-8-(4-hydroxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (116 mg, 0.186 mmol) in DMSO (15.0 mL). After the mixture was stirred at 40? C. for 1 hour, the mixture was cooled to ambient temperature. The mixture was diluted with EtOAc and water. The organic layer was washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (acetone-hexane), thereby obtaining (3,4,5-trifluorophenyl)(9,10,13-trimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (89.8 mg, 0.165 mmol).

Step 4:

[0299] ##STR00070##

[0300] To a mixture of (3,4,5-trifluorophenyl)(9,10,13-trimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (89.0 mg, 0.160 mmol) in 1,4-dioxane (400 ?L) was added ammonium hydroxide (3.40 mL, 29.0 mmol). After reacting by microwave apparatus at 130? C. for 14 hours, the mixture was diluted with EtOAc and water. The organic layer was washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated, thereby obtaining crude (4-amino-3,5-difluorophenyl)(9,10,13-trimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (79.0 mg, 0.150 mmol).

Step 5:

[0301] ##STR00071##

[0302] A solution of (4-amino-3,5-difluorophenyl)(9,10,13-trimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (79.0 mg, 0.146 mmol), 4-chlorocrotonic acid (26.5 mg, 0.220 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 274 ?L, 0.439 mmol) in DMF (1.00 mL) was stirred at ambient temperature for 20 minutes. Then triethylamine (122 ?L, 0.878 mmol) was added thereto, and the mixture was stirred at 35? C. for 30 minutes. To the resulting mixture was added saturated aqueous NaHCO.sub.3, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was used for the next reaction without further purification.

[0303] A solution of (E)-4-chloro-N-(2,6-difluoro-4-(9,10,13-trimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)but-2-enamide (94.0 mg, 0.146 mmol), trans-4-methoxycyclohexanamine hydrochloride (48.4 mg, 0.292 mmol). KI (72.8 g, 0.439 mmol) and K.sub.3PO.sub.4 (124 mg, 0.585 mmol) in DMF (1.00 mL) was stirred at 35? C. for 1 hour. To the resulting mixture was added saturated aqueous NaHCO.sub.3, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by preparative HPLC (water:acetonitrile (0.1% formic acid)) to give Example 42 (29.6 mg, 0.0402 mmol) and crude Example 43 (4.76 mg). Example 42 was separated by CHIRALPAK ART SB(YMC) (hexane-ethanol (0.1% triethyl amine)) to give the title compound (2.64 mg, single isomer, 1.sup.st-eluting isomer, Example 42-1) and (2.30 mg, single isomer, 2.sup.nd-eluting isomer. Example 42-2). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 10.00 (d, J=6.8 Hz, 1H), 7.63 (s, 1H), 7.44 (d, J=8.0 Hz, 2H), 7.17-7.09 (m, 3H), 7.05-7.00 (m, 1H), 6.24 (d, J=15.3 Hz, 1H), 4.97 (t, J=5.6 Hz, 1H), 3.83 (s, 3H), 3.51 (d, J=3.5 Hz, 2H), 3.36 (s, 3H), 3.18-3.14 (m, 1H), 2.97 (dd, J=15.0, 5.0 Hz, 1H), 2.70 (s, 3H), 2.54 (t, J=3.6 Hz, 1H), 2.33 (d, J=15.0 Hz, 1H), 2.10-1.97 (m, 4H), 1.31-1.13 (m, 7H); ESI-MS [M+H].sup.+: 736.5. The crude Example 43 was purified by column chromatography on silica gel (methanol-EtOAc-hexane), thereby obtaining Example 43 (1.36 mg, 0.00185 mmol). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.94 (d, J=6.8 Hz, 1H), 7.63 (s, 1f), 7.44 (d, J=8.0 Hz 2H), 7.17-7.09 (m, 3H), 7.05-7.00 (m, 1H), 6.24 (d, J=15.3 Hz, 1H), 4.53 (m, 1H), 3.82 (s, 3H), 3.51 (d, J=3.5 Hz, 2H), 3.35 (s, 3H), 3.18-3.12 (m, 1H), 2.88 (dd, J=15.0, 5.0 Hz, 1H), 2.67 (s, 3H), 2.59-2.52 (m, 1H), 2.33 (d, J=15.0 Hz, 1H), 2.10-1.97 (m, 4H), 1.31-1.13 (m, 7H); ESI-MS [M+H].sup.+: 736.5.

Synthetic Procedure G

Example 44

(E)-N-(2,6-difluoro-4-(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indole-2-carbonyl)phenyl)-4-((1r,4r)-4-methoxycyclohexyl)amino)but-2-enamide

Step 1:

[0304] ##STR00072##

[0305] Methylamine (2M THF solution, 86 mL, 172 mmol) was added to a solution of 1,3-difluoro-5-methyl-2-nitrobenzene (11.9 g, 68.7 mmol) in DMSO (229 mL) under a water bath. After stirring at RT for 30 min, the reaction mixture was diluted with EtOAc and NaHCO.sub.3 aq. The resulting solid was removed by filtration, the organic layer was washed with H.sub.2O (2?) and brine, the aqueous layer was extracted with EtOAc, washed with H.sub.2O (2?) and brine. Combined organics were dried over Na.sub.2SO.sub.4 and evaporated, thereby obtaining crude 3-fluoro-N,5-dimethyl-2-nitroaniline (12.8 g, 101%).

Step 2:

[0306] ##STR00073##

[0307] N-bromosuccinimide (13.8 g, 77.5 mmol) was added to a solution of 3-fluoro-N,5-dimethyl-2-nitroaniline (11.9 g, 64.6 mmol) in THF (215 mL). After stirring at RT for 2 h, the reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq. (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was suspended in isopropyl ether (238 mL), stirred at 50? C. After cooling, the solid was collected by filtration, washing with further isopropyl ether, and vacuum-dried at 50? C., thereby obtaining 4-bromo-3-fluoro-N,5-dimethyl-2-nitroaniline (14.0 g, 82%).

Step 3:

[0308] ##STR00074##

[0309] Acetylation of 4-bromo-3-fluoro-N,5-dimethyl-2-nitroaniline (13.0 g, 49.3 mmol) was carried out in two batches. Acetic anhydride (15.0 mL, 317 mmol) was added to the starting material (6.50 g, 24.7 mmol), then the reaction mixture was heated at 180? C. by microwave irradiation for 1 h. The other batch was carried out under the same conditions. After cooling, the reaction mixture was diluted with EtOAc, 5M NaOH aq. and NaHCO.sub.3 aq. The organic layer was separated and washed with NaHCO.sub.3 aq. and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining N-(4-bromo-3-fluoro-5-methyl-2-nitrophenyl)-N-methylacetamide (14.6 g, 97%).

Step 4:

[0310] ##STR00075##

[0311] A solution of N-(4-bromo-3-fluoro-5-methyl-2-nitrophenyl)-N-methylacetamide (5.95 g, 19.5 mmol), 2-benzyloxyethanamine (4.38 mL, 29.3 mmol) and DIEA (6.68 mL, 39.0 mmol) in THF (65 mL) was stirred at 70? C. for 4 h. After cooling, the reaction mixture was diluted with EtOAc, washed with NH.sub.4Cl aq. (3?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was suspended in isopropyl ether (43 mL), stirred at 50? C. After cooling, the solid was collected by filtration, washing with further isopropyl ether, and vacuum-dried at 40? C., thereby obtaining N-(3-((2-(benzyloxy)ethyl)amino)-4-bromo-5-methyl-2-nitrophenyl)-N-methylacetamide (8.17 g, 96%).

Step 5:

[0312] ##STR00076##

[0313] A suspension of N-(3-((2-(benzyloxy)ethyl)amino)-4-bromo-5-methyl-2-nitrophenyl)-N-methylacetamide (8.17 g, 18.7 mmol) and iron (10.5 g, 187 mmol) in AcOH (94 mL) was stirred at 60? C. for 3 h. After cooling, EtOAc was added to the reaction mixture then filtered through a CELITE pad, washing with EtOAc and CHCl.sub.3/MeOH. The filtrate was evaporated, diluted with EtOAc, washed with NaHCO.sub.3 aq. and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining N-(2-(benzyloxy)ethyl)-5-bromo-1,2,6-trimethyl-1H-benzo[d]imidazol-4-amine (6.69 g, 92%).

Step 6:

[0314] ##STR00077##

[0315] A suspension of N-(2-(benzyloxy)ethyl)-5-bromo-1,2,6-trimethyl-1H-benzo[d]imidazol-4-amine (769 mg, 1.98 mmol), (7-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (1.07 g, 2.77 mmol). SPhos Pd G3 (139 mg, 0.198 mmol) in THF (9.9 mL) and 2M K.sub.3PO.sub.4 aq. (2.08 mL, 4.16 mmol) was evacuated and N.sub.2 back-filled before heating to 80? C. for 5 h. After cooling, the reaction mixture was diluted with CHCl.sub.3, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining (7-(4-((2-(benzyloxy)ethyl)amino)-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (1.03 g, 89%).

Step 7:

[0316] ##STR00078##

[0317] A suspension of (7-(4-((2-(benzyloxy)ethyl)amino)-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (175 mg, 0.164 mmol) and Pd/C (10%) (175 mg) in EtOH (6.0 mL) was stirred at 4) ? C. under hydrogen (balloon) for 7 h. After cooling, the reaction mixture was filtered through a CELITE pad, washing with MeOH then evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining (7-(4-((2-hydroxyethyl)amino)-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (95.7 mg, 65%).

Step 8:

[0318] ##STR00079##

[0319] TMAD (78 mg, 0.45 mmol) was added to a solution of (7-(4-((2-hydroxyethyl)amino)-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (89.3 mg, 0.181 mmol) and P(n-Bu)3 (113 ?L, 0.453 mmol) in THF (9.1 mL) at 0? C. After stirring at 0? C. for 3 h, the reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq. and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining (3,4,5-trifluorophenyl)(6,8,9-trimethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indol-2-yl)methanone (25.7 mg, 30%).

Step 9:

[0320] ##STR00080##

[0321] A solution of (3,4,5-trifluorophenyl)(6,8,9-trimethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[12:5,6][1,4]diazocino[7,8,1-hi]indol-2-yl)methanone (25.7 mg, 0.0542 mmol), 37% formaldehyde solution (4.52 ?L, 0.0599 mmol) and TFA (4.02 ?L, 0.0542 mmol) in THF (542 ?L) was stirred at RT for 10 min. Then prepared reagent (mixture of sodium cyanoborohydride and zinc chloride (1:0.5) in MeOH (0.3 mol/L, 632 ?L, 0.190 mmol)) was added thereto, and the mixture was stirred at RT for 1 h. The reaction mixture was diluted with CHCl.sub.3, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining (6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indol-2-yl)(3,4,5-trifluorophenyl)methanone (17.7 mg, 67%).

Step 10:

[0322] ##STR00081##

[0323] 28% NH.sub.3 aq. (1.75 mL, 12.6 mmol) was added to (6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indol-2-yl)(3,4,5-trifluorophenyl)methanone (17.7 mg, 0.0362 mmol) in 1,4-Dioxane (354 ?L). The reaction mixture was heated at 130? C. by microwave irradiation for 12 h. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining (4-amino-3,5-difluorophenyl)(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indol-2-yl)methanone (14.3 mg, 81%).

Step 11:

[0324] ##STR00082##

[0325] 10% (w/v) 4-chlorocrotonic acid solution (35.6 ?L, 0.0295 mmol) in propylphosphonic anhydride solution (50 wt % in THF, 0.0570 mmol) was added to a solution of (4-amino-3,5-difluorophenyl)(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indol-2-yl)methanone (14.3 mg, 0.0295 mmol) and Et.sub.3N (41.2 ?L, 0.296 mmol) in DMF (295 ?L). After stirring at RT for 20 min, further 10% (w/v) 4-chlorocrotonic acid solution (17.8 ?L, 0.0148 mmol) in propylphosphonic anhydride solution (50 wt % in THF, 0.0285 mmol) was added and stirring continued for 20 min. The reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq., H.sub.2O and brine then dried over Na.sub.2SO.sub.4, passed through a small amount of NH silica gel (CHCl.sub.3/MeOH) and evaporated, thereby obtaining crude (E)-4-chloro-N-(2,6-difluoro-4-(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indole-2-carbonyl)phenyl)but-2-enamide (16.2 mg, 94%).

Step 12:

[0326] ##STR00083##

[0327] A solution of crude (E)-4-chloro-N-(2,6-difluoro-4-(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indole-2-carbonyl)phenyl)but-2-enamide (16.2 mg), trans-4-methoxycyclohexanamine hydrochloride (14 mg, 0.083 mmol), KI (14 mg, 0.083 mmol) and K.sub.3PO.sub.4 (29 mg, 0.14 mmol) in DMF (275 ?L) was stirred at 30? C. for 2 h. The reaction mixture was diluted with EtOAc, washed with H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3 (0.1% Et.sub.3N)/MeOH) and preparative HPLC (water:acetonitrile (0.1% formic acid)). The purified fractions were washed with sat. NaHCO.sub.3 aq., extracted with CHCl.sub.3/MeOH then dried over Na.sub.2SO.sub.4 and evaporated, thereby obtaining the title compound (9.07 mg, 48%). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 8.40 (dd, J=8.0, 1.0 Hz, 1H), 7.51 (s, 1H), 7.46-7.39 (m, 2H), 7.34 (dd, J=7.6, 7.6 Hz, 1H), 7.16-7.08 (m, 3H), 6.36 (d, J=15.3 Hz, 1H), 4.03-3.93 (m, 1H), 3.87 (dd, J=14.5, 2.8 Hz, 1H), 3.73 (s, 3H), 3.55 (dd, J=5.6, 1.4 Hz, 2H), 3.43 (d, J=11.0 Hz, 1H), 3.34 (s, 3H), 3.17-3.10 (m, 2H), 3.08 (s, 3H), 2.69-2.58 (m, 4H), 2.40 (s, 3H), 2.16-2.00 (m, 4H), 1.33-1.19 (m, 4H); ESI-MS [M+H].sup.+: 681.4.

Synthetic Procedure H

Example 46

(E)-N-(4-(8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:34]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indazole-2-carbonyl)-2,6-difluorophenyl)-4-(((1r,4r)-4-methoxycyclohexyl)amino)but-2-enamide

Step 1:

[0328] ##STR00084##

[0329] Pyridinium p-toluenesulfonate (255 mg) was added to 7-bromo-1H-indazole (2.00 g) and 3,4-dihydro-2H-pyran (1.70 g) in dichloromethane (25.0 mL), and the reaction mixture was stirred at 30? C. for 17 hours. After dilution with chloroform, the mixture was washed with a saturated sodium bicarbonate solution and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining 7-bromo-2-(tetrahydro-2H-pyran-2-yl)-2H-indazole (2.74 g).

Step 2:

[0330] ##STR00085##

[0331] A solution of 7-bromo-2-(tetrahydro-2H-pyran-2-yl)-2H-indazole (2.74 g) obtained in step 1 in THF (30 mL) was cooled to ?10? C. To the reaction mixture was added isopropylmagnesium chloride-lithium chloride complex (tetrahydrofuran solution (abt. 14%), 14.6 mL). After stirring at ?10? C. for 1 hour, to the reaction mixture was added 3,4,5-trifluorobenzoyl chloride (2.84 g). A reaction was performed at ?10? C. for 1 hour. After warming up to room temperature, the reaction mixture was quenched with a saturated ammonium chloride solution. After the mixture was extracted with ethyl acetate, the organic layer was washed with a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining (7-bromo-2-(tetrahydro-2H-pyran-2-yl)-2H-indazol-3-yl)(3,4,5-trifluorophenyl)methanone (2.70 g).

Step 3:

[0332] ##STR00086##

[0333] A solution of (7-bromo-2-(tetrahydro-2H-pyran-2-yl)-2H-indazol-3-yl)(3,4,5-trifluorophenyl)methanone (300 mg) obtained in step 2, 5,5,5,5-tetramethyl-2,2-bi(1,3,2-dioxaborinane) (260 mg), 1,1-bis(diphenylphosphino)ferrocene]dichloropalladium(II) complex with dichloromethane (55.8 mg) and potassium acetate (201 mg) in 1,4-dioxane (4.0 mL) was stirred at 100? C. for 3 hours. After dilution with ethyl acetate, the mixture was filtered through CELITE. The solvent was evaporated under reduced pressure, thereby obtaining (2-(tetrahydro-2H-pyran-2-yl)-7-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2H-indazol-3-yl)(3,4,5-trifluorophenyl)methanone.

[0334] To the solution of crude (2-(tetrahydro-2H-pyran-2-yl)-7-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2H-indazol-3-yl)(3,4,5-trifluorophenyl)methanone in tetrahydrofuran (4.0 mL), 5-iodo-1,2-dimethyl-4-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethoxy)-6-(trifluoromethyl)-1H-benzo[d]imidazole (240 mg), (2-dicyclohexylphosphino-2,6-dimethoxybiphenyl) [2-(2-amino-1,1-biphenyl)]palladium(II) methanesulfonate (43.4 mg) and 0.5 M tripotassium phosphate solution in water (0.93 mL) was added, followed by stirring at 80? C. for 4 hours. After dilution with ethyl acetate, the mixture was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. The solvent was evaporated under reduced pressure, thereby obtaining crude (7-(1,2-dimethyl-4-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethoxy)-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-2-(tetrahydro-2H-pyran-2-yl)-2H-indazol-3-yl)(3,4,5-trifluorophenyl)methanone (200 mg).

Step 4:

[0335] ##STR00087##

[0336] To the solution of crude (7-(1,2-dimethyl-4-(2-((tetrahydro-2H-pyran-2-yl)oxy)ethoxy)-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-2-(tetrahydro-2H-pyran-2-yl)-2H-indazol-3-yl)(3,4,5-trifluorophenyl)methanone (200 mg) obtained in step 3 in THF (3 mL), 5M hydrochloric acid (0.10 mL) was added, followed by stirring at 30? C. for 16 hours. After dilution with ethyl acetate, a saturated sodium bicarbonate solution was added to the mixture. After extraction with ethyl acetate, the mixture was washed with a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (hexane:acetone), thereby obtaining (7-(4-(2-hydroxyethoxy)-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1H-indazol-3-yl)(3,4,5-trifluorophenyl)methanone (25.0 mg).

Step 5:

[0337] ##STR00088##

[0338] Tributylphosphine and N,N,N,N-tetramethylazodicarboxamide (36.6 mg) were added to a solution of (7-(4-(2-hydroxyethoxy)-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1H-indazol-3-yl)(3,4,5-trifluorophenyl)methanone (25.0 mg) obtained in step 4 in tetrahydrofuran (5.0 mL) and toluene (5.0 mL), followed by stirring at 70? C. for 1 hour. After tributylphosphine (23.2 ?L) and N,N,N,N-tetramethylazodicarboxamide (12.3 mg) were added to the reaction mixture, a reaction was performed at 90? C. for 1 hour. The solvent was evaporated under reduced pressure, followed by purifying by column chromatography (hexane:acetone), thereby obtaining crude (8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indazol-2-yl)(3,4,5-trifluorophenyl)methanone including tributylphosphine oxide.

Step 6:

[0339] ##STR00089##

[0340] A solution of crude (8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indazol-2-yl)(3,4,5-trifluorophenyl)methanone obtained in step 5 and 28% ammonia solution in water (1.3 mL) in 1,4-dioxane (1.3 mL) was stirred at 130? C. for 12 hours using microwave irradiation. After dilution with ethyl acetate and water, the mixture was extracted with ethyl acetate. The combined organic layer was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (hexane:acetone), thereby obtaining (4-amino-3,5-difluorophenyl)(8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indazol-2-yl)methanone (5.80 mg).

Step 7:

[0341] ##STR00090##

[0342] (E)-4-chlorobut-2-enoic acid (2.65 mg) and 1-propanephosphonic acid anhydride cyclic trimer (a 1.7M THF solution, 35 ?L) were added to a solution of (4-amino-3,5-difluorophenyl)(8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indazol-2-yl)methanone (5.80 mg) obtained in step 6 in DMF (500 ?L), followed by stirring at room temperature for 20 minutes. Triethylamine (15 ?L) was added to the reaction mixture. A reaction was performed at room temperature for 2 hours. After water was added to the reaction mixture, extraction was performed with ethyl acetate, followed by washing the organic layer with a saturated sodium chloride solution. The washed organic layer was dried over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining (E)-4-chloro-N-(4-(8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indazole-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (6.02 mg).

Step 8:

[0343] ##STR00091##

[0344] (1r,4r)-4-methoxycyclohexan-1-amine hydrochloride (3.17 mg), tripotassium phosphate (8.11 mg), and potassium iodide (4.76 mg) were added to a solution of (E)-4-chloro-N-(4-(8,9-dimethyl-6-(trifluoromethyl)-12,13-dihydro-8H-imidazo[4,5:3,4]benzo[1,2:7,8][1,4]oxazocino[6,5,4-hi]indazole-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (6.02 mg) obtained in step 7 in DMF (500 ?L). A reaction was performed at room temperature for 2 hours. After water was added to the reaction mixture, extraction was performed with ethyl acetate. The combined organic layer was washed with a saturated sodium chloride solution. After the washed layer was dried over sodium sulfate, the solvent was evaporated under reduced pressure. The obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining the title compound (4.01 mg). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 8.51-8.47 (m, 1H), 8.08 (d, J=8.8 Hz, 2H), 7.72 (s, 1H), 7.44-7.41 (m, 2H), 7.26 (s, 4H), 7.11 (td, J=10.3, 5.1 Hz, 1H), 6.26 (d, J=15.3 Hz, 1H), 5.39-5.33 (m, 2H), 4.68-4.46 (m, 4H), 3.86 (s, 3H), 3.51 (d, J=5.0 Hz, 2H), 3.35 (s, 3H), 3.17-3.12 (m, 1H), 2.71 (s, 3H), 2.59-2.53 (m, 1H), 2.13-1.98 (m, 4H), 1.31-1.11 (m, 4H); ESI-MS [M+H].sup.+: 723.5

Synthetic Procedure I

Example 47

[0345] (E)-N-(2,6-difluoro-4-(6,8,9,11-tetramethyl-12-oxo-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indole-2-carbonyl)phenyl)-4-(((1r,4r)-4-methoxycyclohexyl)amino)but-2-enamide

Step 1:

[0346] ##STR00092##

[0347] A solution of N-(4-bromo-3-fluoro-5-methyl-2-nitrophenyl)-N-methylacetamide (692 mg, 2.27 mmol), methylamine (2M THF solution, 3.40 mL, 6.80 mmol) in THF (7.6 mL) was stirred at 6) ? C. for 1.5 h. Further methylamine (2M THF solution, 1.70 mL, 3.40 mmol) was added and stirring continued for 1 h. After cooling, the reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq. and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining N-(4-bromo-5-methyl-3-(methylamino)-2-nitrophenyl)-N-methylacetamide (694 mg, 97%).

Step 2:

[0348] ##STR00093##

[0349] A suspension of N-(4-bromo-5-methyl-3-(methylamino)-2-nitrophenyl)-N-methylacetamide (694 mg, 2.20 mmol) and iron (1.23 g, 22.0 mmol) in AcOH (11 mL) was stirred at 60? C. for 3.5 h. After cooling, EtOAc was added to the reaction mixture then filtered through a CELITE pad, washing with EtOAc. The filtrate was evaporated, diluted with EtOAc, washed with NaHCO.sub.3 aq. and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining 5-bromo-N,1,2,6-tetramethyl-1H-benzo[d]imidazol-4-amine (305 mg, 52%).

Step 3:

[0350] ##STR00094##

[0351] A suspension of 5-bromo-N,1,2,6-tetramethyl-1H-benzo[d]imidazol-4-amine (305 mg, 1.14 mmol), (7-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (660 mg, 1.70 mmol), SPhos Pd G3 (80 mg, 0.11 mmol) in THF (5.7 mL) and 2M K.sub.3PO.sub.4 aq. (1.28 mL, 2.56 mmol) was evacuated and N.sub.2 back-filled before heating to 80? C. for 5 h. After cooling, the reaction mixture was diluted with CHCl.sub.3, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining (3,4,5-trifluorophenyl)(7-(1,2,6-trimethyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)methanone (410 mg, 78%).

Step 4:

[0352] ##STR00095##

[0353] HATU (144 mg, 0.379 mmol) was added to a solution of (3,4,5-trifluorophenyl)(7-(1,2,6-trimethyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)-1H-indol-3-yl)methanone (70.1 mg, 0.152 mmol), 2-acetoxyacetic acid (35.8 mg, 0.303 mmol) and DIEA (104 ?L, 0.606 mmol) in DMF (1.5 mL). After stirring at RT for 1 h, 2M NaOH aq. (758 ?L, 1.52 mmol) was added and stirring continued for 10 min at RT. The reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining crude 2-hydroxy-N-methyl-N-(1,2,6-trimethyl-5-(3-(3,4,5-trifluorobenzoyl)-1H-indol-7-yl)-1H-benzo[d]imidazol-4-yl)acetamide (80.9 mg, 103%).

Step 5:

[0354] ##STR00096##

[0355] TMAD (67 mg, 0.39 mmol) was added to a solution of crude 2-hydroxy-N-methyl-N-(1,2,6-trimethyl-5-(3-(3,4,5-trifluorobenzoyl)-1H-indol-7-yl)-1H-benzo[d]imidazol-4-yl)acetamide (80.9 mg) and P(n-Bu)3 (97 ?L, 0.39 mmol) in THF (7.8 mL) at 0? C. After stirring at RT for 2.5 h, the reaction mixture was diluted with CHCl.sub.3, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining crude 6,8,9,11-tetramethyl-2-(3,4,5-trifluorobenzoyl)-8,11-dihydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indol-12(13H)-one (56.6 mg, 73%).

Step 6:

[0356] ##STR00097##

[0357] 28% NH.sub.3 aq. (4.7 mL, 34 mmol) was added to crude 6,8,9,11-tetramethyl-2-(3,4,5-trifluorobenzoyl)-8,11-dihydroimidazo[4,5:5,6]benzo[12:5,6][1,4]diazocino[7,8,1-hi]indol-12(13H)-one (56.6 mg) in 1,4-Dioxane (566 ?L). The reaction mixture was heated at 130? C. by microwave irradiation for 12 h. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining crude 2-(4-amino-3,5-difluorobenzoyl)-6,8,9,11-tetramethyl-8,11-dihydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indol-12(13H)-one (91 mg, 16%).

Step 7:

[0358] ##STR00098##

[0359] 10% (w/v) 4-chlorocrotonic acid solution (27.4 ?L, 0.0228 mmol) in propylphosphonic anhydride solution (50 wt % in THF, 0.0438 mmol) was added to a solution of crude 2-(4-amino-3,5-difluorobenzoyl)-6,8,9,11-tetramethyl-8,11-dihydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indol-12(13H)-one (9.1 mg) and Et.sub.3N (25.4 ?L, 0.182 mmol) in DMF (182 ?L). After stirring at RT for 1 h, further 10% (w/v) 4-chlorocrotonic acid solution (16.6 ?L, 0.0138 mmol) in propylphosphonic anhydride solution (50 wt % in THF, 0.0266 mmol) was added and stirring continued for 20 min. The reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq., H.sub.2O and brine then dried over Na.sub.2SO.sub.4, passed through a small amount of NH silica gel (CHCl.sub.3/MeOH) and evaporated, thereby obtaining crude (E)-4-chloro-N-(2,6-difluoro-4-(6,8,9,11-tetramethyl-12-oxo-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indole-2-carbonyl)phenyl)but-2-enamide (10.8 mg, 99%).

Step 8:

[0360] ##STR00099##

[0361] A solution of crude (E)-4-chloro-N-(2,6-<difluoro-4-(6,8,9,11-tetramethyl-12-oxo-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indole-2-carbonyl)phenyl)but-2-enamide (10.8 mg), trans-4-methoxycyclohexanamine hydrochloride (9 mg, 0.05 mmol), KI (9 mg, 0.05 mmol) and K.sub.3PO.sub.4 (19 mg, 0.090 mmol) in DMSO (358 ?L) was stirred at 30? C. for 1 h. The reaction mixture was diluted with DMSO then filtered and purified by preparative HPLC (water:acetonitrile (0.1% formic acid)). The purified fractions were washed with sat. NaHCO.sub.3 aq., extracted with CHCl.sub.3/MeOH then dried over Na.sub.2SO.sub.4 and evaporated, thereby obtaining the title compound (5.58 mg, 45%). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 8.45 (dd, J=8.0, 1.0 Hz, 1H), 7.64 (s, 1H), 7.48-7.42 (m, 2H), 7.39 (dd, J=8.4, 8.4 Hz, 1H), 7.34 (d, J=0.8 Hz, 1H), 7.21-7.06 (m, 3H), 6.23 (dt, J=15.3, 1.8 Hz, 1H), 4.98 (d, J=12.8 Hz, 1H), 4.17 (d, J=12.8 Hz, 1H), 3.78 (s, 3H), 3.49 (dd, J=5.3, 1.8 Hz, 2H), 3.40 (s, 3H), 3.35 (s, 3H), 3.18-3.11 (m, 1H), 2.65 (s, 3H), 2.57-2.49 (m, 1H), 2.23 (s, 3H), 2.11-2.04 (m, 2H), 2.02-1.94 (m, 2H), 1.33-1.09 (m, 4H); ESI-MS [M+H].sup.+: 695.6.

Synthetic Procedure J

Example 48

(E)-N-(2,6-difluoro-4-(2,3,5-trimethyl-13-methylene-12,13-dihydro-3H-imidazo[4,5:5,6]benzo[1,2:6,7]cyclohepta[1,2,3-hi]indolizine-10-carbonyl)phenyl)-4-(((1r,4r)-4-methoxycyclohexyl)amino)but-2-enamide

Step 1:

[0362] ##STR00100##

[0363] To a mixture of (4-amino-3,5-difluorophenyl)(8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)methanone (380 mg, 0.98 mmol), 4-bromo-5-iodo-1,2,6-trimethyl-1H-benzo[d]imidazole (260 mg, 0.70 mmol) and Pd(PPh.sub.3).sub.4 (81 mg, 0.070 mmol) in 1,2-dimethoxyethane (2.5 mL) was added 2M aqueous sodium carbonate solution (0.70 mL, 1.4 mmol). After reacting by microwave apparatus at 110? C. for 2 hrs, the mixture was diluted with EtOAc and water. Insoluble material was filtered off and the organic layer was washed with brine, dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (CHCl.sub.3-methanol) to give (4-amino-3,5-difluorophenyl)(8-(4-bromo-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)methanone (260 mg).

Step 2:

[0364] ##STR00101##

[0365] To a mixture of (4-amino-3,5-difluorophenyl)(8-(4-bromo-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)methanone (250 mg) in THF (2.5 mL) was added NIS (110 mg, 0.49 mmol). The mixture was stirred at RT for 2 hrs and NIS (8.9 mg, 0.039 mmol) was added and the mixture was stirred at RT for 30 min. The mixture was diluted with EtOAc, water, sat. NaHCO.sub.3 aq., and sat. NaCl aq., and the organic layer was washed with sat. NaHCO.sub.3 aq. and brine, dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (hexane-acetone) to give crude (4-amino-3,5-difluorophenyl)(8-(4-bromo-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)methanone (280 mg).

Step 3:

[0366] ##STR00102##

[0367] To a mixture of crude (4-amino-3,5-difluorophenyl)(8-(4-bromo-1,2,6-trimethyl-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)methanone (180 mg), 2-allyl-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (345 mg, 2.1 mmol) and Pd(PPh.sub.3).sub.4 (30 mg, 0.026 mmol) in 1,2-dimethoxyethane (3.0 mL) and water (0.51 mL) was added sodium carbonate (220 mg, 2.1 mmol). After reacting by microwave apparatus at 100? C. for 12 hrs, the mixture was diluted with EtOAc and water and the organic layer was washed with brine, dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (hexane-acetone) to give (4-amino-3,5-difluorophenyl)(7,9,10-trimethyl-12-methylene-12,13-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:6,7]cyclohepta[1,2,3-hi]indolizin-2-yl)methanone (17 mg).

Step 4:

[0368] ##STR00103##

[0369] A solution of (4-amino-3,5-difluorophenyl)(7,9,10-trimethyl-12-methylene-12,13-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:6,7]cyclohepta[1,2,3-hi]indolizin-2-yl)methanone (17 mg), 4-chlorocrotonic acid (5.8 mg, 0.048 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 0.057 mL, 0.092 mmol) in DMF (1.5 mL) was stirred at RT for 15 min. Then triethylamine (0.020 mL, 0.15 mmol) was added thereto, and the mixture was stirred at RT for 1 hr. 4-chlorocrotonic acid (5.8 mg, 0.048 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 0.057 mL, 0.092 mmol) were added and the mixture was stirred at RT for 15 min. Then triethylamine (0.020 mL, 0.15 mmol) was added thereto, and the mixture was stirred at RT for 1 hr and at 30? C. for 1 hr. 4-chlorocrotonic acid (5.8 mg, 0.048 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 0.057 mL, 0.092 mmol) were added and the mixture was stirred at RT for 15 min. Then triethylamine (0.020 mL, 0.15 mmol) was added thereto, and the mixture was stirred at 30? C. for 1 hr and at 50? C. overnight. To the resulting mixture was added saturated aqueous NaHCO.sub.3 and water, and extracted with EtOAc, and the organic layer was washed successively with H.sub.2O, saturated aqueous NaHCO.sub.3 then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3-MeOH) to give (E)-4-chloro-N-(2,6-difluoro-4-(7,9,10-trimethyl-12-methylene-12,13-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:6,7]cyclohepta[1,2,3-hi]indolizine-2-carbonyl)phenyl)but-2-enamide (12 mg).

Step 5:

[0370] ##STR00104##

[0371] A solution of (E)-4-chloro-N-(2,6-difluoro-4-(7,9,10-trimethyl-12-methylene-12,13-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:6,7]cyclohepta[1,2,3-hi]indolizine-2-carbonyl)phenyl)but-2-enamide (12 mg), trans-4-methoxycyclohexanamine hydrochloride (8.9 mg, 0.054 mmol). KI (11 mg, 0.065 mmol) and K.sub.3PO.sub.4 (23 mg, 0.11 mmol) in DMF (1.0 mL) was stirred at 30? C. for 30 min and at 40? C. for 3 hrs. To the resulting mixture was added H.sub.2O and the organic layer was washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3-MeOH) to give the title compound (9.6 mg). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.92 (dd, J=5.5, 0.6 Hz, 1H), 7.72-7.68 (m, 0.5H), 7.54-7.50 (m, 0.5H), 7.43 (d, J=8.0 Hz, 2H), 7.28-7.26 (m, 1H), 7.22 (s, 1H), 7.17 (s, 1H), 7.12 (dt, J=12.3, 4.2 Hz, 1H), 7.02 (t, J=7.1 Hz, 1H), 6.28 (d, J=15.3 Hz, 1H), 5.54 (brs, 1H), 5.39 (d, J=1.5 Hz, 1H), 3.81 (d, J=14.5 Hz, 1H), 3.74 (s, 3H), 3.65 (d, J=14.3 Hz, 1H), 3.54-3.52 (m, 2H), 3.35 (s, 3H), 3.17-3.12 (m, 1H), 2.64 (s, 3H), 2.61 (s, 3H), 2.62-2.55 (m, 1H), 2.12-1.98 (m, 4H), 1.30-1.15 (m, 4H); MS-ESI [M+H].sup.+: 664.5.

Synthetic Procedure K

Example 49

(E)-N-(2,6-difluoro-4-(8-oxo-11-(trifluoromethyl)-5,6-dihydro-4H,8H-pyrido[2,1:4,5][1,5]diazocino[3,2,1-hi]indole-1-carbonyl)phenyl-4-((1r,4r)-4-methoxycyclohexyl)amino)but-2-enamide

Step 1:

[0372] ##STR00105##

[0373] To a mixture of 2,6-dichloro-3-(trifluoromethyl)pyridine (2.15 g, 9.95 mmol) and 4-methoxybenzyl alcohol (1.36 mL, 10.9 mmol) in THF (30 mL) was added NaH (60% in mineral oil, 0.796 g, 19.9 mmol). After stirred at room temperature for 2 hrs, 4-methoxybenzyl alcohol (0.4 mL) was added thereto. The mixture was stirred at room temperature for 30 min, and water and EtOAc were added thereto. The organic layer was washed with brine, dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (hexane-EtOAc) to give an approximately 3:1 mixture of 2-chloro-6-((4-methoxybenzyl)oxy)-3-(trifluoromethyl)pyridine and 6-chloro-2-((4-methoxybenzyl)oxy)-3-(trifluoromethyl)pyridine (3.42 g).

Step 2:

[0374] ##STR00106##

[0375] The mixture of the above mixture of 2-chloro-6-((4-methoxybenzyl)oxy)-3-(trifluoromethyl)pyridine and 6-chloro-2-((4-methoxybenzyl)oxy)-3-(trifluoromethyl)pyridine (317 mg), (7-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (386 mg, 0.998 mmol), S-Phos Pd G3 (35.1 mg, 0.0499 mmol), and aqueous potassium phosphate tribasic (1M, 2 mL, 2.00 mmol) in THF (8 mL) was stirred at 80? C. for 1.5 hrs. The mixture was added EtOAc and water. The organic layer was separated, washed with brine, dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (hexane-EtOAc) to give (7-(6-((4-methoxybenzyl)oxy)-3-(trifluoromethyl)pyridin-2-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (402 mg) and (7-(6-((4-methoxybenzyl)oxy)-5-(trifluoromethyl)pyridin-2-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (123 mg),

##STR00107##

Step 3:

[0376] To a solution of (7-(6-((4-methoxybenzyl)oxy)-3-(trifluoromethyl)pyridin-2-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (100 mg, 0.180 mmol) in DMSO (2 mL) was added potassium hydroxide (14 mg, 0.25 mmol) and 2-(3-bromopropoxy)tetrahydro-2H-pyran (0.0457 mL, 0.270 mmol). After stirred at room temperature for 3 hrs, water and EtOAc were added thereto. The organic layer was washed successively with water then brine, dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (hexane-EtOAc) to give (7-(6-((4-methoxybenzyl)oxy)-3-(trifluoromethyl)pyridin-2-yl)-1-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (87.8 mg).

Step 4:

[0377] ##STR00108##

[0378] To a solution of (7-(6-((4-methoxybenzyl)oxy)-3-(trifluoromethyl)pyridin-2-yl)-1-(3-((tetrahydro-2H-pyran-2-yl)oxy)propyl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (87.8 mg, 0.126 mmol) in THF (2 mL) was added 1M hydrochloric acid (0 mL, 1 mmol). After stirred at room temperature overnight, saturated aqueous NaHCO.sub.3 was added to the reaction mixture, and extracted with EtOAc, and washed with brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3-EtOH) to give (7-(6-hydroxy-3-(trifluoromethyl)pyridin-2-yl)-1-(3-hydroxypropyl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (52.5 mg).

Step 5:

[0379] ##STR00109##

[0380] To the mixture of (7-(6-hydroxy-3-(trifluoromethyl)pyridin-2-yl)-1-(3-hydroxypropyl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (52.5 mg, 0.106 mmol) and triphenylphosphine (83.6 mg, 0.319 mmol) in THF (3 mL) was added diisopropyl azodicarboxylate (0.0418 ml, 0.212 mmol), and the mixture was stirred at room temperature for 15 min. The resulting mixture was added methanol, and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3-EtOH) to give crude 1-(3,4,5-trifluorobenzoyl)-11-(trifluoromethyl)-5,6-dihydro-4H,8H-pyrido[2,1:4,5][1,5]diazocino[3,2,1-hi]indol-8-one (63.9 mg).

Step 6:

[0381] ##STR00110##

[0382] The mixture of the above 1-(3,4,5-trifluorobenzoyl)-11-(trifluoromethyl)-5,6-dihydro-4H,8H-pyrido[2,1:4,5][1,5]diazocino[3,2,1-hi]indol-8-one (63.9 mg), 28% aqueous ammonium hydroxide solution (2 mL) and 1,4-dioxane (2 mL) was heated by microwave apparatus at 120? C. for 12 hrs, then the mixture was diluted with EtOAc and brine. The organic layer was dried over sodium sulfate and evaporated under reduced pressure. The residue was purified by column chromatography on silica gel (hexane-EtOAc/ethanol (4/1)) to give 1-(4-amino-3,5-difluorobenzoyl)-11-(trifluoromethyl)-5,6-dihydro-4H,8H-pyrido[2,1:4,5][1,5]diazocino[3,2,1-hi]indol-8-one (44.0 mg)

Step 7:

[0383] ##STR00111##

[0384] To the mixture of 1-(4-amino-3,5-difluorobenzoyl)-11-(trifluoromethyl)-5,6-dihydro-4H,8H-pyrido[2,1:4,5][1,5]diazocino[3,2,1-hi]indol-8-one (44.0 mg, 0.0929 mmol) and triethylamine (0.261 mL, 1.92 mmol) in DMF (2 mL) was added 10% (w/v) (E)-4-chlorobut-2-enoic acid solution (0.12 mL) in propylphosphonic anhydride solution (50 wt % in THF). After stirred at 45? C. for 10 min, 10% (w/v) (E)-4-chlorobut-2-enoic acid solution (0.06 mL) in propylphosphonic anhydride solution (50 wt % in THF) was added thereto twice. Saturated aqueous NaHCO.sub.3 was added thereto, and the mixture was extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. To the residue was added DMSO (0.9 mL) and trans-4-methoxycyclohexan-1-amine (0.0639 mL). The mixture was heated at 45? C. for 1 hr. The resulting mixture was purified by preparative HPLC (water:acetonitrile (0.1% formic acid)) to give the title compound (31.3 mg). .sup.1H-NMR: (500 MHz, CHLOROFORM-D) S 8.61 (dd, J=8.1, 1.1 Hz, 1H), 7.72 (d, J=9.8 Hz, 1H), 7.61 (s, 1H), 7.46 (d, J=9.8 Hz, 2H), 7.42 (t, J=7.8 Hz, 1H), 7.29 (d, J=7.3 Hz, 1H), 7.13 (dt, 1=15.5, 5.3 Hz, 1H), 6.76 (d, J=9.8 Hz, 1H), 6.28 (d, J=15.6 Hz, 1H), 4.88 (dd, J=13.9, 5.3 Hz, 1H), 4.21-4.18 (m, 1H), 4.09-4.03 (m, 1H), 3.55-3.49 (m, 3H), 3.36 (s, 3H), 3.18-3.11 (m, 1H), 2.62-2.53 (m, 1H), 2.41-2.31 (m, 1H), 2.10-2.06 (m, 2H), 2.01-1.95 (m, 3H), 1.30-1.13 (m, 4H); ESI-MS [M+H].sup.+: 669.3.

[0385] Other Examples were prepared using the synthetic procedures A to K and purification notes as shown in the table below.

TABLE-US-00001 Syn- thet- ic ES- Ex- pro- MS am- ced- Purification [M + ple Compound name Compound Structure ure notes 1H NMR H].sup.+ 2-1, 2-2 (E)-4-(tert- butylamino)-N-(4- (11-chloro-5,6- dihydro-4H- benzo[8,9][1,5] oxazonino[7,6,5- hi]indole-1- carbonyl)-2,6- difluorophenyl)but- 2-enamide [00112] A Purified by preparative HPLC (CHIRALPAK IE (hexane- ethanol (0.1% triethyl amine))) to afford Example 2-1 (single 1H NMR (400 MHz, CHLOROFORM-D) ? 8.50 (dd, J = 8.0, 1.1 Hz, 1H), 7,57 (s, 1H), 7.46-7.39 (m, 3H), 7.36-7.27 (m, 4H), 7.20-7.11 (m, 1H), 7.10 (dd, J = 7.0, 2.4 Hz, 1H), 6.41 (br d, J = 15.3 Hz, 1H), 4.38-4.25 (m, 1H), 4.19-4.07 (m, 2H), 4.07-3.96 (m, 1H), 3.58-3.42 (m, 2H), 2.34- 2.22 (m, 1H), 2.10-2.00 (m, 1H), 578.5 isomer, 1st- 1.26-1.19 (m, 9H) eluting isomer) and Example 2-2 (single isomer, 2nd-eluting isomer) 3 (E)-N-(4-(12- chloro-4,5,6,7- tetrahydrobenzo[2,3] [1,6]oxazecino[4,5, 6-hi]indole-1- carbonyl)-2,6- difluorophenyl)-4- (((1,4r)-4- methoxycyclohexyl) amino)but-2- enamide [00113] A 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.51 (dd, J = 8.0, 1.0 Hz, 1H), 7.59 (s, 1H), 7.44-7.38 (m, 3H), 7.34 (t, J = 8.4 Hz, 1H), 7.25-7.19 (m, 3H), 7.13 (dt, J = 15.3, 5.2 Hz, 1H), 6.93 (d, J = 8.0 Hz, 1H), 6.28 (d, J = 15.5 Hz, 1H), 4.41 (dd, J = 11.3, 2.3 Hz, 1H), 4.14 (t, J = 8.4 Hz, 1H), 4.09-4.01 (m, 1H), 3.97-3.90 (m, 1H), 3.52 (dd, J = 5.3, 1.5 Hz, 648.6 2H), 3.35 (s, 3H), 3,19-3.12 (m, 1H), 2.59-2.50 (m, 1H), 2.22-1.95 (m, 4H), 1.78-1.63 (m, 2H), 1.48- 1.36 (m, 1H), 1.33-1.08 (m, 4H) 4-1, 4-2 (E)-N-(4-(11- chloro-5,6-dihydro- 4H- benzo[8,9][1,5] oxazonino[7,6,5- hi]indole-1- carbonyl)-2,6- difluorophenyl)-4- (((1,4r)-4- methoxycyclohexyl) amino)but-2- [00114] A Purified by preparative HPLC (CHIRALPAK IE (hexane- ethanol (0.1% triethyl amine))) to afford Example 4-1 (single isomer, 1st- 1H NMR (400 MHz, CHLOROFORM-D) ? 8.51 (d, J = 7.9 Hz, 1H), 7.54 (s, 1H), 7.47- 7.37 (m, 3H), 7.37-7.27 (m, 4H), 7.18-7.04 (m, 2H), 6.29 (d, J = 15.4 Hz, 1H), 4.35-4.30 (m, 1H), 4.22-4.07 (m, 2H), 4.07-3.93 (m, 1H), 3.52 (d, J = 4.1 Hz, 2H), 3.35 (s, 3H), 3.25-3.06 (m, 1H), 2.60-2.45 (m, 1H), 2.37-2.22 (m, 1H), 2.16-1.93 (m, 4H), 1.36-1.10 634.5 enamide eluting isomer) (m, 4H) and Example 4-2 (single isomer, 2nd-eluting isomer) 5-1, 5-2 (E)-N-(2,6-difluoro- 4-(8-(2- oxopyrrolidin-1-yl)- 10- (trifluoromethyl)- 4,5- dihydrobenzo [7,8][1. 4]oxazocino[6,5,4- hi]indole-1- carbonyl)phenyl)-4- (((1r,4t)-4- [00115] A Purified by preparative HPLC (CHIRALPAK IC (hexane- ethanol (0.1% triethyl amine))) to afford Example 5-1 (single isomer, 1st- 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.46 (d, J = 8.0 Hz, 1H), 7.98 (s, 1H), 7.81 (d, J = 2.0 Hz, 1H), 7.57 (s, 1H), 7.41 (d. J = 8.3 Hz, 2H), 7.35 (t, J = 7.8 Hz, 1H), 7.18 (d, J = 7.3 Hz, 1H), 7.06 (dt, J = 15.3, 5.6 Hz, 1H), 6.39 (d, J = 15,3 Hz, 1H), 4.50-4.30 (m, 2H), 4.12 (d, J = 10.3 Hz, 1H), 3.97-3.92 (m, 3H). 3.58 (d, J = 5.3 Hz, 2H), 3.34 (s, 737.5 methoxycyclohexyl) eluting isomer) 3H), 3.17-3.12 (m, 1H), 2.70-2.64 amino)but-2- and Example 5-2 (m, J = 8.1 Hz, 3H), 2.28-2.21 (m, enamide (single isomer, 2H), 2.11-2.02 (m, 4H), 1.31-1.21 2nd-eluting (m, 4H) isomer) 6 (E)-N-(2,6-difluoro- 4-(10-methyl-4,5- dihydrobenzo [7,8][1,4] oxazocino[6,5,4- hi]indole-1- carbonyl)phenyl)-4- (((1r,4r)-4- methoxycyclohexyl) amino)but-2- enamide [00116] A 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.44 (d, J = 8.0 Hz, 1H), 7.53 (s, 1H), 7.44 (s, 1H), 7.42 (s, 1H), 7.40-7.32 (m, 2H), 7.23 (d, J = 7.8 Hz, 1H), 7.18-7.09 (m, 3H), 7.03 (d, J = 7.8 Hz, 1H), 6.27 (d, J = 15.3 Hz, 1H), 4.59-4.52 (m, 1H), 4.33 (td, J = 11,8, 2.3 Hz, 1H), 4. 11 (dd, J = 11.4, 2.4 Hz, 1H), 3.86 (dd, J = 14.9, 1.9 Hz, 1H), 3.52 (d, J = 5.3 600.3 Hz, 2H), 3.36 (s, 3H), 3.19-3.12 (m, 1H), 2.58-2.51 (m, 1H), 2.40 (s, 3H), 2.10-2.07 (m, 2H), 2.00 (d, J = 12.0 Hz, 2H), 1.31-1.11 (m, 4H) 7 (E)-N-(2,6-difluoro- 4-(10-fluoro-4,5- dihydrobenzo[7,8] [1,4]oxazocino[6,5,4- hijindole-1- carbonyl)phenyl)-4- (((1r,4r)-4- methoxycyclohexyl) amino)but-2- enamide [00117] A 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.48 (dd, J = 6.5, 2.5 Hz, 1H), 7.54 (s, 1H), 7.43-7.37 (m, 5H), 7.19-7.09 (m, 3H), 7.02 (d, J = 8.0 Hz, 1H), 6.27 (d, J = 15.5 Hz, 1H), 4.68- 4.61 (m, 1H), 4.40 (td, J = 11.9, 2.6 Hz, 1H), 4.16-4.11 (m, 1H), 3.95 (dd, J = 15.3, 2.3 Hz, 1H), 3.53-3.51 (m, 2H), 3.36 (s, 3H), 3.19-3.12 (m, 1H), 2.58-2.51 (m, 604.2 1H), 2.10-2.07 (m, 2H), 2.03-1.98 (m, 2H), 1.31-1,11 (m, 4H) 8 (E)-N-(4-(10- chloro-8-(2- oxopyrrolidin-1-yl)- 4,5- dihydrobenzo[7,8] [1,4]oxazocino [6,5,4- hi]indole-1- carbonyl)-2,6- difluorophenyl)-4- (((1r,4t)-4- [00118] A 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.46 (dd, J = 6.9. 2.1 Hz, 1H), 7.71 (d, J = 2.3 Hz, 1H), 7.61 (d, J = 2.0 Hz, 1H), 7.53 (s, 1H), 7.43-7.38 (m, 4H), 7.23 (s, 1H), 7.12 (dt, J = 15.4, 5.2 Hz, 1H), 6.27 (d, J = 15.3 Hz, 1H), 4.63-4.56 (m, 1H), 4.35 (td, J = 11.9, 2,4 Hz, 1H), 4.19-4.11 (m, 1H), 3.94-3.88 (m, 3H), 3.52-3.51 (m, 2H), 3.35 (s. 703.3 methoxycyclohexyl) 3H), 3.18-3.12 (m, 1H), 2.67 (t, amino)but-2- J = 8.1 Hz, 2H), 2.57-2.51 (m, 1H), enamide 2.26-2.19 (m, 2H), 2.10-2.07 (m, 2H), 2.01-1.98 (m, 2H), 1.31-1.10 (m, 4H) 9 (E)-N-(4-(10- chloro-9-cyano-4,5- dihydrobenzo[7,8] [1:4]oxazocino[6,5,4- hi]indole-1- 9 carbonyl)-2,6- difluorophenyl)-4- (((1,4r)-4- methoxycyclohexyl) amino)but-2- enamide [00119] A 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.53 (d, J = 7.5 Hz, 1H), 7.78 (d, J = 8.5 Hz, 1H), 7.56 (s, 1H), 7.46-7.37 (m, 4H), 7.24 (d, J = 8.5 Hz, 1H), 7.12 (td, J = 10.3, 5.1 Hz, 1H), 6.28 (d, J = 15.5 Hz, 1H), 4.57- 4.42 (m, 2H), 4.18 (d, J = 11.3 Hz, 1H), 3.99 (d, J = 14.0 Hz, 1H), 3.53-3.48 (m, 2H), 3.41-3.29 (m, 1H), 3.35 (s, 3H), 3.19-3.11 645.2 (m, 1H), 2.62-2.53 (m, 1H), 2.09 (d, J = 11.5 Hz, 2H), 2.03-1.94 (m. 2H), 1.31-1.19 (m, 4H) 10 (E)-N-(2,6-difluoro- 4-(10-methoxy-4,5- dihydrobenzo[7,8] [1,4]oxazocino[6,5,4- hi]indole-1- carbonyl)phenyl)-4- (((1,4r)-4- methoxycyclohexyl) amino)but-2- enamide [00120] A 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.53 (d, J = 7.5 Hz, 1H), 7.78 (d, J = 8.5 Hz, 1H), 7.56 (s, 1H), 7.46-7.37 (m, 4H), 7.24 (d, J = 8.5 Hz, 1H), 7.12 (td, J = 10.3, 5.1 Hz, 1H), 6.28 (d, J = 15.5 Hz, 1H), 4.57- 4.42 (m, 2H), 4.18 (d, J = 11.3 Hz, 1H), 3.99 (d, J = 14.0 Hz, 1H), 3.53-3.48 (m, 2H), 3.41-3.29 (m, 1H), 3.35 (s, 3H), 3.19-3.11 616.3 (m, 1H), 2.62-2.53 (m, 1H), 2.09 (d, J = 11.5 Hz, 2H), 2.03-1.94 (m, 2H), 1.31-1.19 (m, 4H) 11-1, 11-2 (E)-N-(2,6-difluoro- 4-(10- (trifluoromethyl)- 4,5- dihydrobenzo[7,8][1,4] oxazocino[6,5,4- hijindole-1- carbonyl)phenyl)-4- (((1,4r)-4- methoxycyclohexyl) amino)but-2- [00121] A Purified by preparative HPLC (CHIRALPAK IE (hexane- ethanol (0.1% triethyl amine))) to afford Example 11-1 (single isomer, 1st- 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.50 (d, J = 8.0 Hz, 1H), 7.74 (d, J = 8.0 Hz, 1H), 7.59 (t, J = 7.9 Hz, 1H), 7.54 (s, 1H), 7.47 (s, 1H), 7.45 (s, 1H), 7.39 (1, J = 7.6 Hz, 2H), 7.22 (d. J = 7.5 Hz, 1H), 7.13 (td, J = 10.3, 5.0 Hz, 1H), 6.97 (s, 1H), 6.25 (d, J = 15.3 Hz, 1H), 4.54-4.47 (m, 1H), 4.37 (td, J = 11.9, 2.4 Hz, 1H), 4.15-4.10 (m, 1H), 3.92 (d, 654.3 enamide eluting isomer) J = 14.5 Hz, 1H), 3.52 (dd, J = 5.0, and Example 11- 1.5 Hz, 2H), 3.36 (s, 3H), 3.19- 2 (single isomer, 3.12 (m, 1H), 2.62-2.50 (m, 1H), 2nd-eluting 2.10-2.07 (m, 2H), 1.99 (d, J = isomer) 12.3 Hz, 2H), 1.31-1.10 (m, 4H) 13 (E)-4-(tert- butylamino)-N-(2,6- difluoro-4-(6,8,9- trimethyl-12,13- dihydro-SH- imidazo[4,5:3,4] benzo[1,2:7,8][1,4] oxazocino[6,5,4- hi]indole-2- carbonyl)phenyl) [00122] B 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.43 (dd, J = 8.0, 1.0 Hz, 1H), 7.53 (s, 1H), 7.46-7.40 (m, 2H), 7.37 (t, J = 7.8 Hz, 1H), 7.21-7.10 (m, 3H), 6.29 (dt, J = 15.4, 1.7 Hz, 1H), 4.64- 4.46 (m, 2H), 4.45-4.34 (m, 1H), 3.84 (dd, J = 14.6, 1,9 Hz, 1H), 3.77 (s, 3H), 3.45 (dd, J = 5.0, 1.8 Hz, 2H), 2.63 (s, 3H), 2.49 (s, 612.4 but-2-enamide 3H), 1.10 (s, 9H) 14-1, 14-2 (E)-N-(2,6-difluoro- 4-(6,8,9-trimethyl- 12,13-dihydro-8H- imidazo[4,5:3,4] benzo[1,2:7,8][1,4] oxazocino[6,5,4- hi]indole-2- carbonyl)phenyl)-4- (((11,4r)-4- methoxycyclohexyl) amino)but-2- [00123] B Purified by preparative HPLC (CHIRAL ART SB(YMC) (hexane-ethanol (0.1% triethyl amine))) to afford Example 14-1 (single isomer, 1st- eluting isomer) 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.43 (dd, J = 8.0, 1.0 Hz, 1H), 7.56 (s, 1H), 7.47-7.41 (m, 2H), 7.37 (dd, J= 7.6, 7.6 Hz, 1H), 7.21-7.07 (m, 4H), 6.26 (dt, J = 15.3, 1.6 Hz, 1H), 4.62-4.46 (m, 2H), 4.45-4.33 (m, 1H), 3.84 (dd, J = 14.4, 1.9 Hz, 1H), 3.75 (s, 3H), 3.51 (dd, J = 5.3, 1.8 Hz, 2H), 3.35 (s, 3H), 3.19-3.10 (m, 1H), 2.63 (s, 3H), 668.5 enamide and Example 14- 2.57-2.51 (m, 1H), 2.49 (s, 3H), 2 (single isomer, 2.13-2.03 (m, 2H), 2.03-1.94 (m, 2nd-eluting 2H), 1.36-1.09 (m, 4H) isomer) 15-1, 15-2 (E)-N-(2,6-difluoro- 4-(6,8,9-trimethyl- 13,14-dihydro- 8H,12H- imidazo[4,5:3,4] benzo[1,2:8,9][1,5] oxazonino[7,6,5- hi]indole-2- carbonyl)phenyl)-4- (((1r,4r)-4- methoxycyclohexyl) [00124] R Purified by preparative HPLC (CHIRALPAK IE (hexane- ethanol (0.1% triethyl amine))) to afford Example 15-1 (single isomer, 1st- 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.45 (dd, J = 8.0, 1.3 Hz, 1H), 7.53 (s, 1H), 7.45-7.38 (m, 3H), 7.14-7.08 (m, 2H), 7.02 (d, J = 0.8 Hz, 1H), 6.29 (dt, J = 15.4, 1,6 Hz, 1H), 4.91-4.85 (m, 1H), 4.24-4.11 (m, 2H), 3.89 (td, J = 9.8, 5.0 Hz, 1H), 3.74 (s, 3H), 3.52 (dd, J = 5.3. 1.8 Hz, 2H), 3.35 (s, 3H), 3.18-3.11 (m, 1H), 2.63 (s, 3H), 682.5 amino)but-2- eluting isomer) 2.59-2.52 (m, 1H), 2.26-2.17 (m, enamide and Example 15- 4H), 2.12-1.92 (m, 4H), 1.30-1.12 2 (single isomer, (m, 4H) 2nd-eluting isomer) 16 (E)-N-(2,6-difluoro- 4-(2,3,5-trimethyl- 3H,12H- imidazo[4,5.3,4] benzo[1,2:6,7][1,3] oxazepino[5,4,3- hi]indole-9- carbonyl)phenyl)-4- (((1r,4r)-4- methoxycyclohexyl) amino)but-2- [00125] B 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.38 (d, J = 7.0 Hz, 1H), 7.63 (s, 1H), 7.51- 7.39 (m, 4H), 7.15-7.09 (m, 2H), 6.26 (d, J = 15.3 Hz, 1H), 6.11- 6.03 (m, 2H), 3.74 (s, 3H), 3.52 (d, J = 4.3 Hz, 2H), 3.35 (s, 3H), 3.17-3.12 (m, 1H), 2.75 (s, 3H), 2.64 (s, 3H), 2.56-2.48 (m , 1H), 2.10-1.98 (m, 4H), 1.30-1.15 (m, 4H) 654.5 enamide 17 (E)-N-(2,6-difluoro- 4-((R)-6,8,9,13- tetramethyl-12,13- dihydro-8H- imidazo[4,5;3,4] benzo[1,2:7,8][1,4] oxazocino[6,5,4- hi]indole-2- carbonyl)phenyl)-4- (((1,4r)-4- [00126] B 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.44 (dd, J = 7.9, 1.1 Hz, 1H), 7.52-7.45 (m, 3H), 7.38 (t, J = 7.8 Hz, 1H), 7.19 (dd, J = 7.4, 1.1 Hz, 1H), 7.16- 7.10 (m, 2H), 6.27 (d, J = 14.8 Hz, 1H), 4.82 (dd, J = 6.3, 2.5 Hz, 1H), 4.61 (dd, J = 14.9, 2.9 Hz, 1H), 3.75 (s, 3H), 3,58-3.52 (m, 3H), 3.35 (s, 3H), 3.16-3.13 (m, 682.5 methoxycyclohexyl) 1H), 2.63 (s, 3H), 2.47 (s, 3H), amino)but-2- 2.11-1.99 (m, 4H), 1.31-1.15 (m, enamide 7H). 18 (E)-N-(2,6-difluoro- 4-((S)-6,8,9,13- tetramethyl-12,13- dihydro-8H- imidazo[4,5:3,4] benzo[1,2:7,8][1,4] oxazocino[6,5,4- hi]indole-2- carbonyl)phenyl)-4- [00127] B 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.44 (dd, J = 8.0, 1.0 Hz, 1H), 7.52-7.45 (m, 3H), 7.38 (t, J = 7.8 Hz, 1H), 7.20 (dd, J = 7.5, 1.3 Hz, 1H), 7.14- 7.09 (m, 2H), 6.26 (d, J = 15.3 Hz, 1H), 4.83-4.80 (m, 1H), 4.61 (dd, J = 14.8, 3.0 Hz, 1H), 3.75 (s, 3H), 3.58-3.52 (m, 3H), 3.36 (s, 682.5 (((1,4r)-4- 3H), 3.19-3.12 (m, 1H), 2.62 (s, methoxycyclohexyl) 3H), 2.47 (s, 3H), 2.10-1.98 (m, amino)but-2- 4H), 1.31-1.14 (m, 7H). enamide 19 (E)-N-(2,6-difluoro- 4-((R)-6,8,9,12- tetramethy 1-12,13- dihydro-8H- imidazo[4,5:3,4] benzo[1,2:7,8][1,4] oxazocino[6,5,4- hi]indole-2- carbonyl)phenyl)-4- (((1,4r)-4- methoxycyclohexyl) amino)but-2- enamide [00128] B 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.44 (dd, J = 8.0, 1.0 Hz, 1H), 7.52-7.43 (m, 3H), 7.38 (t, J = 7.8 Hz, 1H), 7.20 (dd, J = 7.5, 1.3 Hz, 1H), 7.16- 7.06 (m, 2H), 6.26 (d. J = 15.3 Hz, 1H), 4.85-4.79 (m, 1H), 4.61 (dd, J = 14.8, 3.0 Hz, 1H), 3.75 (s, 3H), 3.58-3.51 (m, 3H), 3.35 (s, 3H), 3.19-3.04 (m, 1H), 2.62 (s, 3H), 2.47 (s, 3H), 2.10-1.98 (m, 4H), 1.32-1.11 (m, 7H). 682.5 20 (E)-N-(2,6-difluoro- 4-((S)-6,8,9,12- tetramethyl-12,13- dihydro-8H- imidazo[4,5:3,4] benzo[1,2:7,8][1,4] oxazocino[6,5,4- hi]indole-2- carbonyl)pheny 1)-4- (((1,4r)-4- [00129] B 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.44 (dd, J = 8.0, 1.3 Hz, 1H), 7.51-7.44 (m, 2H), 7.38 (t, J = 7.8 Hz, 1H), 7.23-7.18 (m, 1H), 7.16-7.09 (m, 2H), 6.26 (d, J = 15.3 Hz, 1H), 4.85-4.79 (m, 1H), 4.61 (dd, J = 14.8, 3.0 Hz, 1H), 3.75 (s, 3H), 3.56-3.52 (m, 3H), 3.36 (s, 3H), 3.19-3.12 (m, 1H), 2.62 (s, 3H), 682.5 methoxycyclohexyl) 2.47 (s, 3H), 2.10-1.98 (m, 4H), amino)but-2- 1.31-1.11 (m, 7H). enamide 21-1, 21-2 (E)-N-(2,6-difluoro- 4-(6,8,9-trimethyl- 8H, 12H,14H- spiro[cyclopropane- 1,13- imidazo[4,5:3,4] benzo[1,2:8,9][1,5] oxazonino[7,6,5- hi]indole]-2- carbonyl)phenyl)-4- (((1r,4t)-4- [00130] B Purified by preparative HPLC (CHIRAL ART SB(YMC) (hexane-ethanol (0.1% triethyl amine))) to afford Example 21-1 (single isomer, 1st- eluting isomer) 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.46 (dd, J = 8.0, 1.0 Hz, 1H), 7.52-7.39 (m, 4H), 7.16-7.09 (m, 2H), 7.03 (d, J = 0.8 Hz, 1H) , 6.25 (d, J = 15.0 Hz, 1H), 4.54 (d, J = 14.5 Hz, 1H), 4.27 (d, J = 12,5 Hz, 1H), 4.09 (d, J = 12.3 Hz, 1H), 3.75 (s. 3H), 3.53-3.49 (m, 2H), 3.35 (s. 3H), 3.18-3.06 (m, 2H), 2.63 (s. 3H), 2.18 (s, 3H), 2.10-1.98 (m, 708.5 methoxycyclohexyl) and Example 21- 4H), 1.30-1.11 (m, 5H), 0.51-0.41 amino)but-2- 2 (single isomer, (m, 2H), 0.23-0.19 (m, 1H) enamide 2nd-eluting isomer) 22 (E)-N-(2,6-difluoro- 4-((S)-6,8,9,13- tetramethyl-13,14- dihydro-8H, 12H- imidazo[4,5:3,4] benzo[1,248,9][1,5] oxazonino[7,6,5- hi]indole-2- carbonyl)phenyl)-4- (((1,4r)-4- methoxycyclohexyl) [00131] B 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.45 (dt, J = 8.0, 1.6 Hz, 1H), 7.53 (d, J = 5.0 Hz, 1H), 7.45 (dt, J = 13.0, 2.6 Hz, 2H), 7.41-7.36 (m, 1H), 7.16-7.09 (m, 1H), 7.05 (dd, J = 7.3, 1.3 Hz, 1H), 7.01-7.00 (m, 1H), 6.29 (d, J = 15.3 Hz, 1H), 4.58-4.52 (m, 1H), 4.47-4.37 (m, 1H), 3.75 (s, 3H), 3.68-3.61 (m, 1H), 3.53 (d, J = 5.3 Hz, 2H), 696.4 amino)but-2- 3.35 (s, 3H), 3.19-3.12 (m, 1H), enamide 2.63-2.55 (m, 4H), 2.17-1.97 (m, 6H), 1.31-1.17 (m, 4H), 1.13 (d, J = 6.3 Hz, 3H). 23 (E)-N-(2,6-difluoro- 4-((R)-6,8,9,13- tetramethyl-13,14- dihydro-8H,12H- imidazo[4,5:3,4] benzo[1,2:8,9][1,5] oxazonino[7,6,5- hi]indole-2- carbonyl)phenyl)-4- (((1,4r)-4- methoxycyclohexyl) [00132] B Purified by preparative HPLC (CHIRALPAK SB(YMC) (hexane-ethanol (0.1% triethyl amine))) to afford Example 23 (single isomer, 1st- 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.47-8.44 (m, 1H), 7.52 (d, J = 4.0 Hz, 1H), 7.46-7.43 (m, 2H), 7.39 (t, J = 7.6 Hz, 1H), 7.16-7.09 (m, 1H), 7.05 (dd, J = 7.4, 1.1 Hz, 1H), 7.00 (d, J = 3.3 Hz, 1H), 6.27 (d, J = 15.5 Hz, 1H), 4.58-4.52 (m, 1H), 4.47- 4.37 (m, 1H), 3.75 (s, 3H), 3.68- 3.61 (m, 1H), 3.54 (dd, J = 18.3, 5.0 Hz, 2H), 3.35 (s, 3H), 3.19- 696.4 amino)but-2- eluting isomer) 3.12 (m, 1H), 2.63-2.57 (m, 4H), enamide and Example 24 2.17-1.98 (m, 6H), 1.31-1.18 (m, (single isomer, 4H), 1.13 (d, J = 6.3 Hz, 3H). 24 2nd-eluting 1H-NMR (400 MHz, 696.4 isomer) CHLOROFORM-D) ? 8.47-8.44 (m, 1H), 7.52 (d, J = 4.0 Hz, 1H), 7.46-7.43 (m, 2H), 7.39 (t, J = 7.6 Hz, 1H), 7.16-7.09 (m, 1H), 7.05 (dd, J = 7.4, 1.1 Hz, 1H), 7.00 (d, J = 3.3 Hz, 1H), 6.27 (d, J = 15.5 Hz, 1H), 4.58-4.52 (m, 1H), 4.30- 4.26 (m, 1H), 3.75 (s, 3H), 3.68- 3.61 (m, 1H), 3.54 (dd, J = 18.3, 5.0 Hz, 2H), 3.35 (s, 3H), 3.19- 3.12 (m, 1H), 2.63-2.57 (m, 4H), 2.17-1.98 (m, 6H), 1.31-1.18 (m, 4H), 1.13 (d. J = 6.3 Hz, 3H). 25 (E)-N-(2,6-difluoro- 4-(1,8,9-trimethyl-6- (trifluoromethyl)- 12, 13-dihydro-8H- imidazo[4,5:3,4] benzo[1,2:7,8][1,4] oxazocino[6,5,4- hi]indole-2- carbonyl)phenyl)-4- (((1,4r)-4- methoxycyclohexyl) [00133] B 1H-NMR (400 MHz, CHLOROFORM-D) ? 7.69 (s, 1H), 7.46-7.43 (m, 3H), 7.17-7.08 (m, 4H), 6.25 (d, J = 15.3 Hz, 1H), 4.45-4.30 (m, 3H), 4.02-3.94 (m, 1H), 3.85 (s, 3H), 3.50 (dd, J = 5.3, 1.8 Hz, 2H), 3.36 (s, 3H), 3.18-3.11 (m, 1H), 2.70 (s, 3H), 2.56-2.49 (m, 4H), 2.09-1.96 (m, 4H), 1.30-1.09 (m, 4H) 736.3 amino)but-2- enamide 28 (E)-N-(4-(8,9- dimethyl-6- (trifluoromethyl)- 8,11,12,13- tetrahydroimidazo[4, 5:3,4]benzo[1,2: 4,5]azocino[3,2,1- hi]indole-2- carbonyl)-2,6- difluorophenyl)-4- (((1r,4r)-4- methoxycyclohexyl) amino)but-2- enamide [00134] D 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.47 (dd, J = 8.0, 1.1 Hz, 1H), 7.72 (s, 1H), 7.52 (s, 1H), 7.45 (d, J = 7.8 Hz, 2H), 7.36 (t, J = 7.7 Hz, 1H), 7.17 (d, J = 7.4 Hz, 1H), 7.11 (dt, J = 15.4, 5.4 Hz, 1H), 6.31 (d, J = 15.4 Hz, 1H), 3.92-3.82 (m, 2H), 3.84 (s, 3H), 3.75-3.71 (m, 1H), 3.55-3.54 (m, 2H), 3.35 (s, 3H), 3.18-3.12 (m, 1H), 2.69 (s, 3H), 2.65-2.57 (m, 2H), 2.15-2.01 (m, 6H), 1.31-1.19 (m, 4H) 720.4 29 (E)-N-(4-(8,9- dimethy 1-6- (trifluoromethyl)- 11,12,13,14- tetrahydro-8H- imidazo[4,5:3,4] benzo[1,2:4,5]azonino [3,2,1-hi]indole-2- carbonyl)-2,6- difluorophenyl)-4- (((1r,4r)-4- [00135] D 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.51 (dd, J = 8.0, 0.8 Hz, 1H), 7.67 (s. 1H), 7.50-7.43 (m, 3H), 7.40 (t, J = 7.7 Hz, 1H), 7.18-7.08 (m, 2H), 6,98- 6.92 (brs, 1H), 6.24 (d, J = 15.3 Hz, 1H), 3.85 (s, 3H), 3.75-3.65 (m, 2H), 3.55-3,45 (m, 3H), 3.35 (s, 3H), 3.18-3.08 (m, 1H), 2.71 (s, 3H), 2.55-2.48 (m, 2H), 2.15- 1.94 (m, 4H), 1.88-1.78 (m, 1H), 734.4 methoxycyclohexyl) 1.75-1.60 (m, 1H), 1.30-1.10 (m, amino)but-2- 6H) enamide 32 (E)-N-(2,6-difluoro- 4-(7,9,10-trimethyl- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,2:2,3] oxocino[4,5,6- hi]indolizine-2- carbonyl)phenyl)-4- (((1,4r)-4- methoxycyclohexyl) amino)but-2- [00136] F 1H-NMR (400 MHz, CHLOROFORM-D) ? 9.97 (dd, J = 7.0. 1.3 Hz, 1H), 7.45-7.39 (m, 2H), 7.17-7.00 (m, 6H), 6.24 (dt, J = 15.3, 1.7 Hz, 1H), 4.76 (dd, J = 10.4, 4.6 Hz, 1H), 4.20-4.14 (m, 1H), 3.74 (s, 3H), 3.69-3.56 (m, 1H), 3.51 (dd, J = 5.3, 1.8 Hz, 2H), 3.35 (s, 3H), 3,18-3.11 (m, 1H), 2.94-2.87 (m, 1H), 2.63 (s, 3H), 2.57-2.50 (m, 2H), 2.44 (s. 668.4 enamide 3H), 2.11-2.05 (m, 2H), 2.02-1.95 (m, 2H), 1.24-1.10 (m, 4H) 33 (E)-4-(tert- butylamino)-N-(4- (9,10-dimethyl-7- (trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,2.2,3] oxocino[4,5,6- hilindolizine-2- carbonyl)-2,6- [00137] E 1H-NMR (400 MHz, CHLOROFORM-D) ? 9.98 (dd, J = 7.0, 1.0 Hz, 1H), 7.64 (s. 1H), 7.46-7.36 (m, 2H), 7.18-7.11 (m, 3H), 7.02 (dd, J = 7.0, 7.0 Hz, 1H), 6.33 (d, J = 15.5 Hz, 1H), 4.73 (dd, J = 10.5, 4.5 Hz, 1H), 4.29-4.17 (m, 1H), 3.84 (s, 3H), 3.47 (dd, J = 5.3, 1.5 Hz, 2H), 2.88-2.80 (m, 1H), 2.70 (s, 3H). 666.4 difluorophenyl)but- 2.57 (dd, J = 15.3, 2.3 Hz, 1H), 2-enamide 1.18 (s, 9H) 34 (E)-N-(4-(9,10- dimethyl-7- (trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo [1,2:2,3] oxocino[4,5,6- hilindolizine-2- carbonyl)-2,6- difluorophenyl)-4- [00138] E 1H-NMR (400 MHz, CHLOROFORM-D) ? 9.98 (dd, J = 7.0, 1.0 Hz, 1H), 7.65 (s, 1H), 7.47-7.38 (m, 2H), 7.17-7.00 (m, 5H), 6.27 (dt, J = 15.4, 1.7 Hz, 1H), 4.74 (dd, J = 10.4, 4.6 Hz, 1H), 4.23-4.17 (m, 1H), 4.04-3.95 (m, 2H), 3.84 (s, 3H), 3.54 (dd, J = 5.1, 1.6 Hz, 2H), 3.46-3.37 (m. 2H), 2.89-2.72 (m, 2H), 2.70 (s. 694.4 ((tetrahydro-2H- 3H), 2.62-2.52 (m, 1H), 1.88-1.85 pyran-4- (m, 2H), 1.48-1.38 (m, 2H) yl)amino)but-2- enamide 35 (E)-N-(4-(9,10- dimethy 1-7- (trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,2.2,3] oxocino[4,5,6- hilindolizine-2- carbonyl)-2,6- difluorophenyl)-4-((1- [00139] E 1H-NMR (500 MHz, CHLOROFORM-D) ? 9.98 (dd, J = 7.0, 0.9 Hz, 1H), 7.64 (s, 1H), 7.44-7.39 (m, 2H), 7.18-7.09 (m, 3H), 7.06-6.99 (m, 2H), 6.22 (dt, J = 15.4, 2.0 Hz, 1H), 4.73 (dd, J = 10.4, 4.6 Hz, 1H), 4.23-4.17 (m, 1H), 3.84 (s, 3H), 3.55 (dd, J = 4.9, 1.8 Hz, 2H), 2.88-2.80 (m, 1H), 2.70 (s, 3H), 2.57 (dd, J = 664.5 methylcyclopropyl) 15.3, 2.1 Hz, 1H), 1.29 (s, 3H), amino)but-2-enamide 0.60 (dd, J = 5.6, 4.7 Hz, 2H), 0.41 (dd, J = 6.3, 4.4 Hz, 2H) 36 (E)-N-(4-(9,10- dimethy 1-7- (trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,21:2,3] oxocino[4,5,6- hilindolizine-2- carbonyl)-2,6- difluorophenyl)-4- ((1-methyl-1- oxidophosphinan-4- [00140] E 1H-NMR (400 MHz, CHLOROFORM-D) ? 9.98 (dd, J = 7.0, 1.0 Hz, 1H), 8.01 (s. 1H), 7.64 (s, 1H), 7.46-7.39 (m, 2H), 7.19-7.08 (m, 3H), 7.01 (dd, J = 7.1, 7.1 Hz, 1H), 6.41 (dt, J = 15.3, 2.1 Hz, 1H), 4.73 (dd, J = 10.4, 4.6 Hz, 1H), 4.23-4.17 (m, 1H), 3.84 (s, 3H), 3.49 (dd, J = 4.8, 1.8 Hz, 2H), 2.88-2.80 (m, 1H), 2.76-2.70 (m, 4H), 2.57 (dd, J = 15.4, 2.1 Hz, 1H), 2.25-2.10 740.4 yl)amino)but-2- (m, 2H), 2.07-1.90 (m, 4H), 1.68- enamide 1.59 (m, 2H), 1.51 (d, J = 12.8 Hz, 3H) 37 (E)-N-(4-(9,10- dimethyl-7- (trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,2:2,3] oxocino[4,5,6- hi]indolizine-2- carbonyl)phenyl)-4- (((1,4r)-4- methoxycyclohexyl) [00141] E 1H-NMR (400 MHz, CHLOROFORM-D) ? 10.01-9.99 (m, 1H), 7.82 (d. J = 8.8 Hz, 2H), 7.69 (d, J = 8.5 Hz, 1H), 7.64 (s, 1H), 7.55-7.52 (m, 1H), 7.14 (s, 1H), 7.11-7.03 (m, 2H), 7.00- 6.95 (m, 1H), 6.19 (d, J = 15.3 Hz, 1H), 4.72 (q, J = 5.1 Hz, 1H), 4.23-4.17 (m, 1H), 3.84 (s, 3H), 3.53-3.49 (m, 2H), 3.34 (s, 3H), 3.17-3.10 (m, 1H), 2.86-2.82 (m, 686.4 amino)but-2-enamide 1H), 2.70 (s, 3H), 2.62-2.53 (m, 2H), 2.17-1.99 (m, 4H), 1.30-1.21 (m, 4H) 38-1, 38-2 (E)-N-(4-(9,10- dimethyl-7- (trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,2:2,3] oxocino[4,5,6- hilindolizine-2- carbonyl)-2,6- [00142] E Purified by preparative HPLC (CHIRALPAK ID (hexane- ethanol (0.1% triethyl amine))) to afford Example 1H-NMR (400 MHz, CHLOROFORM-D) ? 9.99 (d, J = 6.8 Hz, 1H), 7.64 (s, 1H), 7.48- 7.37 (m, 2H), 7.20-7.16 (m, 2H), 7.09-7.00 (m, 3H), 6.25 (d, J = 15.5 Hz, 1H), 4.74 (dd, J = 10.4, 4.6 Hz, 1H), 4.23-4.17 (m, 1H), 3.84 (s, 3H), 3.16 (d, J = 5.0 Hz, 2H), 2.89-2.80 (m, 1H), 2.70 (s, 638.4 difluorophenyl)-4- 38-1 (single 3H), 2.57 (dd, J - 15.2, 1.6 Hz, (dimethy lamino)but- isomer, 1st- 1H), 2.31 (s, 6H) 2-enmide eluting isomer) and Example 38- 2 (single isomer, 2nd-eluting isomer) 39 (E)-N-(4-(9,10- dimethyl-7- (trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,2:2,3] oxocino[4,5,6- hilindolizine-2- carbonyl)-2,6- difluorophenyl)-4-((4 [00143] E 1H-NMR (400 MHz, CHLOROFORM-D) ? 9.98 (d, J = 7.0 Hz, 1H), 7.65 (s, 1H), 7.43 (d, J = 8.0 Hz, 2H), 7.21-7.11 (m, 3H), 7.10-6.98 (m, 2H), 6.34 (d, J = 15.3 Hz, 1H), 4.74 (dd, J = 10.3, 4.5 Hz, 1H), 4.23-4.17 (m, 1H), 3.92-3.77 (m, 5H), 3.68-3.57 (m, 2H), 3.44 (d, J = 3.8 Hz, 2H), 2.89-2.81 (m, 1H), 2.70 (s, 3H), 708.4 methyltetrahydro- 2.63-2.52 (m, 1H), 1.58 (t, J = 5.0 2H-pyran-4- Hz, 4H), 1.18 (s, 3H) yl)amino)but-2- enamide 40 (E)-1-((4-((4-(9,10- dimethy 1-7- (trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,2:2,3] oxocino[4,5,6- hilindolizine-2- carbonyl)-2,6- difluorophenyl) amino)- [00144] E 1H-NMR (400 MHz, CHLOROFORM-D) ? 9.98 (d, J = 6.8 Hz, 1H), 7.65 (s, 1H), 7.53 (s, 1H), 7.41 (d, J = 8.0 Hz, 2H), 7.18-7.16 (m, 2H), 7.10-7.00 (m, 2H), 6.32 (d, J = 15,5 Hz, 1H), 4.85 (d, J = 3.3 Hz, 2H), 4.73 (dd, J = 10.3, 4.5 Hz, 1H), 4.20 (t, J = 10.5 Hz, 1H), 3.84 (s, 3H), 2.96- 2.80 (m, 2H), 2.70 (s, 3H), 2.62 2.56 (m, 1H), 2.05-1.98 (m, 2H), 736.2 4-oxobut-2-en-1-yl) 1.71-1.71 (m, 8H), 1.43-1.39 (m, amino)cyclohexane- 1H) 1-carboxylic acid 41 (E)-N-(4-(9,10- dimethy 1-7- (trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,2:2,3] oxocino[4,5,6- hilindolizine-2- carbonyl)-2,6- difluorophenyl)-4-((3- methyltetrahydrofuran- [00145] E 1H-NMR (400 MHz, CHLOROFORM-D) ? 9.98 (dd, J = 7.0, 1.0 Hz, 1H), 7,65 (s, 1H), 7.46-7.43 (m, 2H), 7.15 (td, J = 10.0, 5.3 Hz, 3H), 7.04-7.00 (m, 1H), 6.31 (d, J = 15.3 Hz, 1H), 4.74 (dd, J = 10.5, 4.5 Hz, 1H), 4.24-4.17 (m, 1H), 4.03-3.97 (m, 1H), 3.92-3.87 (m, 1H), 3.84 (s, 3H), 3.72-3,61 (m, 2H), 3,49-3.47 (m, 3H), 2.88-2.82 (m, 1H), 2.70 694.4 3-yl)amino)but- (s, 3H), 2.62-2.55 (m, 1H), 2.07- 2-enamide 1.95 (m, 1H), 1.86-1.79 (m, 1H), 1.32 (s, 3H) 45 (E)-N-(2,6-difluoro- 4-(8,9,11-trimethyl- 6-(trifluoromethyl)- 8,11,12,13- tetrahydroimidazo[4 5,6][1,4]diazocino[7, 8,1-hi]indole-2- carbonyl)phenyl)-4- (((1,4r)-4- methoxycyclohexyl) amino)but-2- [00146] G 1H-NMR (400 MHz, CHLOROFORM-D) ? 8.45 (dd, J = 8.0, 1.0 Hz, 1H), 7.70 (s, 1H), 7.49 (dd, J = 14,9, 7,9 Hz, 3H), 7.36-7.31 (m, 1H), 7.16-7.09 (m, 2H), 6.24 (d, J = 15.5 Hz, 1H), 3.98-3.91 (m, 1H), 3.83 (s, 3H). 3.53-3.49 (m, 2H), 3.41-3.37 (m, 2H), 3.36 (s, 3H), 3.19-3.11 (m, 2H), 3.09 (s, 3 H), 2.68 (s, 3H), 2.57-2.52 (m, 1H), 2.17-1.98 (m, 735.4 enamide 4H), 1.31-1.13 (m, 4H) 50 (E)-N-(4-(9,10- dimethyl-7- (trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,2:2,3] oxocino[4,5,6- hi]indolizine-2- carbonyl)-2,6- difluorophenyl)-4-((3- [00147] E 1H-NMR (400 MHz, CHLOROFORM-D) ? 9.98 (d, J = 7.0 Hz, 1H), 7.65 (s, 1H), 7.44 (d. J = 7.9 Hz, 2H), 7.20-7.15 (m, 3H), 7.03 (t, J = 7.1 Hz, 1H), 6.95 (s, 1H), 6.34 (d, J = 15.2 Hz, 1H), 4.71 (d, J = 47.2 Hz, 2H), 4.75- 4.70 (m, 1H), 4.68-4.62 (m, 2H), 4.47 (d, J = 6.9 Hz, 2H), 4.29- 4.17 (m, 1H), 3.84 (s, 3H), 3.63- 698.4 (fluoromethyl)oxetan- 3.62 (m, 2H), 2.89-2.81 (m, 1H), 3-yl)amino)but-2- 2.70 (s, 3H), 2.60-2.55 (m, 1H) enamide

Synthesis of (7-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone

Step 1:

[0386] ##STR00148##

[0387] Dimethylaluminum chloride solution (1.0 M in hexane, 49 mL, 49 mmol) was added to an ice bath cooled solution of 7-bromo-1H-indole (4.80 g, 24.5 mmol) in DCM (10) mL) and stirred at ambient temperature for 30 min. 3,4,5-trifluorobenzoyl chloride (4.81 mL, 36.7 mmol) was added thereto, and the mixture was stirred at 0? C. for 20 min. 2N Hydrochloric acid was slowly added thereto and the mixture was diluted with the mixture of chloroform (80 mL) and ethanol (20 mL). The organic layer was separated and washed with aqueous NaHCO.sub.3 solution and brine, and then dried (Na.sub.2SO.sub.4) and evaporated. The residue was diluted with IPE and hexane, and the precipitate was collected via filtration to give (7-bromo-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (4.54 g). The remained filtrate was evaporated and purified by column chromatography on silica gel (gradient elution, 10-50%, EtOAc-hexane) to give (7-bromo-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (2.52 g). MS: [M+H].sup.+=354, 356.

Step 2:

[0388] ##STR00149##

[0389] The mixture of (7-bromo-1H-indol-3-yl)(3,4,5-trifluorophenyl)methanone (7.89 g, 22.3 mmol), bis(neopentyl glycolato)diboron (10.06 g, 44.6 mmol). Pd(dppf)Cl.sub.2CH.sub.2Cl.sub.2 (910 mg, 1.11 mmol), potassium acetate (6.56 g, 66.8 mmol) in 1,4-dioxane (80 mL) was stirred at 90? C. for 12 hrs. After cooling, the reaction mixture was evaporated, and EtOAc and saturated aqueous NaHCO.sub.3 were added thereto. The insolubles were removed by filtration, and the organic layer was separated, washed with brine, and then dried (Na.sub.2SO.sub.4) and evaporated. The residue was diluted with CHCl.sub.3, and the precipitate was collected via filtration to give the title compound (4.90 g). The remained filtrate was evaporated and purified by column chromatography on silica gel (gradient elution, 10-50%, EtOAc/EtOH (4/1)-hexane) to give the title compound (3.08 g).

Synthesis of 5-iodo-4-methoxy-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazole

Step 1:

[0390] ##STR00150##

[0391] Methylamine (2M THF solution, 31.0 mL, 61.6 mmol) was added to a solution of 1-chloro-3-fluoro-2-nitro-5-(trifluoromethyl)benzene (5.00 g, 20.5 mmol) in THF (6.25 mL). After stirring at room temperature for 1 hour, the reaction mixture was concentrated under reduced pressure, thereby obtaining crude 3-chloro-N-methyl-2-nitro-5-(trifluoromethyl)aniline (5.23 g).

Step 2:

[0392] ##STR00151##

[0393] Sodium methoxide (17.4 g, 323 mmol) was added to a solution of 3-chloro-N-methyl-2-nitro-5-(trifluoromethyl)aniline (8.22 g, 32.3 mmol) in MeOH (108 mL). After stirring at 80? C. for 24 hours, the reaction mixture was diluted with EtOAc, washed with saturated aqueous NH.sub.4Cl and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining 3-methoxy-N-methyl-2-nitro-5-(trifluoromethyl)aniline (7.08 g, 88%).

Step 3:

[0394] ##STR00152##

[0395] N-iodosuccinimide (7.00 g, 31.1 mmol) was added to a solution of 3-methoxy-N-methyl-2-nitro-5-(trifluoromethyl)aniline (7.08 g, 28.3 mmol) in AcOH (70.0 mL). After stirring at 40? C. for 14 hours, the mixture was cooled to room temperature, and H.sub.2O was added to the reaction mixture. The resulting solid was collected by filtration, and vacuum-dried at 60? C., thereby obtaining crude 4-iodo-3-methoxy-N-methyl-2-nitro-5-(trifluoromethyl)aniline (10.3 g, 97%).

Step 4:

[0396] ##STR00153##

[0397] NH.sub.4Cl (3.67 g, 68.5 mmol) and iron (7.65 g, 137 mmol) were added to a solution of 4-iodo-3-methoxy-N-methyl-2-nitro-5-(trifluoromethyl)aniline (10.3 g, 27.4 mmol) in MeOH (39.0 mL), THF (39.0 mL) and H.sub.2O (19.5 mL). After stirring at 60? C. for 2 hours, the mixture was cooled to room temperature, and EtOAc was added to the reaction mixture then filtered through a CELITE pad. The filtrate was washed with H.sub.2O and brine, then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining 4-iodo-3-methoxy-N1-methyl-5-(trifluoromethyl)benzene-1,2-diamine (7.77 g, 82%).

Step 5:

[0398] ##STR00154##

[0399] conc. HCl (187 ?L, 2.25 mmol) and AcOH (1.29 mL, 22.5 mmol) were added to a solution of 4-iodo-3-methoxy-N1-methyl-5-(trifluoromethyl)benzene-1,2-diamine (7.77 g, 22.5 mmol) in trimethyl orthoacetate (40.0 mL, 314 mmol). After stirring at room temperature for 62 hours, the reaction was quenched with 5 mol/L aqueous NaOH (5.45 mL, 27.3 mmol). The reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was dissolved in EtOAc (8.0 mL) at 50? C., and heptane (32 mL) was added, then cooled to room temperature slowly to give the precipitation. The precipitate was collected by filtration, washing with further heptane, and vacuum-dried at 60? C., thereby obtaining the title compound (5.50 g, 66%). The filtrate was evaporated and purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining the title compound (1.56 g, 19%).

Synthesis of 5-iodo-4-methoxy-1,2,6-trimethyl-1H-benzo[d]imidazole

Step 1:

[0400] ##STR00155##

[0401] Methylamine (2M THF solution, 38.2 mL, 76.4 mmol) was added to a 1-fluoro-3-methoxy-5-methyl-2-nitrobenzene (4.04 g, 21.8 mmol). After the reaction mixture was heated at 70? C. by microwave irradiation for 12 hours, the mixture was cooled to room temperature. The mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated, thereby obtaining crude 3-methoxy-N,5-dimethyl-2-nitroaniline (4.29 g, 100%).

Step 2:

[0402] ##STR00156##

[0403] N-iodosuccinimide (6.72 g, 29.9 mmol) was added to a solution of 3-methoxy-N,5-dimethyl-2-nitroaniline (5.33 g, 27.2 mmol) in DMF (53.3 mL). After stirring at 45? C. for 2 hours, the mixture was cooled to room temperature, and H.sub.2O and saturated aqueous NaHCO.sub.3 were added to the mixture. The resulting solid was collected by filtration, and vacuum-dried at 40? C., thereby obtaining crude 4-iodo-3-methoxy-N,5-dimethyl-2-nitroaniline (8.48 g, 97%).

Step 3:

[0404] ##STR00157##

[0405] NH.sub.4Cl (3.52 g, 65.8 mmol) and iron (7.35 g, 132 mmol) were added to a solution of 4-iodo-3-methoxy-N,5-dimethyl-2-nitroaniline (8.48 g, 26.3 mmol) in MeOH (43.8 mL), THF (43.8 mL) and H.sub.2O (21.9 mL). After stirring at 60? C. for 3 hours, the mixture was cooled to room temperature and diluted with EtOAc then filtered through a CELITE pad. The filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining 4-iodo-3-methoxy-N1,5-dimethylbenzene-1,2-diamine (6.68 g, 87%).

Step 4:

[0406] ##STR00158##

[0407] conc. HCl (95.4 ?L, 1.15 mmol) and AcOH (656 ?L, 11.5 mmol) were added to a solution of 4-iodo-3-methoxy-N1,5-dimethylbenzene-1,2-diamine (3.35 g, 11.5 mmol) in trimethyl orthoacetate (20.4 mL, 160 mmol). After stirring at room temperature for 14 hours, the reaction was quenched with 10 mol/L aqueous NaOH (1.33 mL, 12.7 mmol). The reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/EtOAc), thereby obtaining the title compound (2.09 g, 58%).

Synthesis of (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone

Step 1:

[0408] ##STR00159##

[0409] CuBr2 (4.23 g, 19.0 mmol) was added to a solution of 3,4,5-trifluoroacetophenone (1.50 g, 8.61 mmol) in EtOAc (22.0 mL) and the reaction heated to 70? C. overnight. After cooling, the reaction was filtered through CELITE and the filtrate washed sequentially with sat. aq. NaHCO.sub.3 (3?) and brine, then dried (MgSO.sub.4) and evaporated to give intermediate 2-bromo-1-(3,4,5-trifluorophenyl)ethan-1-one.

[0410] 3-bromo-2-methylpyridine (1.64 mL, 14.2 mmol) was added to a solution of 2-bromo-1-(3,4,5-trifluorophenyl)ethan-1-one (1.80 g, 7.11 mmol) in THF (10.0 mL) and the reaction heated to 80? C. for 4 h. Further 3-bromo-2-methylpyridine (0.820 mL, 7.11 mmol) was added and heating continued overnight. After cooling, heptane (15 mL) was added and the resultant precipitate collected via filtration, washing with further heptane, and dried in vacuo to give 3-bromo-2-methyl-1-[2-oxo-2-(3,4,5-trifluorophenyl)ethyl]pyridin-1-ium bromide. MS: [M]+=344.

Step 2:

[0411] ##STR00160##

[0412] A mixture of DMF (4.08 mL, 52.7 mmol) and dimethyl sulfate (4.99 mL, 52.7 mmol) was heated to 80? C. for 2 h. After cooling, this solution was added to a separate solution of 3-bromo-2-methyl-1-[2-oxo-2-(3,4,5-trifluorophenyl)ethyl]pyridin-1-ium bromide (2.80 g, 6.59 mmol) in DMF (10 mL) and the reaction stirred at RT for 30 min. N,N-diisopropylethylamine (9.18 mL, 52.7 mmol) was added and the resulting suspension allowed to stand for 30 min. H.sub.2O (?50 mL) was added and, after standing for a further 30 min, the precipitate was collected via filtration, washing with further water, and the solid dried in vacuo. This solid was re-crystallised from boiling EtOAc (?25 mL) to give (8-bromoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone. MS: [M+H]+=354.

Step 3:

[0413] ##STR00161##

[0414] A solution of (8-bromoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (82.0 g, 232 mmol), 2-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)-5,5-dimethyl-1,3,2-dioxaborinane (63.0 g, 279 mmol), [1,1-bis(diphenylphosphino)ferrocene]dichloropalladium(II) dichloromethane Adduct (4.70 g, 5.80 mmol), potassium acetate (39.0 g, 395 mmol) in THF (750 mL) was evacuated and N.sub.2 back-filled before heating to reflux temperature (oil bath: 93? C.) for 1.5 hours. After cooling, the reaction mixture was filtered, rinsing with EtOAc, and the filtrate was washed with brine. The resulting suspension was filtered, rinsing with EtOAc, and the filtrate was washed with aqueous NaHCO.sub.3 and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was suspended in EtOAc (100 mL), stirred at room temperature for 3 hours. The solid was collected by filtration, washing with further hexane/EtOAc=3/1 (100 mL), and vacuum-dried, thereby obtaining the title compound (50.9 g, 57%). The filtrate was evaporated and purified by column chromatography on silica gel (hexane/EtOAc). The solid was suspended in EtOAc (7.0 mL) and hexane (14 mL) was slowly added. The suspension was stirred at room temperature for 2 hours and collected by filtration, washing with further hexane/EtOAc=5/1, and vacuum-dried, thereby obtaining the title compound (4.50 g, 5%).

Synthesis of (4-amino-3,5-difluorophenyl)(8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)methanone

Step 1:

[0415] ##STR00162##

[0416] A 5 L pressure vessel was charged with (8-bromoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (208 g, 0.59 mol), THF (2 L), and 28% NH3 aq. (830 ml), and heated at 135? C., with stirring for 24 hr. The mixture was cooled to rt, poured into ice-water (1 L), and stirred for 2 hr. The precipitate was collected by filtration and rinsed with water (1 L) to give a crude solid. The solid was added EtOAc (0 L) and heated at 65? C. To the mixture was slowly added hexane (2 L) then cooled down to rt. After stirring at rt for 20 hr, the solid was collected by filtration, rinsed with hexane/EtOAc (3/1), dried in vacuo to give 4-(8-Bromoindolizine-3-carbonyl)-2,6-difluoroaniline. MS: [M+H]+=351.

Step 2:

[0417] ##STR00163##

[0418] A 10 L 4-necked flask was charged with (4-amino-3,5-difluorophenyl)(8-bromoindolizin-3-yl)methanone (396 g, 1.13 mol), dry THF (3.8 L), and KOAc (188 g, 1.92 mol, 1.7 eq). The mixture was de-gassed (nitrogen gas was passed through the mixture at 50? C. for 40 min) and the mixture was added PdCl.sub.2(dppf)-CH.sub.2Cl.sub.2 (28.6 g, 0.035 mol) and bis(neopentyl Glycolato) diboron (331 g, 1.47 mol). The resulting mixture was stirred at 70? C. for 10 hr. After cooled down to rt, the mixture was poured into ice-water (4 L), added EtOAc (4 L), and filtered (CELITE). The filtrate was separated and the aq. phase was re-extracted with EtOAc (2 L). Organic phases were combined and washed with water (3.5 L), sat NaCl aq. (3.5 L), dried (Na.sub.2SO.sub.4), filtered, and concentrated. The resulting crude material was purified by column chromatography (SiO.sub.2 10 kg, CH.sub.2Cl.sub.2/EtOAc=10/1 to 3/1) and the resulting solid was further purified by washing with Hexane (500 ml) to give the title compound.

Synthetic Procedure F

Example 130, 130-1 and 130-2

(E)-N-(4-(9,13-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide

Step 1:

[0419] ##STR00164##

[0420] To a mixture of (9,13-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (129 mg, 0.244 mmol), obtained in the same manner as Example 42, in 1,4-dioxane (2.40 mL) was added 28-30% NH.sub.3 aq. (8.20 mL). The reaction mixture was heated at 130? C. by microwave irradiation for 15 hours. After cooling, the mixture was diluted with EtOAc, washed with brine, dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone) to obtain (4-amino-3,5-difluorophenyl)(9,13-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (1.sup.st-eluting diastereomer, 2.sup.nd-luting diastereomer).

Step 2:

[0421] ##STR00165##

[0422] A solution of (4-amino-3,5-difluorophenyl)(9,13-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (2.sup.nd-eluting diastereomer; 105 mg, 0.199 mmol), 4-chlorocrotonic acid (30.1 mg, 0.249 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 0.312 mL, 0.499 mmol) in DMF (1.99 mL) was stirred at room temperature for 20 minutes. Then triethylamine (0.111 mL, 0.798 mmol) was added thereto, and the mixture was stirred at room temperature for 3 hours. 4-Chlorocrotonic acid (15.0 mg, 0.124 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 0.156 mL, 0.250 mmol) were added and the reaction mixture was stirred at room temperature for 15 minutes. Then triethylamine (55.5 ?L, 0.399 mmol) was added thereto, and the mixture was stirred at room temperature for 30 minutes. To the resulting mixture was added saturated aqueous NaHCO.sub.3 and water, and the resulting mixture was extracted with EtOAc. The organic layer was washed successively with H.sub.2O, saturated aqueous NaHCO.sub.3, brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone) to obtain (E)-4-chloro-N-(4-(9,13-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide.

Step 3:

[0423] ##STR00166##

[0424] A mixture of (E)-4-chloro-N-(4-(9,13-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (125 mg, 0.199 mmol), KI (99.0 mg, 0.596 mmol) and 3-methyloxetan-3-amine (88.3 ?L, 0.994 mmol) in DMSO (2.00 mL) was stirred at 40?50? C. for 4.5 hours. The mixture was diluted with water and extracted with EtOAc. The organic layer was washed with water, brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/methanol) to obtain (E)-N-(4-(9,13-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide as Example 130.

Step 4:

[0425] ##STR00167##

[0426] The racemate was separated by chiral SFC separation (Column: Daicel Chiralcel OD, 250 mm?30 mm, 0.1% NH.sub.4OH in EtOH) to give the title compound (1st-eluting isomer. Example 130-1) and (2nd-eluting isomer. Example 130-2). .sup.1H NMR (400 MHz, CDCl.sub.3) ? 10.02 (dd, J=7.00, 0.96 Hz, 1H), 8.04 (s, 1H), 7.76 (s, 1H), 7.43 (d, J=7.83 Hz, 2H), 7.20-7.12 (m, 4H), 7.04 (t, J=7.10 Hz, 1H), 6.34 (dt, J=15.28, 1.68 Hz, 1H), 4.98 (m, 1H), 4.58 (d, J=6.26 Hz, 2H), 4.43 (d, J=6.50 Hz, 2H), 3.97 (s, 3H), 3.54-3.52 (m, 2H), 3.01-2.96 (m, 1H), 2.35 (d, J=15.01 Hz, 1H), 1.52 (s, 3H), 1.23 (d, J=6.18 Hz, 3H); ESI-MS [M+H].sup.+: 680.

##STR00168##

Example 131

(E)-N-(4-(9,13-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide

[0427] Example 131 was attained in the same manner as Example 130, using 1st-eluting diastereomer in Step 1, to yield the racemic mixture. .sup.1H NMR (400 MHz, CDCl.sub.3) ? 9.96 (dd, J=6.84, 1.12 Hz, 1H), 8.00 (s, 1H), 7.76 (s, 1H), 7.45 (d, J=7.84 Hz, 2H), 7.17-7.11 (m, 2H), 7.06-6.95 (m, 3H), 6.33 (d, J=15.32 Hz, 1H), 4.60 (d, J=6.36 Hz, 2H), 4.59-4.51 (m, 1H), 4.44 (d, J=6.49 Hz, 2H), 3.95 (s, 3H), 3.56-3.54 (m, 2H), 2.88-2.82 (m, 1H), 2.58-2.54 (m, 1H), 1.53 (s, 3H), 1.50 (d, J=6.61 Hz, 3H); ESI-MS [M+H].sup.+: 680.

Synthetic Procedure L

Example 71

(E)-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide

Step 1:

[0428] ##STR00169##

[0429] To a mixture of 5-bromo-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazole (4.39 g, 15 mmol) in H.sub.2SO.sub.4 (15 mL) was added KNO.sub.3 (1.80 g, 17.8 mmol) at 0? C. The mixture was warmed to room temperature and stirred for 2 hours. The mixture was carefully poured into crushed ice and 30% NH.sub.3 aq. was added until the mixture was neutralized. The resulting precipitate was collected by filtration, washed with water, and dried in vacuo at 50? C. to obtain 5-bromo-1,2-dimethyl-4-nitro-6-(trifluoromethyl)-1H-benzo[d]imidazole.

Step 2:

[0430] ##STR00170##

[0431] A solution of 5-bromo-1,2-dimethyl-4-nitro-6-(trifluoromethyl)-1H-benzo[d]imidazole (5.10 g, 15.0 mmol), iron powder (4.18 g, 74.8 mmol) and NH.sub.4Cl (4.00 g, 74.8 mmol) in EtOH (100 mL) and H.sub.2O (20 mL) was stirred at 70? C. for 30 minutes. The mixture was diluted with EtOAc (500 mL), and the mixture was filtered and concentrated. Water and CHCl.sub.3 were added to the filtrate, and the organic layer was separated, washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was diluted with diisopropyl ether, and the precipitate was collected by filtration to obtain 5-bromo-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-amine.

Step 3:

[0432] ##STR00171##

[0433] A solution of 5-bromo-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-amine (1.23 g, 3.99 mmol), (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (2.32 g, 5.99 mmol), SPhos Pd G3 (281 mg, 0.399 mmol) in THF (40 mL) and 1 M K.sub.3PO.sub.4 aq. (5.99 mL, 5.99 mmol) was evacuated and N.sub.2 back-filled before heating to 75? C. for 1.5 hours. After cooling, the reaction mixture was diluted with EtOAc. The mixture was filtered, rinsing with EtOAc, and the filtrate was washed with H.sub.2O, brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)). The residue was washed with diisopropyl ether, and the precipitate was collected by filtration to obtain (8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 4:

[0434] ##STR00172##

[0435] NIS (339 mg, 1.50 mmol) and TFA (0.25 mL, 3.37 mmol) were added to a solution of (8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (720 mg, 1.43 mmol) in THF (10 mL). After stirring at room temperature for 70 minutes, additional NIS (50 mg, 0.222 mmol) was added. After stirring at room temperature for 2 hours, the mixture was diluted with EtOAc, sat. NaHCO.sub.3 aq., and sat. Na.sub.2S.sub.2O.sub.3 aq. The organic layer was separated, washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was triturated with diisopropyl ether and the precipitate was collected by filtration to obtain (8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 5:

[0436] ##STR00173##

[0437] A mixture of (8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (467 mg, 0.743 mmol), 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (0.787 mL, 3.72 mmol) and Pd(PPh.sub.3).sub.4 (85.9 mg, 0.0743 mmol) in 1,4-dioxane (7.0 mL) and 2 M Na.sub.2CO.sub.3 aq. (1.86 mL, 3.72 mmol) was evacuated and N.sub.2 back-filled before heating to 95? C. for 4 hours. After cooling, the reaction mixture was diluted with EtOAc, washed with water and brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was triturated with diisopropyl ether and the precipitate were collected by filtration. The precipitate was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (E)-(8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 6:

[0438] ##STR00174##

[0439] To a solution of (E)-8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (806 mg, 1.41 mmol) in CH.sub.2Cl.sub.2 (20.3 mL) was added sodium triacetoxyborohydride (597 mg, 2.82 mmol) and TFA (2.09 mL, 28.2 mmol) at room temperature. After stirring at room temperature for 3 minutes, the reaction was quenched with sat. NaHCO.sub.3 aq. and 5 M NaOH aq., and the mixture was diluted with EtOAc. The organic layer was washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (9,10-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone.

Step 7:

[0440] ##STR00175##

[0441] A mixture of (9,10-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (364 mg, 0.689 mmol), 37% aqueous formaldehyde solution (0.104 mL, 1.38 mmol) and 0.3 M Zn(BH.sub.3CN).sub.2 in MeOH (3.44 mL, 1.03 mmol; prepared from NaBH.sub.3CN (1.03 mmol) and ZnCl.sub.2 (0.515 mmol)) in THF (4.0 mL) was stirred at room temperature for 45 minutes. EtOAc and 30% ammonium solution were added. The layers were separated, and the organic layer was washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (3,4,5-trifluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 8:

[0442] ##STR00176##

[0443] To the mixture of (3,4,5-trifluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (205 mg, 0.378 mmol) in 1,4-dioxane (1.5 mL) was added 28-30% NH.sub.3 aq. (3.0 mL). The reaction mixture was heated to 135? C. by microwave irradiation for 12 hours. After cooling, the mixture was diluted with EtOAc, washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (4-amino-3,5-difluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 9:

[0444] ##STR00177##

[0445] A solution of (4-amino-3,5-difluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (176 mg, 0.326 mmol) and triethylamine (1.28 mL, 9.38 mmol) in DMF (7.1 mL) was slowly added 0.4 mL of 4-chlorocrotonic acid T3P solution (prepared from (E)-4-chlorobut-2-enoic and T3P (50 wt % in THF) (1 mL/100 mg (4-chlorocrotonic acid))). Additional 4-chlorocrotonic acid T3P solution (0.3 mL) was added thereto. The resulting mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq., water, brine, dried over Na.sub.2SO.sub.4, and evaporated. To the residue was added DMSO (2 mL) and 3-methyloxetan-3-amine (140 ?L), and the mixture was stirred at 45? C. for 3.5 hours. The mixture was purified by preparative reversed-phase HPLC (water:acetonitrile (0.1% formic acid)). Saturated NaHCO.sub.3 aq. was added to the purified fractions containing the title compound, and the mixture was extracted with EtOAc. The combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4, and the solvent was evaporated under reduced pressure to obtain (E)-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide.

[0446] The racemate was separated by CHIRALPAK-IA (hexane-EtOH (0.1% Et.sub.3N): 75/25), and the 2.sup.nd elution was the title compound. .sup.1H NMR (400 MHz, CDCl.sub.3) ? 9.97 (d, J=6.8 Hz, 1H), 7.67 (s, 1H), 7.50 (s, 1H), 7.39 (d, J=8.5 Hz, 2H), 7.16-7.06 (m, 3H), 7.00 (t, J=6.8 Hz, 1H), 6.36 (d, J=15.3 Hz, 1H), 4.59 (d, J=6.0 Hz, 2H), 4.44 (d, J=5.8 Hz, 2H), 3.82 (s, 3H), 3.53 (s, 2H), 3.44 (d, J=9.5 Hz, 1H), 3.09 (s, 3H), 2.89-2.83 (m, 1H), 2.68 (s, 3H), 2.54 (d, J=14.5 Hz, 1H), 2.27 (t, J=13.4 Hz, 1H), 1.52 (s, 3H); ESI-MS [M+H].sup.+: 693.

Example 92

[0447] (E)-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide

Step 1:

[0448] ##STR00178##

[0449] 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-amine (500 mg, 1.48 mmol), (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (1.15 g, 2.96 mmol), SPhos Pd G3 (281 mg, 0.148 mmol) in THF (15 mL) and 2 M K.sub.3PO.sub.4 aq. (1.85 mL, 3.70 mmol) was evacuated and N.sub.2 back-filled before heating to 80? C. overnight. After cooling, the reaction mixture was diluted with EtOAc. The mixture was filtered, rinsing with EtOAc, and the filtrate was washed with water, brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel twice (hexane-EtOAc/EtOH (4/1), then hexane-acetone). The residue was triturated with diisopropyl ether to obtain (8-(4-amino-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 2:

[0450] ##STR00179##

[0451] NIS (254 mg, 1.13 mmol) and TFA (0.210 mL, 2.26 mmol) were added to (8-(4-amino-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (651 mg, 1.13 mmol) in THF (5.5 mL). After stirring at room temperature for 4.5 hours, the mixture was diluted with EtOAc, sat. NaHCO.sub.3 aq., and sat. Na.sub.2S.sub.2O.sub.3 aq. The organic layer was separated, washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-acetone). The residue was triturated with diisopropyl ether and the precipitate was collected by filtration to obtain (8-(4-amino-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 3:

[0452] ##STR00180##

[0453] A mixture of (8-(4-amino-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (599 mg, 0.910 mmol), 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (0.964 mL, 4.55 mmol), Pd(PPh.sub.3).sub.4 (105 mg, 0.0910 mmol) in 1,4-dioxane (8.0 mL) and 2 M Na.sub.2CO.sub.3 aq. (2.05 mL, 3.72 mmol) was evacuated and N.sub.2 back-filled before heating to 100? C. for 10 hours. After cooling, the reaction mixture was diluted with EtOAc, washed with water and brine, then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-acetone) to obtain (E)-(8-(4-amino-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 4:

[0454] ##STR00181##

[0455] To a solution of (E)-(8-(4-amino-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (550 mg, 0.913 mmol) in CH.sub.2Cl.sub.2 (20.3 mL) was added sodium triacetoxyborohydride (580 mg, 2.74 mmol) and TFA (2.03 mL, 27.4 mmol) at room temperature. After stirring at room temperature for 3 minutes, the reaction was diluted with sat. NaHCO.sub.3 aq. and 5 M NaOH aq., then the resulting mixture was diluted with EtOAc. The organic layer was washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (10-(methoxymethyl)-9-methyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone.

Step 5:

[0456] ##STR00182##

[0457] A mixture of (10-(methoxymethyl)-9-methyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (510 mg, 0.913 mmol), aqueous 37% formaldehyde solution (0.228 mL, 2.74 mmol) and 0.3 M zinc cyanoborohydride solution in methanol (6.09 mL, 1.83 mmol; prepared from NaBH.sub.3CN and ?ZnCl.sub.2) in THF (7.0 mL) was stirred at room temperature for 1 hour. The mixture was diluted with EtOAc and sat. NaHCO.sub.3 aq., and the organic layer was washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (10-(methoxymethyl)-9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone.

Step 6:

[0458] ##STR00183##

[0459] To a solution of (10-(methoxymethyl)-9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (450 mg, 0.786 mmol) in 1,4-dioxane (5.0 mL) was added 28-30% NH.sub.3 aq. (10 mL). The reaction mixture was heated at 130? C. under microwave irradiation for 12 hours. After cooling, the mixture was diluted with EtOAc, washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (4-amino-3,5-difluorophenyl)(10-(methoxymethyl)-9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 7:

[0460] ##STR00184##

[0461] A solution of (4-amino-3,5-difluorophenyl)(10-(methoxymethyl)-9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (408 mg, 0.716 mmol) and triethylamine (2.00 mL, 1.43 mmol) in DMF (4.0 mL) was slowly added 0.895 mL of 4-chlorocrotonic acid T3P solution (prepared from (E)-4-chlorobut-2-enoic and T3P (50 wt % in THF) (100 mg 4-chlorocrotonic acid/mL)). Additional 4-chlorocrotonic acid T3P solution (0.895 mL) was added. The resulting mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 aq., water, brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (E)-4-chloro-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)but-2-enamide.

Step 8:

[0462] ##STR00185##

[0463] To a solution of (E)-4-chloro-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)but-2-enamide (150 mg, 0.223 mmol) in DMSO (0.50 mL) were added 3-methyloxetan-3-amine (98.3 ?L, 1.12 mmol) and potassium iodide (55.8 mg, 0.336 mmol), and the mixture was stirred at 50? C. for 2 hours. The mixture was purified by column chromatography on silica gel (CHCl.sub.3 (0.5% Et.sub.3N)-MeOH) to obtain (E)-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide.

[0464] The racemate was separated by CHIRALPAK-IE (DAICEL) (hexane-EtOH (0.1% Et.sub.3N) (10/90)), and the 2.sup.nd elution product was the title compound. .sup.1H NMR (400 MHz, CHLOROFORM-D) ? 9.97 (dd, J=7.0, 1.0 Hz, 1H), 7.75 (s, 1H), 7.41 (d, J=7.8 Hz, 2H), 7.31-7.24 (m, 1H), 7.18-6.98 (m, 4H), 6.34 (d, J=15.3 Hz, 1H), 4.81 (d, J=1.8 Hz, 2H), 4.59 (d, J=6.3 Hz, 2H), 4.44 (d, J=6.5 Hz, 2H), 3.94 (s, 3H), 3.53 (dd, J=5.1, 1.6 Hz, 2H), 3.48-3.43 (m, 4H), 3.10 (s, 3H), 2.91-2.84 (m, 1H), 2.56-2.52 (m, 1H), 2.27 (td, J=14.0, 4.3 Hz, 1H), 1.52 (s, 3H); ESI-MS [M+H].sup.+: 723.

Example 140

[0465] (E)-N-(2,6-difluoro-4-(7-methoxy-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide

Steps 1-3:

[0466] ##STR00186##

[0467] Methylamine (2 M THE solution, 30 mL) was added to a solution of 1,3-difluoro-5-methoxy-2-nitrobenzene (5.67 g, 30 mmol) in THF (21 mL). After stirring at room temperature for 15 minutes, water and EtOAc were added to the mixture. The organic layer was separated, washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was diluted in THF (100 mL), cooled to 0? C., and NBS (5.34 g, 30.0 mmol) was added. After stirring for 50 minutes, the precipitate was collected by filtration and washed with diisopropylether to obtain 4-bromo-3-fluoro-5-methoxy-N-methyl-2-nitroaniline (4.58 g). The above filtrate also contained 4-bromo-3-fluoro-5-methoxy-N-methyl-2-nitroaniline mainly and the filtrate was only used for the next reaction after evaporation Acetic anhydride (40 mL) was added to the residue, then the reaction mixture was heated at 175? C. by microwave irradiation for 1 hour. After cooling, the mixture was diluted with MeOH and evaporated. The residue was diluted with EtOAc, washed with sat. NaHCO.sub.3 aq., brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc) to obtain N-(4-bromo-3-fluoro-5-methoxy-2-nitrophenyl)-N-methylacetamide.

Step 4:

[0468] ##STR00187##

[0469] To the mixture of N-(4-bromo-3-fluoro-5-methoxy-2-nitrophenyl)-N-methylacetamide (4.66 g, 14.5 mmol) in THF (20 mL) was added methylamine (2 M THF solution, 21.8 mL). After stirring at room temperature for 30 minutes, water and EtOAc were added to the mixture. The organic layer was separated, washed with brine, and dried over Na.sub.2SO.sub.4. After evaporation, the residue was triturated with diisopropyl ether and collected by filtration to obtain N-(4-bromo-5-methoxy-3-(methylamino)-2-nitrophenyl)-N-methylacetamide.

Step 5:

[0470] ##STR00188##

[0471] A mixture of N-(4-bromo-5-methoxy-3-(methylamino)-2-nitrophenyl)-N-methylacetamide (2.32 g, 6.98 mmol), (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (4.05 g, 10.5 mmol) and SPhos Pd G3 (252 mg, 0.323 mmol) in toluene (49 mL) and 1 M K.sub.3PO.sub.4 aq. (12.6 mL, 12.6 mmol) was evacuated and N.sub.2 back-filled before heating to 100? C. for 1 hour. After cooling, the resulting mixture was diluted with EtOAc and the insoluble matters were removed by filtration. The filtrate was washed with water, brine, and dried over Na.sub.2SO.sub.4. After evaporation, the resulting residue was purified by column chromatography on silica gel (hexane-EtOAc (+10% CHCl.sub.3)) to obtain N-(5-methoxy-3-(methylamino)-2-nitro-4-(3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)phenyl)-N-methylacetamide.

Step 6:

[0472] ##STR00189##

[0473] To a solution of N-(5-methoxy-3-methylamino)-2-nitro-4-(3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)phenyl)-N-methylacetamide (2.06 g, 3.91 mmol) in ethanol (20 mL) and THF (50 mL) was added palladium hydroxide on carbon (2.90 g, 20 wt. % loading (dry basis)). The mixture was stirred at room temperature overnight under hydrogen atmosphere. After nitrogen purging, the mixture was filtered and the filter cake was rinsed with EtOAc and MeOH. To the filtrate was added acetic acid (2 mL), and the mixture was concentrated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to give (8-(6-methoxy-1,2-dimethyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 7:

[0474] ##STR00190##

[0475] To a solution of (8-(6-methoxy-1,2-dimethyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (1.99 g, 4.16 mmol) in THF (50 mL) was added NIS (960 mg, 4.27 mmol) and TFA (1.60 mL, 21.5 mmol). After stirring at room temperature for 3 hours, the mixture was diluted with EtOAc, sat. NaHCO.sub.3 aq., and sat. Na.sub.2S.sub.2O.sub.3 aq. The organic layer was separated, washed with brine, and dried over Na.sub.2SO.sub.4. After evaporation, the obtained residue was diluted with diisopropyl ether and the precipitate was collected by filtration to obtain (1-iodo-8-(6-methoxy-1,2-dimethyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 8:

[0476] ##STR00191##

[0477] A mixture of (1-iodo-8-(6-methoxy-1,2-dimethyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (2.14 g, 3.54 mmol), 2-[(f)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (3.75 mL, 17.7 mmol) and Pd(PPh.sub.3).sub.4 (300 mg) in 1,4-dioxane (54 mL) and 2 M Na.sub.2CO.sub.3 aq. (8.85 mL, 17.7 mmol) was evacuated and N.sub.2 back-filled before heating to 95? C. for 6 hours. After cooling, the reaction mixture was diluted with EtOAc, washed with water and brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was triturated by diisopropyl ether and the precipitates were collected by filtration to obtain (E)-(1-(2-ethoxyvinyl)-8-(6-methoxy-1,2-dimethyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 9:

[0478] ##STR00192##

[0479] To a solution of (E)-(1-(2-ethoxyvinyl)-8-(6-methoxy-1,2-dimethyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (1.64 g, 3.00 mmol) in CH.sub.2Cl.sub.2 (25 mL) was added sodium triacetoxyborohydride (1.27 g, 5.99 mmol) and TFA (5.56 mL, 74.9 mmol) at room temperature. After stirring at room temperature for 30 minutes, the reaction was diluted with sat. NaHCO.sub.3 aq., and the resulting mixture was diluted with EtOAc. The organic layer was separated, washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was triturated by diisopropyl ether and the precipitates were collected by filtration to obtain (7-methoxy-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone.

Step 10:

[0480] ##STR00193##

[0481] To the mixture of (7-methoxy-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (1.50 g, 2.97 mmol) in 1,4-dioxane (12 mL) was added 28-30% NH.sub.3 aq. (24 mL). The reaction mixture was heated to 135? C. by microwave irradiation for 13 hours. After cooling, the mixture was diluted with EtOAc, washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was triturated by EtOAc and diisopropyl ether, and the precipitate was collected by filtration to obtain (4-amino-3,5-difluorophenyl)(7-methoxy-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone.

Steps 11-12:

[0482] ##STR00194##

[0483] To the mixture of (4-amino-3,5-difluorophenyl)(7-methoxy-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (393 mg, 0.784 mmol), (E)-4-chlorobut-2-enoic acid (123 mg, 1.02 mmol) and T3P (50 wt % in THF, 1.47 mL) in THF (5 mL) was added triethylamine (0.641 mL, 4.70 mmol). After stirring at room temperature for 30 minutes, the resulting mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 aq., water, brine, then dried over Na.sub.2SO.sub.4 and evaporated. To the residue was added DMSO (5 mL) and 1-methylcyclopropanamine (0.435 mL) and the mixture was stirred at room temperature for 5 hours. Additional methylcyclopropanamine (0.2 mL) was added, and the mixture was stirred at room temperature for 2 hours. Water was added and the mixture was extracted with EtOAc. The combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was suspended with ethanol and diisopropyl ether, and collected by filtration to obtain (E)-N-2,6-difluoro-4-(7-methoxy-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide.

[0484] The racemate was separated by CHIRALPAK-IE (hexane-EtOH (0.1% Et.sub.3N): 10/90) to obtain the title compound (as 2.sup.nd elution). .sup.1H NMR (400 MHz, CDCl.sub.3) ? 9.99 (dd, J=7.0, 1.0 Hz, 1H), 7.44-7.37 (m, 2H), 7.25 (dd, J=7.1, 1.1 Hz, 1H), 7.16-7.08 (m, 3H), 7.04-7.00 (m, 1H), 6.78 (s, 1H), 6.25-6.20 (m, 1H), 3.79 (s, 3H), 3.73 (s, 3H), 3.69 (t, J=2.6 Hz, 1H), 3.56-3.50 (m, 3H), 3.06 (s, 3H), 2.89-2.83 (m, 1H), 2.62 (s, 3H), 2.58-2.54 (m, 1H), 2.49-2.41 (m, 1H), 1.29 (s, 3H), 0.61 (dd, J=5.9, 4.6 Hz, 2H), 0.41 (dd, J=6.4, 4.4 Hz, 2H); ESI-MS [M+H].sup.+: 639.

Example 146

[0485] (E)-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazole-2-carbonyl)phenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide

Step 1:

[0486] ##STR00195##

[0487] Hydrazine monohydrate (0.840 mL) was added to 1-(2-fluoro-5-(trifluoromethyl)phenyl)ethan-1-one (3.0) g, 14.6 mmol) in NMP (25.0 mL) and the mixture was stirred at 160? C. using microwave irradiation for 8 hours. After dilution with EtOAc, the mixture was washed with a saturated NaHCO.sub.3 solution, brine, and dried over Na.sub.2SO.sub.4. After evaporation, the residue was purified by silica gel column chromatography (hexane:ethyl acetate) to obtain 3-methyl-5-(trifluoromethyl)-1H-indazole.

Step 2:

[0488] ##STR00196##

[0489] A solution of 3-methyl-5-(trifluoromethyl)-1H-indazole (280 mg, 1.40 mmol) in H.sub.2SO.sub.4 (0.68 mL) was cooled to ? C., and potassium nitrate (198 mg, 1.96 mmol) was added. After stirring at 0? C. for 15 minutes, the reaction mixture was poured into ice. The mixture was diluted with EtOAc, the organic layer was washed with diluted NH.sub.4OH, brine, and dried over Na.sub.2SO.sub.4. After evaporation, the residue was purified by silica gel column chromatography (hexane:ethyl acetate) to afford 3-methyl-7-nitro-5-(trifluoromethyl)-1H-indazole.

Step 3:

[0490] ##STR00197##

[0491] 3-Methyl-7-nitro-5-(trifluoromethyl)-1H-indazole (330 mg, 1.35 mmol) and trimethyloxonium tetrafluoroborate (597 mg) in acetone (6 mL) were stirred at 30? C. for 1 hour. After evaporation, EtOAc and saturated NaHCO.sub.3 solution were added to the mixture. The layers were separated and the aqueous later was extracted with EtOAc. The combined organic layers were washed with brine, dried over Na.sub.2SO.sub.4, and concentrated to afford 2,3-dimethyl-7-nitro-5-(trifluoromethyl)-2H-indazole.

Step 4:

[0492] ##STR00198##

[0493] A solution of 23-dimethyl-7-nitro-5-(trifluoromethyl)-2H-indazole (2.27 g, 8.76 mmol), iron powder (2.5 g), and 2 M NH.sub.4Cl solution (10 mL) in methanol (15 mL) and THF (15 mL) was stirred at 75? C. for 2 hours. The insoluble material was filtered and the filtrate was concentrated under reduced pressure. The residue was diluted with EtOAc, washed with water, brine, and dried over Na.sub.2SO.sub.4. After evaporation, residue was purified by silica gel column chromatography (hexane:ethyl acetate) to afford 2,3-dimethyl-5-(trifluoromethyl)-2H-indazol-7-amine.

Step 5:

[0494] ##STR00199##

[0495] A solution of 2,3-dimethyl-5-(trifluoromethyl)-2H-indazol-7-amine (2.03 g) obtained in step 4 and N-bromosuccinimide (1.51 g) in DMF (30 mL) was stirred at room temperature for 30 minutes. The mixture was diluted with ethyl acetate and washed with a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining 6-bromo-2,3-dimethyl-5-(trifluoromethyl)-2H-indazol-7-amine.

Step 6:

[0496] ##STR00200##

[0497] A solution of 6-bromo-2,3-dimethyl-5-(trifluoromethyl)-2H-indazol-7-amine (174 mg) obtained in step 5, (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (394 mg), SPhos Pd G3 (39.8 mg) in THF (5.00 mL) and 2M K.sub.3PO.sub.4 aq. (0.71 mL) was evacuated and N.sub.2 back-filled before heating to 80? C. for 1 hour using microwave. After cooling, the reaction mixture was diluted with EtOAc. The resulting suspension was filtered, rinsing with EtOAc, and the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:acetone), thereby obtaining (8-(7-amino-2,3-dimethyl-5-(trifluoromethyl)-2H-indazol-6-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 7:

[0498] ##STR00201##

[0499] N-iodosuccinimide (160 mg) was added to a solution of (8-(7-amino-2,3-dimethyl-5-(trifluoromethyl)-2H-indazol-6-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (330 mg) and TFA (0.22 mL) in THF (10 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (8-(7-amino-2,3-dimethyl-5-(trifluoromethyl)-2H-indazol-6-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 8:

[0500] ##STR00202##

[0501] A solution of (8-(7-amino-2,3-dimethyl-5-(trifluoromethyl)-2H-indazol-6-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (224 mg), 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (0.38 mL), Pd(PPh.sub.3).sub.4 (41.2 mg) and 2M Na.sub.2CO.sub.3 aq. (0.89 mL) in 1,4-dioxane (5.0 mL) was evacuated and N.sub.2 back-filled before heating to 90? C. for 3 hours. After cooling, the reaction mixture was diluted with ethyl acetate, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (E)-(8-(7-amino-2,3-dimethyl-5-(trifluoromethyl)-2H-indazol-6-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 9:

[0502] ##STR00203##

[0503] Sodium triacetoxyborohydride (160 mg) was added to a solution of (E)-(8-(7-amino-2,3-dimethyl-5-(trifluoromethyl)-2H-indazol-6-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (140 mg) and TFA (0.22 mL) in dichloromethane (10 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with chloroform, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (ethyl acetate:ethanol), thereby obtaining (9,10-dimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazol-2-yl)(3,4,5-trifluorophenyl)methanone.

Step 10:

[0504] ##STR00204##

[0505] 0.3M sodium cyanoborohydride-1/2 zinc chloride in methanol (0.66 mL) was added to a solution of (9,10-dimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazol-2-yl)(3,4,5-trifluorophenyl)methanone (52.0 mg) and 36% formaldehyde solution in water (25 ?L) in THF (0.80 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with ethyl acetate, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (3,4,5-trifluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazol-2-yl)methanone.

Step 11:

[0506] ##STR00205##

[0507] A solution of (3,4,5-trifluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazol-2-yl)methanone (48.0 mg) obtained in step 10 and 28% ammonia solution in water (2.5 mL) in 1,4-dioxane (2.5 mL) was stirred at 140? C. for 12 hours using microwave irradiation. After dilution with ethyl acetate and water, the mixture was extracted with ethyl acetate. The combined organic layer was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining (4-amino-3,5-difluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazol-2-yl)methanone.

Step 12:

[0508] ##STR00206##

[0509] (E)-4-chlorobut-2-enoic acid (12.5 mg) and 1-propanephosphonic acid anhydride cyclic trimer (a 1.7M THF solution, 125 ?L) were added to a solution of (4-amino-3,5-difluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazol-2-yl)methanone (43.0 mg) in DMF (2.0 mL), followed by stirring at room temperature for 20 minutes. Triethylamine (45 ?L) was added to the reaction mixture. A reaction was performed at room temperature for 2 hours. After water was added to the reaction mixture, extraction was performed with ethyl acetate, followed by washing the organic layer with a saturated sodium chloride solution. The washed organic layer was dried over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining (E)-4-chloro-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazole-2-carbonyl)phenyl)but-2-enamide.

Step 13:

[0510] ##STR00207##

[0511] 3-methyloxetan-3-amine (35 ?L) and potassium iodide (19.8 mg) were added to a solution of (E)-4-chloro-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazole-2-carbonyl)phenyl)but-2-enamide (51.0 mg) in DMSO (900 ?L). A reaction was performed at room temperature for 2 hours. After water was added to the reaction mixture, extraction was performed with ethyl acetate. The combined organic layer was washed with a saturated sodium chloride solution. After the washed layer was dried over sodium sulfate, the solvent was evaporated under reduced pressure. The obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining the racemic (E)-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazole-2-carbonyl)phenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide (35.0 mg). The racemate was separated by CHIRAL ART SB (YMC) (hexane:EtOH (0.1% Et.sub.3N)) to give (E)-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-10,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[3,2-g]indazole-2-carbonyl)phenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide (single isomer, 1st-eluting isomer). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.97 (dd, J=6.9, 0.9 Hz, 1H), 8.00 (s, 1H), 7.41 (dd, J=10.5, 2.8 Hz, 2H), 7.29 (brs, 1H), 7.17-7.09 (m, 3H), 7.00 (t, J=7.1 Hz, 1H), 6.34 (d, J=15.5 Hz, 1H), 4.59 (d, 1=6.5 Hz, 2H), 4.44 (d, J=6.8 Hz, 2H), 4.17 (s, 3H), 3.53 (dd, J=5.3, 1.8 Hz, 2H), 3.46-3.43 (m, 1H), 3.02 (s, 3H), 2.86-2.79 (m, 1H), 2.69 (s, 3H), 2.56-2.52 (m, 1H), 2.36 (td, J=13.8, 4.5 Hz, 1H), 2.05-2.03 (m, 1H), 1.52 (s, 3H); ESI-MS [M+H].sup.+: 693.

Example 174

[0512] (E)-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide

Steps 1-2:

[0513] ##STR00208##

[0514] 2M methaylamine in THF (50.2 mL) was slowly added to the mixture of 1,3-difluoro-5-methoxy-2-nitrobenzene (9.50 g, 50.2 mmol) in THF (35.2 mL) at 0? C. After stirring at ambient temperature for 1 hour, water and EtOAc were added to the resulting slurry. The organic layer was separated, and washed with a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, to the obtained residue of 3-fluoro-5-methoxy-N-methyl-2-nitroaniline was added THF (200 mL), and NBS (8.94 g, 50.2 mmol) was added thereto at 0? C. After stirring for 10 minutes, the precipitates were collected by filtration and washed with diisopropylether to obtain 4-bromo-3-fluoro-5-methoxy-N-methyl-2-nitroaniline (7.61 g, 27.3 mmol). The filtrates were diluted with EtOAc and washed with saturated NaHCO.sub.3 aq. and brine, dried over Na.sub.2SO.sub.4 and evaporated. The residue was diluted with diisopropylether, and collected by filtration to obtain 4-bromo-3-fluoro-5-methoxy-N-methyl-2-nitroaniline.

Step 3:

[0515] ##STR00209##

[0516] A solution of 4-bromo-3-fluoro-5-methoxy-N-methyl-2-nitroaniline (2.46 g, 8.82 mmol) in 2-methoxyacetic anhydride (15 mL) was stirred under microwave irradiation at 180? C. for 1 hour and then poured into MeOH. After the solution was evaporated to remove the solvent, the residue was diluted with EtOAc and saturated sodium bicarbonate solution. The organic layer was separated, and washed with a saturated sodium chloride solution, followed by drying over sodium sulfate and concentration. The residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining N-(4-bromo-3-fluoro-5-methoxy-2-nitrophenyl)-2-methoxy-N-methylacetamide.

Step 4:

[0517] ##STR00210##

[0518] 2M methaylamine in THF (7.7 mL, 15.3 mmol) was slowly added to the mixture of N-(4-bromo-3-fluoro-5-methoxy-2-nitrophenyl)-2-methoxy-N-methylacetamide (2.68 g, 50.2 mmol) in THF (35.2 mL) at 0? C. After stirring at ambient temperature for 30 minutes, the water was added and the precipitate was collected by filtration to obtain N-(4-bromo-5-methoxy-3-(methylamino)-2-nitrophenyl)-2-methoxy-N-methylacetamide.

Step 5:

[0519] ##STR00211##

[0520] A solution of N-(4-bromo-5-methoxy-3-(methylamino)-2-nitrophenyl)-2-methoxy-N-methylacetamide (720 mg, 1.99 mmol), (4-amino-3,5-difluorophenyl)(8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)methanone (1.07 g, 2.78 mmol) and SPhos Pd G3 (143 mg, 0.199 mmol) in THF (15 mL) and 2M K.sub.3PO.sub.4 aq. (1.99 mL, 3.98 mmol) was evacuated and N.sub.2 back-filled before heating to 75? C. for 3 hours. After cooling, the reaction mixture was diluted with EtOAc/MeOH (ca. 10/1). The resulting suspension was filtered, rinsing with EtOAc, the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was suspended with diisopropyl ether and collected by filtration to obtain N-(4-(3-(4-amino-3,5-difluorobenzoyl)indolizin-8-yl)-5-methoxy-3-(methylamino)-2-nitrophenyl)-2-methoxy-N-methylacetamide.

Step 6:

[0521] ##STR00212##

[0522] To a solution of N-(4-(3-(4-amino-3,5-difluorobenzoyl)indolizin-8-yl)-5-methoxy-3-(methylamino)-2-nitrophenyl)-2-methoxy-N-methylacetamide (1.14 g, 2.06 mmol) in EtOH (10 mL) and THF (25 mL), palladium hydroxide (1.00 g) was added, then evacuated and H.sub.2 back-filled. After stirring at room temperature for 2 days, the mixture was diluted with EtOAc and MeOH, and the insoluble matter was filtered off. The filtrate was concentrated under reduced pressure and the residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)), thereby obtaining (4-amino-3,5-difluorophenyl)(8-(6-methoxy-2-(methoxymethyl)-1-methyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)methanone.

Step 7:

[0523] ##STR00213##

[0524] N-Iodosuccinimide (190 mg, 0.847 mmol) and TFA (0.126 mL) were added to a solution of (4-amino-3,5-difluorophenyl)(8-(6-methoxy-2-(methoxymethyl)-1-methyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)methanone (590 mg, 0.847 mmol) in THF (4.0 mL). After stirring at room temperature overnight, additional N-Iodosuccinimide (57.2 mg, 0.254 mmol) was added thereto. After stirring at room temperature for another 1 hour. The mixture was diluted with EtOAc, and sat. NaHCO.sub.3 aq. and sat. Na.sub.2S.sub.2O.sub.3 aq. were added. The organic layer was separated, and washed with brine, followed by drying over sodium sulfate. After evaporation, the residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)), thereby obtaining (4-amino-3,5-difluorophenyl)(1-iodo-8-(6-methoxy-2-(methoxymethyl)-1-methyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)methanone.

Step 8:

[0525] ##STR00214##

[0526] A mixture of (4-amino-3,5-difluorophenyl)(1-iodo-8-(6-methoxy-2-(methoxymethyl)-1-methyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)methanone (648 mg, 1.03 mmol), 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (1.09 mL, 5.13 mmol). Pd(PPh.sub.3).sub.4 (119 mg, 0.103 mmol) in 1,4-dioxane (15 mL) and 2M Na.sub.2CO.sub.3 aq. (2.3 mL, 4.62 mmol) was evacuated and N.sub.2 back-filled before heating to 95? C. for 8 hours. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (E)-(4-amino-3,5-difluorophenyl)(1-(2-ethoxyvinyl)-8-(6-methoxy-2-(methoxymethyl)-1-methyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)methanone.

Step 9:

[0527] ##STR00215##

[0528] To a solution of (E)-(4-amino-3,5-difluorophenyl)(1-(2-ethoxy vinyl)-8-(6-methoxy-2-(methoxymethyl)-1-methyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)methanone (454 mg, 0.788 mmol) in CH.sub.2Cl.sub.2 (12 mL) was added sodium triacetoxyborohydride (334 mg, 1.57 mmol) and TFA (1.17 mL, 15.7 mmol) at room temperature. After stirring at room temperature for 15 minutes, additional sodium triacetoxyborohydride (334 mg, 1.57 mmol) and TFA (1.17 mL, 15.7 mmol) were added thereto. After stirring at room temperature for another 45 minutes, the reaction was quenched with sat. NaHCO.sub.3 aq., then the resulting mixture was diluted with EtOAc. The organic layer was washed with brine, dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (4-amino-3,5-difluorophenyl)(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 10:

[0529] ##STR00216##

[0530] A solution of (4-amino-3,5-difluorophenyl)(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (100 mg, 0.188 mmol) and triethylamine (0.524 mL, 3.76 mmol) in DMF (2.0 mL) was slowly added 0.470 mL of 4-chlorocrotonic acid T3P solution (prepared from (E)-4-chlorobut-2-enoic and T3P (50 wt % in THF)(100 mg 4-chlorocrotonic acid/mL)). After stirring at room temperature for 15 minutes, the resulting mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 aq., H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated to obtain (E)-4-chloro-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)but-2-enamide.

Step 11:

[0531] ##STR00217##

[0532] To a solution of (E)-4-chloro-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)but-2-enamide (118 mg, 0.186 mmol) in DMSO (0.50 mL) was added 1-methylcyclopropan-1-amine (73.7 ?L, 0.930 mmol), and the mixture was stirred at 50? C. for 2 hours. The reaction mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 aq., H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated to obtain (E)-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide (75.0 mg, 0.112 mmol).

[0533] The racemate was separated by CHIRALPAK-IE (DAICEL) (hexane-EtOH (0.1% Et.sub.3N): 10/90), and the 2.sup.nd elution was the title compound. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.99 (dd, J=7.0, 1.0 Hz, 1H), 7.43-7.39 (m, 2H), 7.26-7.23 (m, 1H), 7.14-7.00 (m, 4H), 6.81 (s, 1H), 6.28 (d, J=14.5 Hz, 1H), 4.79-4.72 (m, 2H), 3.96 (q, J=7.7 Hz, 1H), 3.85-3.79 (m, 8H), 3.63 (dd, J=9.0, 3.8 Hz, 1H), 3.54-3.43 (m, 7H), 3.07 (s, 3H), 2.91-2.84 (m, 1H), 2.58-2.54 (m, 1H), 2.49-2.41 (m, 1H), 2.18-2.10 (m, 1H), 1.80-1.72 (m, 1H); ESI-MS [M+H].sup.+: 669.

Example 187

[0534] (E)-N-(4-(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide

Step 1:

[0535] ##STR00218##

[0536] Ammonia (28% water solution, 10 mL) was added to 2-chloro-3-nitro-5-(trifluoromethyl)pyridine (2.10 g) in dioxane (8 n L), and the reaction mixture was stirred at 100? C. for 15 minutes using microwave. After dilution with ethyl acetate, the mixture was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining 3-nitro-5-(trifluoromethyl)pyridin-2-amine.

Step 2:

[0537] ##STR00219##

[0538] 2M hydrochloric acid (3.7 mL) was added to a solution of 3-nitro-5-(trifluoromethyl)pyridin-2-amine (3.80 g) obtained in step 1 and 2-bromo-1,1-diethoxy-propane (4.1 g) in DMA (50 mL), followed by stirring at 100? C. for 1 hour and 120? C. for 15 hours. Water and ethyl acetate were added to the reaction mixture and the aqueous layer was extracted with ethyl acetate. The combined organic layer was washed with a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the residue was purified by column chromatography (chloroform:ethanol), thereby obtaining 3-methyl-8-nitro-6-(trifluoromethyl)imidazo[1,2-a]pyridine.

Step 3:

[0539] ##STR00220##

[0540] A solution of 3-methyl-8-nitro-6-(trifluoromethyl)imidazo[1,2-a]pyridine (1.8 g) obtained in step 2 and palladium on carbon (10 wt %, 780 mg) in ethanol (30 mL) was stirred at 30? C. under H.sub.2 atmosphere for 30 minutes. The insoluble matter was filtered off, followed by evaporating the solvent under reduced pressure. The obtained residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining 3-methyl-6-(trifluoromethyl)imidazo[1,2-a]pyridin-8-amine.

Step 4:

[0541] ##STR00221##

[0542] A solution of 3-methyl-6-(trifluoromethyl)imidazo[1,2-a]pyridin-8-amine (650 mg) obtained in step 3, N-iodosuccinimide (1.7 g) and TFA (0.67 mL) in THF (12 mL) was stirred at room temperature for 30 minutes. The mixture was diluted with ethyl acetate and washed with a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining 7-iodo-3-methyl-6-(trifluoromethyl)imidazo[1,2-a]pyridin-8-amine.

Step 5:

[0543] ##STR00222##

[0544] A solution of 7-iodo-3-methyl-6-(trifluoromethyl)imidazo[1,2-a]pyridin-8-amine (400 mg) obtained in step 4, (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (817 mg), SPhos Pd G3 (124 mg) in THF (3.00 mL) and 2M K.sub.3PO.sub.4 aq. (1.47 mL) was evacuated and N.sub.2 back-filled before heating to 90? C. for 3 hours using microwave. After cooling, the reaction mixture was diluted with EtOAc. The resulting suspension was filtered, rinsing with EtOAc, and the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:acetone), thereby obtaining (8-(8-amino-3-methyl-6-(trifluoromethyl)imidazo[1,2-a]pyridin-7-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 6:

[0545] ##STR00223##

[0546] N-iodosuccinimide (1.26 g) was added to a solution of (8-(8-amino-3-methyl-6-(trifluoromethyl)imidazo[1,2-a]pyridin-7-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (2.60 g) and TFA (1.38 mL) in THF (50 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (8-(8-amino-3-methyl-6-(trifluoromethyl)imidazo[1,2-a]pyridin-7-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 7:

[0547] ##STR00224##

[0548] A solution of (8-(8-amino-3-methyl-6-(trifluoromethyl)imidazo[1,2-a]pyridin-7-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (2.20 g), 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (3.53 mL), SPhos Pd G3 (141 mg) and 2M K.sub.3PO.sub.4 aq. (1.47 mL) in 1,4-dioxane (40.0 mL) was evacuated and N.sub.2 back-filled before heating to 95? C. for 3 hours. After cooling, the reaction mixture was diluted with ethyl acetate, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (E)-(8-(8-amino-3-methyl-6-(trifluoromethyl)imidazo[1,2-a]pyridin-7-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 8:

[0549] ##STR00225##

[0550] Sodium triacetoxyborohydride (1.29 g) was added to a solution of (E)-(8-(8-amino-3-methyl-6-(trifluoromethyl)imidazo[1,2-a]pyridin-7-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (1.70 g) and TFA (2.26 mL) in dichloromethane (50 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with chloroform, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (ethyl acetate:ethanol), thereby obtaining (10-methyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone.

Step 9:

[0551] ##STR00226##

[0552] 0.3M sodium cyanoborohydride-1/2 zinc chloride in methanol (12.2 mL) was added to a solution of (10-methyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (940 mg) and 36% formaldehyde solution in water (457 ?L) in THF (20 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with ethyl acetate, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone.

Step 10:

[0553] ##STR00227##

[0554] A solution of (10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (850 mg) obtained in step 9 and 28% ammonia solution in water (10 mL) in 1,4-dioxane (10 mL) was stirred at 140? C. for 12 hours using microwave irradiation. After dilution with ethyl acetate and water, the mixture was extracted with ethyl acetate. The combined organic layer was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining (4-amino-3,5-difluorophenyl)(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 11:

[0555] ##STR00228##

[0556] (E)-4-chlorobut-2-enoic acid (203 mg) and 1-propanephosphonic acid anhydride cyclic trimer (a 1.7M THF solution, 2.02 mL) were added to a solution of (4-amino-3,5-difluorophenyl)(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (685 mg) in DMF (8 mL), followed by stirring at room temperature for 20 minutes. Triethylamine (719 ?L) was added to the reaction mixture. A reaction was performed at room temperature for 2 hours. After water was added to the reaction mixture, extraction was performed with ethyl acetate, followed by washing the organic layer with a saturated sodium chloride solution. The washed organic layer was dried over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining (E)-4-chloro-N-(4-(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide.

Step 12:

[0557] ##STR00229##

[0558] 3-methyloxetan-3-amine (24 ?L) and potassium iodide (13.1 mg) were added to a solution of (E)-4-chloro-N-(4-(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (33.0 mg) in DMSO (800 ?L). A reaction was performed at room temperature for 2 hours. After water was added to the reaction mixture, extraction was performed with ethyl acetate. The combined organic layer was washed with a saturated sodium chloride solution. After the washed layer was dried over sodium sulfate, the solvent was evaporated under reduced pressure. The obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining the racemic (E)-N-(4-(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide. The racemate was separated by CHIRALPAK IA (hexane:EtOH (0.1% Et.sub.3N)) to give (E)-N-(4-(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-imidazo[1,2:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide (2nd-eluting isomer). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.99 (dd, J=7.0, 1.0 Hz, 1H), 8.36 (s, 1H), 7.57 (d, J=0.8 Hz, 1H), 7.42 (d, J=8.0 Hz, 2H), 7.18-7.09 (m, 3H), 7.02 (t, J=7.1 Hz, 1H), 6.34 (d, J=15.3 Hz, 1H), 4.59 (d, J=6.3 Hz, 2H), 4.44 (d, J=6.5 Hz, 2H), 3.56-3.53 (m, 2H), 3.06 (d, J=10.5 Hz, 3H), 2.90-2.83 (m, 1H), 2.65-2.61 (m, 3H), 2.59-2.57 (m, 3H), 2.50-2.42 (m, 1H), 1.51 (s, 3H); ESI-MS [M+H].sup.+: 679.

Example 200

(E)-N-(2,6-difluoro-4-(7-methoxy-9-(2-methoxyethyl)-10,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide

Steps 1-3:

[0559] ##STR00230##

[0560] 2-Methoxyethanamine (1.01 mL, 11.6 mmol) and N-ethyl-N-isopropyl-propan-2-amine (4.06 mL, 23.3 mmol) were added to a solution of 1,3-difluoro-5-methoxy-2-nitrobenzene (2.00 g, 10.6 mmol) in acetonitrile (53 mL). After stirring at room temperature for 3 hours, 2-methoxyethanamine (0.202 mL, 2.32 mmol) was added and the mixture was stirred at room temperature for 20 minutes. Water and EtOAc were added to the resulting mixture and the organic layer was separated, and washed with brine, followed by drying over Na.sub.2SO.sub.4. After evaporation, the obtained residue was purified by column chromatography on silica gel (hexane-acetone) to obtain 3-fluoro-5-methoxy-N-(2-methoxyethyl)-2-nitroaniline (1.95 g), 3-fluoro-5-methoxy-N-(2-methoxyethyl)-2-nitroaniline (1.95 g) was diluted in THF (40 mL), and NBS (1.42 g, 7.98 mmol) was added thereto at 0? C. After stirring for 30 minutes, water, saturated aqueous NaHCO.sub.3 and EtOAc were added to the resulting mixture and the organic layer was separated, and washed successively with H.sub.2O, saturated aqueous NaHCO.sub.3 then brine, followed by drying over Na.sub.2SO.sub.4, and evaporated. The residue was suspended in diisopropylether (20 mL) and the suspension was stirred at room temperature for 40 minutes. The precipitate was collected via filtration, washing with diisopropylether, and the solid dried in vacuo to give crude 4-bromo-3-fluoro-5-methoxy-N-(2-methoxyethyl)-2-nitroaniline (2.42 g). The mixture of crude 4-bromo-3-fluoro-5-methoxy-N-(2-methoxyethyl)-2-nitroaniline (700 mg) and acetic anhydride (3.92 mL) was heated at 180? C. by microwave irradiation for 12 hours. After cooling, the mixture was diluted with MeOH, and evaporated. Water, saturated aqueous NaHCO.sub.3 and EtOAc were added to the residue and the organic layer was separated, and washed successively with H.sub.2O, saturated aqueous NaHCO.sub.3 then brine, followed by drying over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-acetone) to obtain N-(4-bromo-3-fluoro-5-methoxy-2-nitrophenyl)-N-(2-methoxyethyl)acetamide.

Step 4:

[0561] ##STR00231##

[0562] To the mixture of N-(4-bromo-3-fluoro-5-methoxy-2-nitrophenyl)-N-(2-methoxyethyl)acetamide (700 mg) in THF (3.8 mL) was added methylamine (2M THF solution, 2.88 mL). After stirring at room temperature for 20 minutes, water and EtOAc were added to the resulting mixture. The organic layer was separated, and washed with aqueous NaHCO.sub.3 and brine, followed by drying over Na.sub.2SO.sub.4. After evaporation, the residue was purified by column chromatography on silica gel (hexane-acetone) to obtain N-(4-bromo-5-methoxy-3-methylamino)-2-nitrophenyl)-N-(2-methoxyethyl)acetamide.

Step 5:

[0563] ##STR00232##

[0564] A mixture of N-(4-bromo-5-methoxy-3-(methylamino)-2-nitrophenyl)-N-(2-methoxyethyl)acetamide (652 mg, 1.73 mmol), (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (872 mg, 2.25 mmol) and S-Phos Pd G3 (122 mg) in THF (17 mL) and 2M K.sub.3PO.sub.4 aq. (2.60 mL, 5.20 mmol) was evacuated and N.sub.2 back-filled before heating to 80? C. by microwave irradiation for 3 hours. After cooling, EtOAc, water and saturated aqueous NaCl were added and the insoluble matters were removed by filtration. The organic layer was dried over Na.sub.2SO.sub.4. After evaporation, the resulting residue was purified by column chromatography on silica gel (hexane-acetone) to obtain N-(5-methoxy-3-(methylamino)-2-nitro-4-(3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)phenyl)-N-(2-methoxyethyl)acetamide.

Step 6:

[0565] ##STR00233##

[0566] To a solution of N-(5-methoxy-3-(methylamino)-2-nitro-4-(3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)phenyl)-N-(2-methoxyethyl)acetamide (987 mg, 1.73 mmol) in ethanol (17 mL) and THF (31 mL) was added palladium hydroxide on carbon (10) g, 20 wt. % loading (dry basis)). The mixture was stirred at room temperature for 24 hours and 40? C. for 46 hours under hydrogen atmosphere. After cooling, the mixture was filtered, rinsing with CHCl.sub.3 and MeOH, and evaporated. The residue was purified by column chromatography on silica gel (hexane-acetone) to give (8-(6-methoxy-1-(2-methoxyethyl)-2-methyl-4-methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 7:

[0567] ##STR00234##

[0568] To a solution of (8-(6-methoxy-1-(2-methoxyethyl)-2-methyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (740 mg, 1.42 mmol) in THF (7.00 mL) was added triethylamine (0.773 mL, 5.66 mmol) at room temperature and trifluoroacetic anhydride (0.394 mL, 2.83 mmol) at 0? C. After stirring at room temperature for 1 hour, to this solution was added triethylamine (0.193 mL, 1.42 mmol) at room temperature and trifluoroacetic anhydride (0.099 mL, 0.708 mmol) at 0? C. After stirring at room temperature for 30 minutes, to this solution was added triethylamine (0.193 mL, 1.42 mmol) at room temperature and trifluoroacetic anhydride (0.099 mL, 0.708 mmol) at 0? C. additionally. After stirring at room temperature for 15 minutes, the mixture was diluted with EtOAc, and sat. NaHCO.sub.3 aq. and water. The organic layer was separated, and washed with brine, followed by drying over Na.sub.2SO.sub.4. The solvent was evaporated to obtain crude 2,2,2-trifluoro-N-(6-methoxy-1-(2-methoxyethyl)-2-methyl-5-(3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-1H-benzo[d]imidazol-4-yl)-N-methylacetamide.

Step 8:

[0569] ##STR00235##

[0570] To a solution of crude 2,2,2-trifluoro-N-(6-methoxy-1-(2-methoxyethyl)-2-methyl-5-(3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-1H-benzo[d]imidazol-4-yl)-N-methylacetamide (849 mg) in THF (14 mL) was added N-iodosuccinimide (309 mg, 1.37 mmol) and TFA (0.255 mL, 3.43 mmol). After stirring at room temperature for 1 hour, the mixture was diluted with EtOAc and water. The organic layer was separated, and washed with water, 20% Na.sub.2S.sub.2O.sub.3 aq., sat. NaHCO.sub.3 aq., and brine, followed by drying over Na.sub.2SO.sub.4. The solvent was evaporated to obtain crude 2,2,2-trifluoro-N-(5-(1-iodo-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-6-methoxy-1-(2-methoxyethyl)-2-methyl-1H-benzo[d]imidazol-4-yl)-N-methylacetamide.

Step 9:

[0571] ##STR00236##

[0572] To the mixture of crude 2,2,2-trifluoro-N-(5-(1-iodo-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-6-methoxy-1-(2-methoxyethyl)-2-methyl-1H-benzo[d]imidazol-4-yl)-N-methylacetamide (1.0 g) in 1,2-dimethoxyethane (14 mL) was added 2M Na.sub.2CO.sub.3 aq. (7.1 mL, 14 mmol). The reaction mixture was heated at 120? C. by microwave irradiation for 60 hours. After cooling, the mixture was diluted with EtOAc and water. The organic layer was separated, and washed with brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-acetone) to give (1-iodo-8-(6-methoxy-1-(2-methoxyethyl)-2-methyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Steps 10-14:

[0573] ##STR00237##

[0574] The procedures of following steps were performed in the same manner as Example 140 (Steps 8-12) using (1-iodo-8-(6-methoxy-1-(2-methoxyethyl)-2-methyl-4-(methylamino)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone obtained in Step 9.

[0575] The racemate was separated by CHIRALPAK-IG (hexane-EtOH (0.1% v/v triethylamine)) to obtain (E)-N-(2,6-difluoro-4-(7-methoxy-9-(2-methoxyethyl)-10,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide as the second-eluting isomer. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 10.00 (dd, J=6.96, 1.00 Hz, 1H), 7.36 (d, J=7.92 Hz, 2H), 7.30-7.24 (m, 2H), 7.16-7.08 (m, 2H), 7.03 (t, J=7.08 Hz, 1H), 6.81 (s, 1H), 6.25 (d, J=15.38 Hz, 1H), 4.33-4.22 (m, 2H), 3.77 (s, 3H), 3.73 (t, J=5.45 Hz, 2H), 3.56-3.51 (m, 3H), 3.35 (s, 3H), 3.06 (s, 3H), 2.90-2.83 (m, 1H), 2.63 (s, 3H), 2.58-2.43 (m, 2H), 1.30 (s, 3H), 0.63-0.60 (m, 2H), 0.42-0.40 (m, 2H); ESI-MS [M+H].sup.+: 683.

Example 217

(S,E)-N-(4-(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-[1,2,4]triazolo[4,3:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide

Step 1:

[0576] ##STR00238##

[0577] Hydrazine monohydrate (4.5 mL) was added to 2-chloro-3-nitro-5-(trifluoromethyl)pyridine (10 g) in EtOH (200 mL), and the reaction mixture was stirred at 30? C. for 2 hours. After evaporation, the mixture was diluted with ethyl acetate. The mixture was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. The solvent was evaporated under reduced pressure, thereby obtaining crude 2-hydrazineyl-3-nitro-5-(trifluoromethyl)pyridine.

Step 2:

[0578] ##STR00239##

[0579] Trifluoroacetic acid was added to crude 2-hydrazineyl-3-nitro-5-(trifluoromethyl)pyridine (5.05 g) obtained in step 1 and 1,1,1-trimethoxyethane (13.5 mL) in ethanol (20.0 mL), and the reaction mixture was stirred at 100? C. for 2 hours. After dilution with ethyl acetate, the mixture was washed with a saturated sodium bicarbonate solution and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the residue was dissolved in EtOAc (10.0 mL) at 50? C., and heptane (10.0 mL) was added then cooled to ambient temperature slowly to give the precipitation. The precipitate was collected by filtration, washing with further heptane, and vacuum-dried at 60? C. for 2 hours, thereby obtaining 3-methyl-8-nitro-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridine.

Step 3:

[0580] ##STR00240##

[0581] A solution of 3-methyl-8-nitro-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridine (3.90 g) obtained in step 2 and palladium hydroxide on carbon (20 wt %, 1.70 g) in ethanol (30.0 mL) was stirred at 30? C. under H.sub.2 atmosphere for 30 minutes. The insoluble matter was filtered off, followed by evaporating the solvent under reduced pressure. The obtained residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining 3-methyl-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridin-8-amine.

Step 4:

[0582] ##STR00241##

[0583] A solution of 3-methyl-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridin-8-amine (2.92 g) obtained in step 3, N-iodosuccinimide (4.47 g) and TFA (1.20 mL) in N,N-dimethylformamide (25 mL) was stirred at room temperature for 30 minutes. The mixture was diluted with ethyl acetate and washed with a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining 7-iodo-3-methyl-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridin-8-amine.

Step 5:

[0584] ##STR00242##

[0585] A solution of 7-iodo-3-methyl-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridin-8-amine (1.60 g) obtained in step 4, (4-amino-3,5-difluorophenyl)(8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)methanone (2.88 g), SPhos Pd G3 (494 mg) and 2M K.sub.3PO.sub.4 aq. (5.84 mL) in THF (33.0 mL) was evacuated and N.sub.2 back-filled before heating to 120? C. for 30 minutes using microwave. After cooling, the reaction mixture was diluted with EtOAc. The resulting suspension was filtered, rinsing with EtOAc, and the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:acetone), thereby obtaining (4-amino-3,5-difluorophenyl)(8-(8-amino-3-methyl-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridin-7-yl)indolizin-3-yl)methanone.

Step 6:

[0586] ##STR00243##

[0587] N-iodosuccinimide (2.60 g) was added to a solution of (4-amino-3,5-difluorophenyl)(8-(8-amino-3-methyl-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridin-7-yl)indolizin-3-yl)methanone (1.75 g) and TFA (1.55 mL) in THF (30 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (4-amino-3,5-difluorophenyl)(8-(8-amino-3-methyl-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridin-7-yl)-1-iodoindolizin-3-yl)methanone.

Step 7:

[0588] ##STR00244##

[0589] A solution of (4-amino-3,5-difluorophenyl)(8-(8-amino-3-methyl-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridin-7-yl)-1-iodoindolizin-3-yl)methanone (1.90 g), 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (2.96 mL), Pd(PPh.sub.3).sub.4 (323 mg) and 2M Na.sub.2CO.sub.3 aq. (6.98 mL) in 1,4-dioxane (35.0 mL) was evacuated and N.sub.2 back-filled before heating to 95? C. for 3 hours. After cooling, the reaction mixture was diluted with ethyl acetate, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (E)-(4-amino-3,5-difluorophenyl)(8-(8-amino-3-methyl-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridin-7-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)methanone.

Step 8:

[0590] ##STR00245##

[0591] Sodium triacetoxyborohydride (983 mg) was added to a solution of (E)-(4-amino-3,5-difluorophenyl)(8-(8-amino-3-methyl-6-(trifluoromethyl)-[1,2,4]triazolo[4,3-a]pyridin-7-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)methanone (1.29 g) and TFA (1.72 mL) in dichloromethane (50 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with chloroform, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (ethyl acetate:ethanol), thereby obtaining (4-amino-3,5-difluorophenyl)(10-methyl-7-(trifluoromethyl)-14,15-dihydro-13H-[1,2,4]triazolo[4,3:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 9:

[0592] ##STR00246##

[0593] A solution containing sodium cyanoborohyride (55.0 mg) and zinc chloride (60.0 mg) in methanol (2.94 mL) was added to a solution of (4-amino-3,5-difluorophenyl)(10-methyl-7-(trifluoromethyl)-14,15-dihydro-13H-[1,2,4]triazolo[4,3:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (211 mg), formaldehyde (36% w/v aq. solution, 110 ?L) and TFA (65.5 ?L) in THE (2.0 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with ethyl acetate, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (4-amino-3,5-difluorophenyl)(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-[1,2,4]triazolo[4,3:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 10:

[0594] ##STR00247##

[0595] (E)-4-chlorobut-2-enoic acid (39 mg) and 1-propanephosphonic acid anhydride cyclic trimer (1.7 M solution in THF, 390 ?L) were added to a solution of (4-amino-3,5-difluorophenyl)(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-[1,2,4]triazolo[4,3:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (130 mg) in N,N-dimethylformamide (1.0 mL), followed by stirring at room temperature for 20 minutes. Triethylamine (137 ?L) was added to the reaction mixture. After 2 h, water was added to the reaction mixture, extraction was performed with ethyl acetate, followed by washing the organic layer with a saturated sodium chloride solution. The washed organic layer was dried over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining (E)-4-chloro-N-(4-(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-[1,2,4]triazolo[4,3:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide.

Step 11:

[0596] ##STR00248##

[0597] (S)-Tetrahydrofuran-3-amine (11.2 ?L) and potassium iodide (6.33 mg) were added to a solution of (E)-4-chloro-N-(4-(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-[1,2,4]triazolo[4,3:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (16.0 mg) in DMSO (500 ?L). After 2 h, water was added to the reaction mixture, extraction was performed with ethyl acetate. The combined organic layer was washed with a saturated sodium chloride solution. After the washed layer was dried over sodium sulfate, the solvent was evaporated under reduced pressure. The obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining the racemic (S,E)-N-(4-(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-[1,2,4]triazolo[4,3:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide (9.43 mg). The racemate was separated by CHIRALPAK IA (hexane:EtOH (0.1% v/v triethylamine)) to give (S,E)-N-(4-(10,13-dimethyl-7-(trifluoromethyl)-14,15-dihydro-13H-[1,2,4]triazolo[4,3:1,2]pyrido[3,4:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide as the second-eluting isomer. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 10.00 (dd, J=6.9, 1.1 Hz, 1H), 8.95 (s, 1H), 7.44 (dd, J=10.5, 2.8 Hz, 2H), 7.17-7.00 (m, 4H), 6.32-6.28 (m, 1H), 3.97 (dd, J=14.9, 7.9 Hz, 1H), 3.82 (qd, J=8.8, 5.8 Hz, 2H), 3.65 (dd, J=9.1, 3.6 Hz, 1H), 3.51-3.42 (m, 4H), 3.01 (s, 3H), 2.91-2.85 (m, 1H), 2.67 (s, 3H), 2.65-2.64 (m, 1H), 2.46-2.38 (m, 1H), 2.19-2.10 (m, 1H), 1.81-1.74 (m, 1H); ESI-MS [M+H].sup.+: 680.

Example 224

(E)-N-(4-(7-(difluoromethyl)-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide

Step 1:

[0598] ##STR00249##

[0599] Methylamine (2 M solution in THF, 39.7 mL) was added to (3,5-difluoro-4-nitrophenyl)methanol (10.0 g) in THF (20.0 mL), and the reaction mixture was stirred at 30? C. for 2 hours. After evaporation, the mixture was diluted with ethyl acetate. The mixture was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. The solvent was evaporated under reduced pressure, thereby obtaining crude (3-fluoro-5-(methylamino)-4-nitrophenyl)methanol.

Step 2:

[0600] ##STR00250##

[0601] A solution of crude (3-fluoro-5-(methylamino)-4-nitrophenyl)methanol (10.3 g) obtained in step 1 and N-bromosuccinimide (9.62 g) in N,N-dimethylformamide (55.0 mL) was stirred at room temperature for 30 minutes. To the reaction mixture was added water (150 mL), and the reaction mixture was stirred at room temperature for 30 minutes. The precipitate was collected by filtration, washing with further water, and vacuum-dried at 60? C. for 16 hours, thereby obtaining (2-bromo-3-fluoro-5-(methylamino)-4-nitrophenyl)methanol.

Step 3:

[0602] ##STR00251##

[0603] 2-methoxyacetic anhydride (9.3 mL) was added to the (2-bromo-3-fluoro-5-(methylamino)-4-nitrophenyl)methanol (1.6 g), then the reaction mixture was heated at 100? C. by microwave irradiation for 3 hours. After cooling, the reaction mixture was diluted with EtOAc, 5M aq. NaOH, and NaHCO.sub.3 aq. The organic layer was separated and washed with NaHCO.sub.3 aq. and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining 2-bromo-3-fluoro-5-(2-methoxy-N-methylacetamido)-4-nitrobenzyl 2-methoxyacetate.

Step 4:

[0604] ##STR00252##

[0605] A solution of 2 M sodium hydroxide solution (10.0 mL) was added to a solution of 2-bromo-3-fluoro-5-(2-methoxy-N-methylacetamido)-4-nitrobenzyl 2-methoxyacetate (1.70 g) in ethanol (12.0 mL) and tetrahydrofuran (5.00 mL), followed by stirring at 50? C. for 2 hours. After cooling to room temperature, the reaction mixture was quenched with 5M aq. hydrochloric acid (4.00 mL). After dilution with ethyl acetate, the mixture was extracted with ethyl acetate. The combined organic layer was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the residue was purified by column chromatography (chloroform:ethanol), thereby obtaining N-(4-bromo-3-fluoro-5-(hydroxymethyl)-2-nitrophenyl)-2-methoxy-N-methylacetamide.

Step 5:

[0606] ##STR00253##

[0607] A solution of N-(4-bromo-3-fluoro-5-(hydroxymethyl)-2-nitrophenyl)-2-methoxy-N-methylacetamide (300 mg) obtained in step 4 and manganese dioxide (594 mg) in ethyl acetate (10.0 mL) was stirred at 60? C. for 14 hours. The insoluble matter was filtered off, followed by evaporating the solvent under reduced pressure. The obtained residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining N-(4-bromo-3-fluoro-5-formyl-2-nitrophenyl)-2-methoxy-N-methylacetamide.

Step 6:

[0608] ##STR00254##

[0609] A solution of N-(4-bromo-3-fluoro-5-formyl-2-nitrophenyl)-2-methoxy-N-methylacetamide (600 mg) and bis(2-methoxyethyl)aminosulfur trifluoride (1.52 g) in CH.sub.2Cl.sub.2 (10.0 mL) was stirred at room temperature for 30 minutes. After dilution with chloroform, the mixture was washed with saturated NaHC.sub.3 aq. and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining N-(4-bromo-5-(difluoromethyl)-3-fluoro-2-nitrophenyl)-2-methoxy-N-methylacetamide.

Step 7:

[0610] ##STR00255##

[0611] A solution of N-(4-bromo-5-(difluoromethyl)-3-fluoro-2-nitrophenyl)-2-methoxy-N-methylacetamide (520 mg) obtained in step 6, (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (700 mg), SPhos Pd G3 (98.7 mg) and 2M K.sub.3PO.sub.4 aq. (1.75 mL) in THF (10.0 mL) was evacuated and N.sub.2 back-filled before heating to 70? C. for 1 hour using microwave. After cooling, the reaction mixture was diluted with EtOAc. The resulting suspension was filtered, rinsing with EtOAc, and the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:acetone), thereby obtaining N-(4-(3-(4-amino-3,5-difluorobenzoyl)indolizin-8-yl)-5-(difluoromethyl)-3-fluoro-2-nitrophenyl)-2-methoxy-N-methylacetamide.

Step 8:

[0612] ##STR00256##

[0613] A solution of N-(4-(3-(4-amino-3,5-difluorobenzoyl)indolizin-8-yl)-5-(difluoromethyl)-3-fluoro-2-nitrophenyl)-2-methoxy-N-methylacetamide (550 mg) obtained in step 7, ammonia (28% w/v aq. solution, 5 mL) in 1,4-dioxane (10 mL) was stirred at 70? C. for 30 minutes using microwave irradiation. After dilution with ethyl acetate and water, the mixture was extracted with ethyl acetate. The combined organic layer was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (hexane:ethyl acetate), thereby obtaining N-(3-amino-4-(3-(4-amino-3,5-difluorobenzoyl)indolizin-8-yl)-5-(difluoromethyl)-2-nitrophenyl)-2-methoxy-N-methylacetamide.

Step 9:

[0614] ##STR00257##

[0615] A solution of N-(3-amino-4-(3-(4-amino-3,5-difluorobenzoyl)indolizin-8-yl)-5-(difluoromethyl)-2-nitrophenyl)-2-methoxy-N-methylacetamide (360 mg) obtained in step 8 and palladium hydroxide on carbon (20 wt %, 300 mg) in ethanol (4.00 mL) was stirred at 30? C. under H.sub.2 atmosphere for 15 hours. The insoluble matter was filtered off, followed by evaporating the solvent under reduced pressure. The obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining (4-amino-3,5-difluorophenyl)(8-(4-amino-6-(difluoromethyl)-2-(methoxymethyl)-1-methyl-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)methanone.

Step 10:

[0616] ##STR00258##

[0617] N-iodosuccinimide (87.1 mg) was added to a solution of (4-amino-3,5-difluorophenyl)(8-(4-amino-6-(difluoromethyl)-2-(methoxymethyl)-1-methyl-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)methanone (180 mg) and TFA (1.31 ?L) in THF (3.00 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (4-amino-3,5-difluorophenyl)(8-(4-amino-6-(difluoromethyl)-2-(methoxymethyl)-1-methyl-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)methanone.

Step 11:

[0618] ##STR00259##

[0619] A solution of (4-amino-3,5-difluorophenyl)(8-(4-amino-6-(difluoromethyl)-2-(methoxymethyl)-1-methyl-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)methanone (120 mg), 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (185 ?L), Pd(PPh.sub.3).sub.4 (20.2 mg) and 2M aq. Na.sub.2CO.sub.3 (438 ?L) in 1,4-dioxane (3.00 mL) was evacuated and N.sub.2 back-filled before heating to 90? C. for 2 hours. After cooling, the reaction mixture was diluted with ethyl acetate, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane:ethyl acetate), thereby obtaining (E)-(4-amino-3,5-difluorophenyl)(8-(4-amino-6-(difluoromethyl)-2-(methoxymethyl)-1-methyl-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)methanone.

Step 12:

[0620] ##STR00260##

[0621] Sodium triacetoxyborohydride (58.3 mg) was added to a solution of (E)-(4-amino-3,5-difluorophenyl)(8-(4-amino-6-(difluoromethyl)-2-(methoxymethyl)-1-methyl-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)methanone (79.6 mg) and TFA (102 ?L) in dichloromethane (5.00 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with chloroform, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (ethyl acetate:ethanol), thereby obtaining (4-amino-3,5-difluorophenyl)(7-(difluoromethyl)-10-(methoxymethyl)-9-methyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 13:

[0622] ##STR00261##

[0623] A solution containing sodium cyanoborohydride (16 mg) and zinc chloride (18 mg) in methanol (0.87 mL) was added to a solution of (4-amino-3,5-difluorophenyl)(7-(difluoromethyl)-10-(methoxymethyl)-9-methyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (65 mg) and formaldehyde (36% w/v aq. solution, 33 ?L) in THF (2.0 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with ethyl acetate, washed with sat. NaHCO.sub.3 aq., H.sub.2O (2?) and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (ethyl acetate:ethanol), thereby obtaining (4-amino-3,5-difluorophenyl)(7-(difluoromethyl)-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 14:

[0624] ##STR00262##

[0625] (E)-4-chlorobut-2-enoic acid (12.5 mg) and 1-propanephosphonic acid anhydride cyclic trimer (a 1.7 M THF solution, 125 ?L) were added to a solution of (4-amino-3,5-difluorophenyl)(7-(difluoromethyl)-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (42.1 mg) in N,N-dimethylformamide (2.00 mL), followed by stirring at room temperature for 20 minutes. Triethylamine (45 ?L) was added to the reaction mixture. A reaction was performed at room temperature for 2 hours. After water was added to the reaction mixture, extraction was performed with ethyl acetate, followed by washing the organic layer with a saturated sodium chloride solution. The washed organic layer was dried over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining (E)-4-chloro-N-(4-(7-(difluoromethyl)-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2.3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide.

Step 15:

[0626] ##STR00263##

[0627] 3-methyloxetan-3-amine (35 ?L) and potassium iodide (20 mg) were added to a solution of (E)-4-chloro-N-(4-(7-difluoromethyl)-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4 5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (48 mg) in DMSO (900 ?L). A reaction was performed at room temperature for 2 hours. After water was added to the reaction mixture, extraction was performed with ethyl acetate. The combined organic layer was washed with a saturated sodium chloride solution. After the washed layer was dried over sodium sulfate, the solvent was evaporated under reduced pressure. The obtained residue was purified by column chromatography (chloroform:ethanol), thereby obtaining racemic (E)-N-(4-(7-(difluoromethyl)-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide (41.4 mg). The racemate was separated by CHIRALPAK IG (hexane:EtOH (0.1% v/v triethylamine)) to give (E)-N-(4-(7-(difluoromethyl)-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide as the second-eluting isomer. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) a 10.00 (dd, J=7.0, 1.3 Hz, 1H), 7.78 (d, J=1.5 Hz, 1H), 7.43-7.40 (m, 2H), 7.30 (brs, 1H), 7.14 (dt, J=15.1, 5.3 Hz, 2H), 7.05-6.98 (m, 2H), 6.51 (t, J=55.0 Hz, 1H), 6.34 (dd, J=13.5, 1.8 Hz, 1H), 4.80 (dd, J=14.4, 12.6 Hz, 2H), 4.59 (d, J=6.3 Hz, 2H), 4.44 (d, J=6.5 Hz, 2H), 3.93 (s, 3H), 3.54-3.52 (m, 2H), 3.47 (s, 3H), 3.10 (s, 3H), 2.92-2.85 (m, 1H), 2.59-2.55 (m, 1H), 2.37-2.30 (m, 1H), 2.18 (d, J=2.5 Hz, 1H), 1.52 (s, 3H); ESI-MS [M+H].sup.+: 705.

Synthetic Procedure M

Example 90

[0628] (S,E)-N-(2,6-difluoro-4-(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indole-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide

Step 1:

[0629] Mixture of atropisomers of (4-amino-3,5-difluorophenyl)(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indol-2-yl)methanone (970 mg) obtained in step 10 (Example 44) was separated by CHIRALPAK-IG (hexane-IPA) to give 1st-eluting isomer and 2nd-eluting isomer.

Step 2:

[0630] ##STR00264##

[0631] A solution of first-eluting isomer of (4-amino-3,5-difluorophenyl)(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indol-2-yl)methanone (394 mg), 4-chlorocrotonic acid (147 mg, 1.22 mmol) and propylphosphonic anhydride solution (50% w/w in THF, 761 ?L, 1.22 mmol) in N,N-dimethylformamide (2.70 mL) was stirred at room temperature for 15 min. Then triethylamine (339 ?L, 2.43 mmol) was added, and the mixture was stirred at room temperature for 1 hour. Further 4-chlorocrotonic acid (49 mg, 0.41 mmol), propylphosphonic anhydride solution (50% w/w in THF, 254 ?L, 0.407 mmol) and triethylamine (113 ?L, 0.810 mmol) were added and stirring continued for 30 minutes. The reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 aq., H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining (E)-4-chloro-N-(2,6-difluoro-4-(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indole-2-carbonyl)phenyl)but-2-enamide.

Step 3:

[0632] ##STR00265##

[0633] A solution of (E)-4-chloro-N-(2,6-difluoro-4-(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indole-2-carbonyl)phenyl)but-2-enamide (42 mg, 0.072 mmol). KI (1 mg, 0.07 mmol) and (S)-tetrahydrofuran-3-amine (24.6 ?L, 0.288 mmol) in DMSO (360 ?L) was stirred at 40? C. for 1.5 hours. The reaction mixture was diluted with DMSO then filtered and purified by preparative HPLC (water:acetonitrile (0.1% v/v formic acid)). The purified fractions were washed with NaHCO.sub.3 aq., extracted with CHCl.sub.3/MeOH then dried over Na.sub.2SO.sub.4 and evaporated, thereby obtaining (S,E)-N-(2,6-difluoro-4-(6,8,9,11-tetramethyl-8,11,12,13-tetrahydroimidazo[4,5:5,6]benzo[1,2:5,6][1,4]diazocino[7,8,1-hi]indole-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide. (25.0 mg, 54%). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 8.41 (d, J=7.5 Hz, 1H), 7.50 (s, 1H), 7.46-7.40 (m, 2H), 7.35 (dd, J=7.6 Hz, 1H), 7.19-7.07 (m, 3H), 6.32 (d, J=15.5 Hz, 1H), 4.05-3.77 (m, 5H), 3.73 (s, 3H), 3.64 (dd, J=9.0, 3.5 Hz, 1H), 3.56-3.40 (m, 4H), 3.21-3.04 (m, 4H), 2.62 (s, 3H), 2.40 (s, 3H), 2.20-2.08 (m, 1H), 1.81-1.72 (m, 1H); ESI-MS [M+H].sup.+: 639.5.

Synthetic Procedure N

Example 120

(S,E)-N-(2,6-difluoro-4-(9-methyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-bi]indolizine-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide

Step 1:

[0634] Mixture of atropisomers of (4-amino-3,5-difluorophenyl)(9-methyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (728 mg) was obtained in the same manner as Example 30-1 and 30-2. The racemate was separated by CHIRALPAK-IG (hexane-isopropanol) to give 1st-eluting isomer (286 mg) and 2nd-eluting isomer (266 mg).

Step 2:

[0635] ##STR00266##

[0636] The procedure was performed in the same manner as Example 90 (Steps 2 and 3) using 1st-eluting isomer obtained in Step 1, thereby obtaining (S,E)-N-(2,6-difluoro-4-(9-methyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.99 (dd, J=7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.47-7.41 (m, 2H), 7.19-7.15 (m, 2H), 7.11 (dt, J=15.4, 5.1 Hz, 1H), 7.03 (dd, J=7.0, 7.0 Hz, 1H), 7.00 (brs, 1H), 6.28 (dt, J=15.3, 1.8 Hz, 1H), 4.76 (dd, J=10.4, 4.4 Hz, 1H), 4.26-4.19 (m, 1H), 4.00-3.92 (m, 4H), 3.85-3.77 (m, 2H), 3.63 (dd, J=9.1, 3.6 Hz, 1H), 3.54-3.44 (m, 311), 2.89-2.80 (m, 1H), 2.58 (dd, J=15.3, 2.3 Hz, 1H), 2.18-2.09 (m, 1H), 1.80-1.72 (m, 1H); ESI-MS [M+H].sup.+: 666.

Synthetic Procedure O

Example 148

(S,E)-N-(2,6-difluoro-4-(8,9,11-trimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diindene-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide

Step 1:

[0637] ##STR00267##

[0638] To a mixture of (3-bromopyridin-2-yl)methanamine (3.82 g, 20.4 mmol) and sodium hydrogen carbonate (858 mg, 10.2 mmol) was added ethyl formate (23.1 ml, 286 mmol). After stirring at 50? C. for 19 hours, the mixture was diluted with EtOAc then filtered through a CELITE pad. The filtrate was evaporated and the residue including N-((3-bromopyridin-2-yl)methyl)formamide was used in the next reaction.

[0639] Phosphorus oxychloride (3.81 mL, 40.8 mmol) was added to a solution of N-((3-bromopyridin-2-yl)methyl)formamide (4.39 g, 20.4 mmol) in 1,4-dioxane (66.0 mL). After stirring at 110? C. for 1 hour, saturated aqueous NaHCO.sub.3 was added, and the resulting mixture was extracted with EtOAc. The organic extracts were washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (EtOAc-hexane), thereby obtaining 8-bromoimidazo[1,5-a]pyridine.

Step 2:

[0640] ##STR00268##

[0641] To a mixture of 8-bromoimidazo[1,5-a]pyridine (3.58 g, 18.2 mmol) and 3,4,5-trifluorobenzoyl chloride (4.67 mL, 36.3 mmol) in 1,2-dichloroethane (121 mL) was added triethylamine (7.59 mL, 54.5 mmol) at ambient temperature. After stirring at ambient temperature for 30 minutes, the reaction mixture was added H.sub.2O and saturated aqueous NaHCO.sub.3. The resulting solid was collected by filtration, and vacuum-dried at 50? C., thereby obtaining (8-bromoimidazo[1,5-a]pyridin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 3:

[0642] ##STR00269##

[0643] To a mixture of (8-bromoimidazo[1,5-a]pyridin-3-yl)(3,4,5-trifluorophenyl)methanone (800 mg, 2.25 mmol), 4,4,5,5-tetramethyl-2-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1,3,2-dioxaborolane (686 mg, 2.70 mmol) and PdCl.sub.2(dppf)CH.sub.2Cl.sub.2 (184 mg, 0.225 mmol) in 1,4-dioxane (11.3 mL) was added potassium acetate (663 mg, 6.76 mmol). After stirring at 90? C. for 90 minutes, the mixture was diluted with EtOAc and water. Extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue including (8-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)imidazo[1,5-a]pyridin-3-yl)(3,4,5-trifluorophenyl)methanone was used in the next reaction.

[0644] To a mixture of 5-bromo-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-amine (649 mg, 1.69 mmol), (8-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)imidazo[1,5-a]pyridin-3-yl)(3,4,5-trifluorophenyl)methanone (881 mg, 2.19 mmol) and SPhos Pd G3 (356 mg, 0.506 mmol) in THF (17.0 mL) was added 2M aqueous tripotassium phosphate solution (2.53 mL, 5.06 mmol). After stirring at 80? C. for 2 hours, the mixture was diluted with EtOAc and water. Extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (acetone-hexane), thereby obtaining (8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)imidazo[1,5-a]pyridin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 4:

[0645] ##STR00270##

[0646] Trifluoroacetic anhydride (260 ?L, 1.87 mmol) was added to a mix solution of 2,2-(8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)imidazo[1,5-a]pyridin-3-yl)(3,4,5-trifluorophenyl)methanone (470 mg, 0.934 mmol) and triethylamine (509 ?L, 3.73 mmol) in THF (4.60 mL) at 0? C. The reaction mixture was stirred at ambient temperature for 30 minutes. To the resulting mixture was added saturated aqueous NaHCO.sub.3, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue including N-(1,2-dimethyl-5-(3-(3,4,5-trifluorobenzoyl)imidazo[1,5-a]pyridin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)-2,2,2-trifluoroacetamide was used in the next reaction.

[0647] To a mixture of N-(1,2-dimethyl-5-(3-(3,4,5-trifluorobenzoyl)imidazo[1,5-a]pyridin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)-2,2,2-trifluoroacetamide (560 mg, 0.934 mmol) and TFA (346 ?L, 4.68 mmol) in THF (4.60 mL) was added N-iodosuccinimide (462 mg, 2.06 mmol) at ambient temperature. After stirring at ambient temperature for 1 hour, the reaction mixture was added saturated aqueous NaHCO.sub.3, Na.sub.2S.sub.2O.sub.3, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (acetone-hexane), thereby obtaining 2,2,2-trifluoro-N-(5-(1-iodo-3-(3,4,5-trifluorobenzoyl)imidazo[1,5-a]pyridin-8-yl)-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)acetamide.

Step 5:

[0648] ##STR00271##

[0649] To a mixture of (2,2,2-trifluoro-N-(5-(1-iodo-3-(3,4,5-trifluorobenzoyl)imidazo[1,5-a]pyridin-8-yl)-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)acetamide (736 mg, 1.00 mmol) in 1,2-dimethoxyethane (15.0 mL) was added 2M aqueous sodium carbonate solution (5.00 mL, 10.0 mmol). After reacting by microwave apparatus at 120? C. for 30 minutes, the mixture was diluted with EtOAc and water. Extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated thereby obtaining crude (8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-iodoimidazo[1,5-a]pyridin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 6:

[0650] ##STR00272##

[0651] To a mixture of (8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-iodoimidazo[1,5-a]pyridin-3-yl)(3,4,5-trifluorophenyl)methanone (572 mg, 0.909 mmol), 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (963 ?L, 4.54 mmol) and Pd(PPh.sub.3).sub.4 (105 mg, 0.0909 mmol) in 1,4-dioxane (6.00 mL) was added 2M aqueous sodium carbonate solution (2.27 mL, 4.54 mmol). After stirring at 90? C. for 40 minutes, the mixture was diluted with EtOAc and water. The layers were shaken and separated. The aqueous phase was extracted with EtOAc, and the combined organics were washed successively with H.sub.2O then brine, dried over sodium sulfate, filtered, and evaporated. The residue was purified by column chromatography on silica gel (acetone-hexane), thereby obtaining (E)-(8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)imidazo[1,5-a]pyridin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 7:

[0652] ##STR00273##

[0653] To a mixture of (E)-(8-(4-amino-1,2-dimethyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)imidazo[1,5-a]pyridin-3-yl)(3,4,5-trifluorophenyl)methanone (200 mg, 0.349 mmol) and sodium triacetoxyborohydride (222 mg, 1.05 mmol) in CH.sub.2Cl.sub.2 (3.89 mL) was added TFA (389 ?L, 5.23 mmol) at ambient temperature. After stirring at ambient temperature for 90 minutes, the reaction mixture was added saturated aqueous NaHCO.sub.3, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (acetone-hexane), thereby obtaining (8,9-dimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diinden-2-yl)(3,4,5-trifluorophenyl)methanone.

Step 8:

[0654] ##STR00274##

[0655] A solution of (8,9-dimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diinden-2-yl)(3,4,5-trifluorophenyl)methanone (51.1 mg, 0.0965 mmol), 37% formaldehyde solution (72.5 ?L, 0.965 mmol) and TFA (14.3 ?L, 0.193 mmol) in THF (500 ?L) was stirred at ambient temperature for 5 minutes. Then a mixture of sodium cyanoborohydride and zinc chloride (1:0.5) in MeOH (0.3 mol/L, 1.13 mL, 0.338 mmol)) was added thereto, and the mixture was stirred at ambient temperature for 15 minutes. To the resulting mixture was added saturated aqueous NaHCO.sub.3, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, filtered, and evaporated. The residue was purified by column chromatography on silica gel (acetone-hexane), thereby obtaining (3,4,5-trifluorophenyl)(8,9,11-trimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diinden-2-yl)methanone.

Step 9:

[0656] ##STR00275##

[0657] To a mixture of (3,4,5-trifluorophenyl)(8,9,11-trimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diinden-2-yl)methanone (21.0 mg, 0.0390 mmol) in 1,4-dioxane (2.00 mL) was added ammonium hydroxide (2.10 mL, 18.0 mmol). After reacting by microwave apparatus at 140? C. for 4 hours, the mixture was diluted with EtOAc and water. The layers were shaken and separated. The aqueous phase was extracted with EtOAc, and the combined organics were washed successively with H.sub.2O then brine, dried over sodium sulfate, filtered, and evaporated, thereby obtaining crude (4-amino-3,5-difluorophenyl)(8,9,11-trimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diinden-2-yl)methanone.

Step 10:

[0658] ##STR00276##

[0659] A solution of (4-amino-3,5-difluorophenyl)(8,9,11-trimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diinden-2-yl)methanone (21.0 mg, 0.0389 mmol), 4-chlorocrotonic acid (5.85 mg, 0.0486 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 60.7 ?L, 0.0971 mmol) in DMF (500 ?L) was stirred at ambient temperature for 10 minutes. Then triethylamine (21.6 ?L, 0.155 mmol) was added thereto, and the mixture was stirred at ambient temperature for 30 minutes. To the resulting mixture was added saturated aqueous NaHCO.sub.3, and extracted with EtOAc, and washed successively with H.sub.2O then brine, dried over sodium sulfate, and evaporated. The residue including (E)-4-chloro-N-(2,6-difluoro-4-(8,9,11-trimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diindene-2-carbonyl)phenyl)but-2-enamide was used in the next reaction.

[0660] A solution of (E)-4-chloro-N-(2,6-difluoro-4-(8,9,11-trimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diindene-2-carbonyl)phenyl)but-2-enamide (25.0 mg, 0.0389 mmol), (3S)-tetrahydrofuran-3-amine (17.0 ?L, 0.194 mmol) and KI (32.3 g, 0.194 mmol) in DMSO (1.00 mL) was stirred at 35? C. for 1 hour. The resulting mixture was purified by preparative HPLC (water:acetonitrile (0.1% formic acid)) to give the diastereomixture of the title compound (14.7 mg, 0.0212 mmol). The mixture was separated by CHIRALPAK IA (hexane-ethanol (0.1% triethylamine)) to give (S,E)-N-(2,6-difluoro-4-(8,9,11-trimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diindene-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide (single isomer, 2nd-eluting isomer). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.86 (dd, J=6.1, 1.9 Hz, 1H), 8.20 (d, J=8.8 Hz, 2H), 7.70 (s, 1H), 7.14-7.07 (m, 3H), 6.26 (d, J=15.3 Hz, 1H), 3.96 (dd, J=14.9, 7.9 Hz, 1H), 3.85-3.78 (m, 5H), 3.68-3.56 (m, 3H), 3.49-3.44 (m, 3H), 3.06 (s, 3H), 3.02-2.94 (m, 2H), 2.70 (s, 3H), 2.51-2.44 (m, 1H), 2.18-2.09 (m, 1H), 1.77 (d, J=4.3 Hz, 1H); ESI-MS [M+H].sup.+: 695.

Synthetic Procedure P

Example 152

(E)-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,13-dimethyl-12-oxo-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide

Step 1:

[0661] ##STR00277##

[0662] To a solution of 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-amine (6.80 g, 20.1 mmol) in DMF (40 mL) was added tert-butyl nitrite (3.00 mL, 25.2 mmol) and copper(I) cyanide (3.60 g, 40.2 mmol), and the mixture was stirred at 50? C. for 1 hour. After cooling, EtOAc and 28-30% NH.sub.3 aq. were added thereto. The organic layer was separated, washed with H.sub.2O and brine, and dried over sodium sulfate. After evaporation, the resulting residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carbonitrile.

Step 2:

[0663] ##STR00278##

[0664] 5-Bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carbonitrile (1.00 g, 2.87 mmol) was diluted with 1,4-dioxane (3.0 mL) and 40% H.sub.2SO.sub.4 aq. (12 mL), and the reaction mixture was heated at 120? C. under microwave irradiation for 10 hours. After cooling, the mixture was poured into sat. NaHCO.sub.3 aq. then sat. NaHCO.sub.3 aq. and CHCl.sub.3/MeOH (5/I) were added thereto. The resulting precipitate was collected by filtration and rinsed with water to obtain 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylic acid (462 mg, 1.26 mmol). The filtrate was washed with brine then dried over Na.sub.2SO.sub.4 and evaporated to obtain additional 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylic acid.

Step 3:

[0665] ##STR00279##

[0666] To a mixture of 5-bromo-2-(methoxymethyl)-1-methyl-6-trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylic acid (490 mg, 1.33 mmol) and potassium carbonate (368 mg, 2.66 mmol) in DMF (5.0 mL) and THF (5.0 mL) was added methyl iodide (0.249 mL, 4.00 mmol). After stirring at room temperature overnight, the reaction mixture was diluted with EtOAc and H.sub.2O, mixed, and separated. The separated organic layer was washed with brine, dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain methyl 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate.

Step 4:

[0667] ##STR00280##

[0668] A solution of methyl 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate (561 mg, 1.47 mmol), (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (2.28 g, 5.89 mmol), SPhos Pd G3 (260 mg, 0.368 mmol) in Toluene (13.7 mL) and 2M K.sub.3PO.sub.4 aq. (4.41 mL, 8.83 mmol) was evacuated and N.sub.2 back-filled before heating at 80? C. by microwave irradiation for 2 hours. After cooling, EtOAc was added to the reaction mixture then filtered through a CELITE pad, rinsing with EtOAc. The filtrate was washed with H.sub.2O, NH.sub.4Cl (aq.), and brine then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone/CHCl.sub.3), thereby obtaining methyl 2-(methoxymethyl)-1-methyl-5-(3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate.

Step 5:

[0669] ##STR00281##

[0670] N-Iodosuccinimide (118 mg, 0.518 mmol) was added to a solution of methyl 2-(methoxymethyl)-1-methyl-5-(3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate (199 mg, 0.345 mmol) in THF (3.45 mL) and AcOH (148 ?L, 2.59 mmol). The reaction mixture was stirred at room temperature for 2 hours and at 40? C. for 3.5 hours. After cooling, the mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 (aq.), 20% Na.sub.2S.sub.2O.sub.3 (aq.), and brine then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining methyl 5-(1-iodo-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-2-(methoxymethyl)-1-methyl-6-trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate.

Step 6:

[0671] ##STR00282##

[0672] A mixture of methyl 5-(1-iodo-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate (196 mg, 0.279 mmol), potassium vinyltrifluoroborate (112 mg, 0.838 mmol), PdCl.sub.2(dppf).Math.CH.sub.2Cl.sub.2 (23 mg, 0.028 mmol) in 1,4-dioxane (2.79 mL) and 2M Na.sub.2CO.sub.3 aq. (629 ?L, 1.26 mmol) was evacuated and N.sub.2 back-filled before heating to 100? C. for 9 hours. After cooling, EtOAc was added to the reaction mixture then filtered, rinsing with EtOAc. The filtrate was washed with H.sub.2O, NaHCO.sub.3 (aq.), and brine then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone) to obtain methyl 2-(methoxymethyl)-1-methyl-5-(3-(3,4,5-trifluorobenzoyl)-1-vinylindolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate.

Step 7:

[0673] ##STR00283##

[0674] To a mixture of methyl 2-(methoxymethyl)-1-methyl-5-(3-(3,4,5-trifluorobenzoyl)-1-vinylindolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate (112 mg, 0.186 mmol), 2,6-lutidine (43.4 ?L, 0.372 mmol) and NaIO.sub.4 (159 mg, 0.745 mmol) in 1,4-dioxane (1.86 mL) and H.sub.2O (335 ?L) was added 1% OsO.sub.4 aq. (94.8 ?L, 3.72 ?mol). After stirring at room temperature overnight, the reaction mixture then filtered through a CELITE pad, rinsing with EtOAc. The filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining methyl 5-(1-formyl-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate.

Step 8:

[0675] ##STR00284##

[0676] A solution of methyl 5-(1-formyl-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate (69.1 mg, 0.115 mmol), methylamine (2M THF solution, 172 ?L, 0.344 mmol) and TFA (8.52 ?L, 0.115 mmol) in THF (575 ?L) was stirred at room temperature for 1 hour. Then a mixture of sodium cyanoborohydride and zinc chloride (1:0.5) in MeOH (0.3 mol/L, 954 ?L, 0.286 mmol)) was added thereto, and the mixture was stirred at room temperature for 5 hours. The reaction mixture was diluted with CHCl.sub.3, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining methyl 2-(methoxymethyl)-1-methyl-5-(1-((methylamino)methyl)-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate.

Steps 9-10:

[0677] ##STR00285##

[0678] To a solution of methyl 2-(methoxymethyl)-1-methyl-5-(1-((methylamino)methyl)-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate (45.6 mg, 73.7 ?mol) in MeOH (737 ?L) was added NaOH (aq.) (5M, 147 ?L, 0.737 mmol), and the mixture was stirred at room temperature for 1 hour. Further NaOH (aq.) (5M, 147 ?L, 0.737 mmol) was added and stirring continued for 45 minutes. To the reaction mixture was added HCl (aq.) (6M, 245 ?L, 1.47 mmol), and the mixture was diluted with EtOAc, washed with H.sub.2O and brine. To the aqueous layer was added sat. NaHCO.sub.3 (aq.), and the solution was extracted with EtOAc. Combined organics were dried over Na.sub.2SO.sub.4, filtered, and evaporated, thereby obtaining crude 2-(methoxymethyl)-1-methyl-5-(1-((methylamino)methyl)-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylic acid.

[0679] HATU (42 mg, 0.11 mmol) was added to a solution of crude 2-(methoxymethyl)-1-methyl-5-(1-((methylamino)methyl)-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylic acid (73.7 ?mol) and DIEA (37.8 ?L, 0.221 mmol) in DMF (2.95 mL). After stirring at room temperature for 30 minutes, the reaction mixture was diluted with EtOAc/hexane, washed with NaHCO.sub.3 (aq.), H.sub.2O, and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane/acetone), thereby obtaining crude 10-(methoxymethyl)-9,13-dimethyl-2-(3,4,5-trifluorobenzoyl)-7-(trifluoromethyl)-13,14-dihydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizin-12(9H)-one.

Step 11:

[0680] ##STR00286##

[0681] 28% NH.sub.3 aq. (3.0 mL, 22 mmol) was added to crude 10-(methoxymethyl)-9,13-dimethyl-2-(3,4,5-trifluorobenzoyl)-7-(trifluoromethyl)-13,14-dihydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizin-12(9H)-one (73.7 ?mol) in 1,4-dioxane (666 ?L). The reaction mixture was heated at 130? C. by microwave irradiation for 12 hours. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine, then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3/MeOH), thereby obtaining 2-(4-amino-3,5-difluorobenzoyl)-10-(methoxymethyl)-9,13-dimethyl-7-(trifluoromethyl)-13,14-dihydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizin-12(9H)-one.

Steps 12-13:

[0682] ##STR00287##

[0683] A solution of 2-(4-amino-3,5-difluorobenzoyl)-10-(methoxymethyl)-9,13-dimethyl-7-(trifluoromethyl)-13,14-dihydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizin-12(9H)-one (20.4 mg), 4-chlorocrotonic acid (9 mg, 0.07 mmol) and propylphosphonic anhydride solution (50 wt % in THF, 43.8 ?L, 70.0 ?mol) in DMF (700 ?L) was stirred at room temperature for 15 minutes. Then Et.sub.3N (19.5 ?L, 0.140 mmol) was added thereto, and the mixture was stirred at room temperature for 1 hour. Further 4-chlorocrotonic acid (5 mg, 0.04 mmol), propylphosphonic anhydride solution (50 wt % in THF, 22.0 ?L, 35.0 ?mol) and Et.sub.3N (9.76 ?L, 70.0 ?mol) were added and stirring continued for 1 hour. The reaction mixture was diluted with EtOAc, washed with NaHCO.sub.3 (aq.), H.sub.2O, and brine then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was passed through a small amount of NH silica gel (CHCl.sub.3) and evaporated, thereby obtaining crude (E)-4-chloro-N-2,6-difluoro-4-(10-(methoxymethyl)-9,13-dimethyl-12-oxo-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)but-2-enamide.

[0684] A solution of crude (E)-4-chloro-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,13-dimethyl-12-oxo-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)but-2-enamide (21 mg, 35 ?mol), KI (11 mg, 66 ?mol), DIEA (10.5 ?L, 61.2 ?mol) and 3-methyloxetan-3-amine (13.6 L, 0.153 mmol) in DMSO (306 ?L) was stirred at 40? C. for 3 hours. The reaction mixture was diluted with DMSO then filtered and purified by preparative HPLC (water:acetonitrile (0.1% formic acid)). The purified fractions were washed with NaHCO.sub.3 aq., extracted with CHCl.sub.3/MeOH then dried over Na.sub.2SO.sub.4 and evaporated, thereby obtaining (E)-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,13-dimethyl-12-oxo-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.99 (dd, J=7.0, 1.0 Hz, 1H), 7.95 (s, 1H), 7.45-7.38 (m, 2H), 7.29 (s, 1H), 7.27-7.23 (m, 1H), 7.21-7.06 (m, 3H), 6.32 (dt, J=15.3, 1.9 Hz, 1H), 4.88 (d, J=13.0 Hz, 1H), 4.83 (d, J=13.0 Hz, 1H), 4.77 (d, J=15.5 Hz, 1H), 4.57 (d, J=6.3 Hz, 2H), 4.43 (d, J=6.5 Hz, 2H), 3.98 (s, 3H), 3.80 (d, J=15.8 Hz, 1H), 3.53 (dd, J=5.1, 1.9 Hz, 2H), 3.45 (s, 3H), 2.91 (s, 3H), 1.51 (s, 3H); ESI-MS [M+H].sup.+: 738.

Synthetic Procedure Q

Example 158

(S,E)-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,13-dimethyl-14-oxo-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide

Step 1:

[0685] ##STR00288##

[0686] To a solution of 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carbonitrile (100 mg, 0.287 mmol) in dichloromethane (5.0 mL) was added diisobutylaluminium hydride in hexane (1.0 M, 1.15 mL, 1.15 mmol) at 0? C., and the mixture was stirred at 0? C. for 30 minutes. 2M HCl was added to the mixture, and stirred at room temperature for 1 hour. The resulting mixture was diluted with EtOAc (5.0 mL), added sat. NaHCO.sub.3 and Boc.sub.2O (0.119 mL, 0.575 mmol). After stirring overnight, the mixture was filtered, rinsing with EtOAc, the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc) to obtain tert-butyl ((5-bromo-2-(methoxymethyl)-1-methyl-6-trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methyl)carbamate.

Step 2:

[0687] ##STR00289##

[0688] Tert-butyl ((5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methyl)carbamate (277 mg, 0.612 mmol), (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (388 mg, 1.00 mmol), S-Phos Pd G3 (30.2 mg, 0.0429 mmol) in THF (1.5 mL) and 2M K.sub.3PO.sub.4 aq. (0.612 mL, 1.22 mmol) was evacuated and N.sub.2 back-filled before heating to 80? C. for 6 hours. After cooling, the reaction mixture was diluted with EtOAc. The resulting suspension was filtered, rinsing with EtOAc, the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)), and collected by filtration, washed with diisopropyl ether to obtain tert-butyl ((2-(methoxymethyl)-1-methyl-5-(3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methyl)carbamate.

Step 3:

[0689] ##STR00290##

[0690] N-Iodosuccinimide (80.0 mg, 0.356 mmol) and TFA (0.0661 mL, 0.889 mmol) was added tert-butyl ((2-(methoxymethyl)-1-methyl-5-(3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methyl)carbamate (230 mg, 0.356 mmol) in THF (4.0 mL). After stirring at room temperature for 1 hour, the mixture was diluted with EtOAc, and sat. NaHCO.sub.3 aq. and sat. Na.sub.2S.sub.2O.sub.3 aq. were added thereto. The organic layer was separated, and washed with a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain tert-butyl ((5-(1-iodo-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methyl)carbamate.

Step 4:

[0691] ##STR00291##

[0692] A mixture of tert-butyl ((5-(1-iodo-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methyl)carbamate (120 mg, 0.155 mmol), potassium vinyltrifluoroborate (52.0 mg, 0.388 mmol) and PdCl.sub.2(dppf).Math.CH.sub.2Cl.sub.2 (12.7 mg, 0.0155 mmol) in 1,4-dioxane (1.5 mL) and 2M Na.sub.2CO.sub.3 (aq.) (0.256 mL, 0.513 mmol) was evacuated and N.sub.2 back-filled before heating to 100? C. for 8 hours. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine, then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (hexane-acetone) to obtain tert-butyl ((2-(methoxymethyl)-1-methyl-5-(3-(3,4,5-trifluorobenzoyl)-1-vinylindolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methyl)carbamate.

Step 5:

[0693] ##STR00292##

[0694] To a mixture of tert-butyl ((2-(methoxymethyl)-1-methyl-5-(3-(3,4,5-trifluorobenzoyl)-1-vinylindolizin-8-yl)-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methyl)carbamate (82.4 mg, 0.123 mmol), 2,6-lutidine (0.0285 mL, 0.245 mmol) and NaIO.sub.4 (105 mg, 0.490 mmol) in 1,4-dioxane (3.8 mL) and H.sub.2O (0.221 mL) was added 1% OsO.sub.4 (aq.) (0.0623 mL, 0.00245 mmol). After stirring at room temperature overnight, the reaction mixture was diluted with EtOAc. The resulting suspension was filtered, rinsing with EtOAc, the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain tert-butyl ((5-(1-formyl-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methyl)carbamate.

Steps 6-8:

[0695] ##STR00293##

[0696] To a mixture of tert-butyl ((5-(1-formyl-3-(3,4,5-trifluorobenzoyl)indolizin-8-yl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methyl)carbamate (53.0 mg, 0.0786 mmol), NaPH.sub.2O.sub.4 (aq.) (0.70M, 0.786 mL, 0.550 mmol), 2-methyl-2-butene (0.416 mL, 3.93 mmol) and sulfamic acid (76.3 mg, 0.786 mmol) in tert-butanol (0.40 mL) and THF (0.40 mL) was added sodium chlorite (42.6 mg, 0.471 mmol), and stirred at room temperature for 15 minutes. EtOAc and sat. NaHCO.sub.3 aq. were added thereto, and the layers were mixed and separated. The separated organic layer was washed with brine, dried over Na.sub.2SO.sub.4, filtered, and evaporated. The resulting crude product 8-(4-(((tert-butoxycarbonyl)amino)methyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-3-(3,4,5-trifluorobenzoyl)indolizine-1-carboxylic acid was diluted with MeOH (0.50 mL) and added HCl in dioxane (4.0M, 0.500 mL, 2.0) mmol). After stirring the mixture at room temperature for 30 minutes, EtOAc and sat. NaHCO.sub.3 (aq.) were added thereto, and the layers were mixed and separated. The separated organic layer was washed with brine, dried over Na.sub.2SO.sub.4, filtered, and evaporated. The resulting crude product 8-(4-(aminomethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-3-(3,4,5-trifluorobenzoyl)indolizine-1-carboxylic acid was diluted with THF (4.6 mL) and added 1-(3-dimethylaminopropyl)-3-ethylcarbodiimide hydrochloride (30.1 mg, 0.157 mmol), 1-hydroxybenzotriazole hydrate (24.1 mg, 0.157 mmol), and triethylamine (0.219 mL, 0.157 mmol). After stirring at 50? C. for 1 hour, the mixture was diluted with EtOAc and sat. NaHCO.sub.3 (aq.), and the layers were mixed and separated. The separated organic layer was washed with brine, dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain 10-(methoxymethyl)-9-methyl-2-(3,4,5-trifluorobenzoyl)-7-(trifluoromethyl)-12,13-dihydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizin-14(9H)-one.

Step 9:

[0697] ##STR00294##

[0698] To a mixture of 10-(methoxymethyl)-9-methyl-2-(3,4,5-trifluorobenzoyl)-7-(trifluoromethyl)-12,13-dihydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizin-14(9H)-one (23.7 mg, 0.0414 mmol) and methyl iodide (7.75 ?L, 0.124 mmol) in DMF (0.40 mL) was added sodium hydride (60 wt %, 3.31 mg, 0.0828 mmol). After stirring the mixture at room temperature for 1 hour, methyl iodide (7.75 ?L, 0.124 mmol) and sodium hydride (60 wt %, 3.31 mg, 0.0828 mmol) were added thereto. The mixture was stirred at the same temperature for another 1 hour, and diluted with EtOAc and sat. NaHCO.sub.3 (aq.). The layers were mixed and separated. The separated organic layer was washed with brine, dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain 10-(methoxymethyl)-9,13-dimethyl-2-(3,4,5-trifluorobenzoyl)-7-(trifluoromethyl)-12,13-dihydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizin-14(9H)-one.

Step 10:

[0699] ##STR00295##

[0700] To a solution of 10-(methoxymethyl)-9,13-dimethyl-2-(3,4,5-trifluorobenzoyl)-7-(trifluoromethyl)-12,13-dihydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizin-14(9H)-one (26.5 mg, 0.0452 mmol) in 1,4-dioxane (2.0 mL) was added 28-30% NH.sub.3 aq. (3.0 mL). The reaction mixture was heated at 130? C. under microwave irradiation for 12 hours. After cooling, the mixture was diluted with EtOAc, washed with brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain 2-(4-amino-3,5-difluorobenzoyl)-10-(methoxymethyl)-9,13-dimethyl-7-(trifluoromethyl)-12,13-dihydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizin-14(9H)-one.

Step 11:

[0701] ##STR00296##

[0702] A solution of 2-(4-amino-3,5-difluorobenzoyl)-10-(methoxymethyl)-9,13-dimethyl-7-(trifluoromethyl)-12,13-dihydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizin-14(9H)-one (26.4 mg, 0.0452 mmol) and triethylamine (0.126 mL, 0.181 mmol) in DMF (1.0 mL) was slowly added 0.895 mL of 4-chlorocrotonic acid T3P solution (prepared from (E)-4-chlorobut-2-enoic and T3P (50 wt % in THF) (100 mg 4-chlorocrotonic acid/mL)). Additional 4-chlorocrotonic acid T3P solution (0.113 mL) was added thereto. The resulting mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 (aq.), H.sub.2O, and brine then dried over Na.sub.2SO.sub.4, filtered, and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (E)-4-chloro-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,13-dimethyl-14-oxo-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)but-2-enamide.

Step 12:

[0703] ##STR00297##

[0704] To a solution of (E)-4-chloro-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,13-dimethyl-14-oxo-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)but-2-enamide (28.9 mg, 0.0421 mmol) in DMSO (0.50 mL) was added (S)-tetrahydrofuran-3-amine (18.4 ?L, 0.211 mmol), and the mixture was stirred at 40? C. for 2 hours. The mixture was purified by preparative reversed-phase HPLC (water:acetonitrile (0.1% formic acid)). Sat. NaHCO.sub.3 (aq.) was added to the purified fractions containing the title compound, followed by extraction with ethyl acetate. The extract was washed with brine, dried over sodium sulfate, and filtered. The solvent was evaporated under reduced pressure, thereby obtaining (S,E)-N-(2,6-difluoro-4-(10-(methoxymethyl)-9,13-dimethyl-14-oxo-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:3,4]benzo[1,2:6,7]azocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide as an atropmixture. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 10.01 (dd, 3=6.9, 1.1 Hz, 1H), 7.87 (s, 1H), 7.85 (s, 1H), 7.48 (s, 1H), 7.46 (s, 1H), 7.20 (d, J=7.3 Hz, 1H), 7.13-7.07 (m, 2H), 6.29 (d, J=15.3 Hz, 1H), 5.27 (d, 1=14.5 Hz, 1H), 5.06 (d, J=14.5 Hz, 1H), 4.83 (s, 2H), 3.97-3.92 (m, 4H), 3.84-3.76 (m, 2H), 3.62 (dd, J=9.1, 3.6 Hz, 1H), 3.48-3.45 (m, 6H), 3.15 (s, 3H), 2.17-2.08 (m, 1H), 1.79-1.74 (m, 1H); ESI-MS [M+H].sup.+: 737.

Synthetic Procedure R

Example 184

(S,E)-N-(2,6-difluoro-4-(9-(methoxymethyl)-8,11-dimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diindene-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide

Step 1:

[0705] Mixture of atropisomers of (4-amino-3,5-difluorophenyl)(9-(methoxymethyl)-8,11-dimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diinden-2-yl)methanone (26 mg) was obtained in the same manner as Example 148. The racemate was separated by CHIRALPAK-IG (hexane-IPA) to give 1st-eluting isomer (9.6 mg) and 2nd-eluting isomer.

Step 2:

[0706] ##STR00298##

[0707] The procedure was performed in the same manner as Example 90 (Steps 2 and 3) using 1st-eluting isomer obtained in Step 1, thereby obtaining (S,E)-N-(2,6-difluoro-4-(9-(methoxymethyl)-8,11-dimethyl-6-(trifluoromethyl)-8,11,12,13-tetrahydro-1,2a,8,10,11-pentaazacycloocta[1,2,3-cd:5,4-e]diindene-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) a 9.88-9.84 (m, 1H), 8.23-8.16 (m, 2H), 7.78 (s, 1H), 7.15-7.06 (m, 3H), 6.98 (brs, 1H), 6.25 (dt, J=15.3, 1.8 Hz, 1H), 4.85-4.78 (m, 2H), 3.98-3.92 (m, 4H), 3.85-3.77 (m, 2H), 3.64-3.56 (m, 2H), 3.49-3.43 (m, 6H), 3.07 (s, 3H), 3.03-2.92 (m, 2H), 2.51-2.43 (m, 1H), 2.17-2.09 (m, 1H), 1.79-1.72 (m, 1H); ESI-MS [M+H].sup.+: 724.

Synthetic Procedure S

Example 199

[0708] (S,E)-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-(2-(hydroxymethyl)azetidin-1-yl)but-2-enamide

Step 1:

[0709] Mixture of atropisomers of (4-amino-3,5-difluorophenyl)(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (885 mg) was obtained in the same manner as Example 71. The racemate was separated by CHIRALPAK-IE (hexane-IPA) to give 1st-eluting isomer (405 mg) and 2nd-eluting isomer.

Step 2:

[0710] ##STR00299##

[0711] The procedure was performed in a similar manner as Example 90 (Steps 2 and 3) using 2nd-eluting isomer obtained in Step 1, thereby obtaining (S,E)-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-(2-(hydroxymethyl)azetidin-1-yl)but-2-enamide. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.97 (dd, J=6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.45 (d, J=8.0 Hz, 2H), 7.12 (s, 1H), 7.05 (d, J=7.3 Hz, 1H), 7.02-6.93 (m, 2H), 6.22 (d, J=15.3 Hz, 1H), 3.93 (s, 3H), 3.68-3.60 (m, 2H), 3.50-3.42 (m, 5H), 3.27-3.21 (m, 1H), 3.11 (s, 3H), 2.96-2.86 (m, 2H), 2.56 (d, J=15.0 Hz, 1H), 2.32-2.22 (m, 2H), 2.03-1.96 (m, 1H); ESI-MS [M+H].sup.+: 679.

Synthetic Procedure T

Example 209

(S,E)-N-(2,6-difluoro-4-(10-(methoxymethyl)-9-methyl-7-(trifluoromethyl)-9,12-dihydro-14H-imidazo[4,5:3,4]benzo[1,2:6,7]oxocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide

Step 1:

[0712] ##STR00300##

[0713] To a solution of methyl 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole-4-carboxylate (440 mg, 1.15 mmol) in dichloromethane (12 mL) was added diisobutylaluminium hydrdide in hexane (1.0M, 3.46 mL, 3.46 mmol) at 0? C., and the mixture was stirred at 0? C. for 30 minutes. MeOH and 30% potassium sodium tartrate (aq.) were added to the reaction mixture and stirred at room temperature for 30 minutes. The resulting mixture was diluted with EtOAc and washed with brine, dried over Na.sub.2SO.sub.4, evaporated to obtain (5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methanol.

Step 2:

[0714] ##STR00301##

[0715] (5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-yl)methanol (383 mg, 1.08 mmol), (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (840 mg, 2.17 mmol). S-Phos Pd G3 (53.5 mg, 0.0759 mmol) in THF (6.0 mL) and 2M K.sub.3PO.sub.4 aq. (1.36 mL, 2.71 mmol) was evacuated and N.sub.2 back-filled before heating to 80? C. for 4 hours. After cooling, the reaction mixture was diluted with EtOAc. The resulting suspension was filtered, rinsing with EtOAc, the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (8-(4-(hydroxymethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 3:

[0716] ##STR00302##

[0717] N-Iodosuccinimide (169 mg, 0.751 mmol) and TFA (0.139 mL, 1.88 mmol) were added (8-(4-(hydroxymethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (411 mg, 0.751 mmol) in THF (4.0 mL). After stirring at room temperature overnight, the mixture was diluted with EtOAc, and sat. NaHCO.sub.3 aq. and sat. Na.sub.2S.sub.2O.sub.3 aq. were added thereto. The organic layer was separated, and washed with a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (8-(4-(hydroxymethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 4:

[0718] ##STR00303##

[0719] A mixture of (8-(4-(hydroxymethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (584 mg, 0.867 mmol), potassium vinyltrifluoroborate (290 mg, 2.17 mmol), PdCl.sub.2(dppf).Math.CH.sub.2Cl.sub.2 (70.8 mg, 0.0867 mmol) in 1,4-dioxane (12 mL) and 2M Na.sub.2CO.sub.3 aq. (1.43 mL, 2.86 mmol) was evacuated and N.sub.2 back-filled before heating to 100? C. for 3 hours. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-acetone) to obtain (8-(4-(hydroxymethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-vinylindolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 5:

[0720] ##STR00304##

[0721] To a mixture of (8-(4-(hydroxymethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-vinylindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (461 mg, 0.804 mmol), lutidine (0.187 mL, 1.61 mmol) and NaIO.sub.4 (688 mg, 3.22 mmol) in 1,4-dioxane (30 mL) and H.sub.2O (1.45 mL) was added 1% OsO.sub.4 aq. (0.409 mL, 0.0161 mmol). After stirring at room temperature overnight, the reaction mixture was diluted with EtOAc. The resulting suspension was filtered, rinsing with EtOAc, the filtrate was washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain 8-(4-(hydroxymethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-3-(3,4,5-trifluorobenzoyl)indolizine-1-carbaldehyde.

Step 6:

[0722] ##STR00305##

[0723] To a mixture of 8-(4-(hydroxymethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-3-(3,4,5-trifluorobenzoyl)indolizine-1-carbaldehyde (197 mg, 0.342 mmol) and pyridine (0.111 mL, 1.37 mmol) in dichloromethane (4.0 mL) was added SOCl.sub.2 (0.0499 mL, 0.685 mmol) at 0? C., and stirred at the same temperature for 3.5 hours. Additional pyridine (0.333 mL, 4.11 mmol) and SOCl.sub.2 (0.150 mL, 2.06 mmol) were added thereto and the reaction mixture was stirred at 0? C. for 30 minutes. Further pyridine (0.222 mL, 2.74 mmol) and SOCl.sub.2 (0.100 mL, 1.37 mmol) were added to the reaction mixture two times and stirred at 0? C. to room temperature overnight. The resulting mixture was diluted with EtOAc and washed with brine, dried over Na.sub.2SO.sub.4, then evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain 8-(4-(chloromethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-3-(3,4,5-trifluorobenzoyl)indolizine-1-carbaldehyde.

Step 7:

[0724] ##STR00306##

[0725] Sodium triacetoxyborohydride (164 mg, 0.775 mmol) and acetic acid (0.0443 mL, 0.775 mmol) were added to 8-(4-(chloromethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-3-(3,4,5-trifluorobenzoyl)indolizine-1-carbaldehyde (92.0 mg, 0.155 mmol) in THF (3.0 mL). After stirring at room temperature overnight, the solvent was removed under reduced pressure. The residue was diluted with EtOAc and water, extracted with EtOAc. The separated organic phase was washed with brine and dried over sodium sulfate, filtered, evaporated to obtain (8-(4-(chloromethyl)-2-(methoxymethyl)-1-methyl-6-trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(hydroxymethyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 8:

[0726] ##STR00307##

[0727] A mixture of (8-(4-(chloromethyl)-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-5-yl)-1-(hydroxymethyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (92.4 mg, 0.155 mmol) and sodium hydride (ca. 60 wt %, 12.4 mg, 0.310 mmol) in DMF (3.0 mL) was stirred at room temperature for 30 minutes. Then EtOAc and H.sub.2O were added thereto, the separated organic layer was washed with brine, dried over Na.sub.2SO.sub.4, then evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (10-(methoxymethyl)-9-methyl-7-(trifluoromethyl)-9,12-dihydro-14H-imidazo[4,5:3,4]benzo[1,2:6,7]oxocino[5,4,3-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone.

Step 9:

[0728] ##STR00308##

[0729] To a solution of (10-(methoxymethyl)-9-methyl-7-(trifluoromethyl)-9,12-dihydro-14H-imidazo[4,5:3,4]benzo[1,2:6,7]oxocino[5,4,3-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (81.0 mg, 0.145 mmol) in 1,4-dioxane (2.5 mL) was added 28-30% NH.sub.3 aq. (4.0 mL). The reaction mixture was heated at 130? C. under microwave irradiation for 12 hours. After cooling, the mixture was diluted with EtOAc, washed with brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain (4-amino-3,5-difluorophenyl)(10-(methoxymethyl)-9-methyl-7-(trifluoromethyl)-9,12-dihydro-14H-imidazo[4,5:3,4]benzo[1,2:6,7]oxocino[5,4,3-hi]indolizin-2-yl)methanone.

Step 10:

[0730] ##STR00309##

[0731] To a solution of (4-amino-3,5-difluorophenyl)(10-(methoxymethyl)-9-methyl-7-(trifluoromethyl)-9,12-dihydro-14H-imidazo[4,5:3,4]benzo[1,2:6,7]oxocino[5,4,3-hi]indolizin-2-yl)methanone (78.9 mg, 0.142 mmol), 4-chlorocrotonic acid (18.8 mg, 0.156 mmol) and T3P (50 wt % in THF, 0.133 mL, 0.213 mmol) in THF (1.0 mL) was added triethylamine (0.0593 mL, 0.425 mmol). After stirring at room temperature for 15 minutes. T3P (50 wt % in THF, 0.133 mL, 0.213 mmol) and triethylamine (0.0593 mL, 0.425 mmol) were added thereto. After stirring at room temperature for another 15 minutes, the resulting mixture was diluted with EtOAc, washed with sat. NaHCO.sub.3 (aq.), H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated to obtain (E)-4 chloro-N-(2,6-difluoro-4-(10-(methoxymethyl)-9-methyl-7-(trifluoromethyl)-9,12-dihydro-14H-imidazo[4,5:3,4]benzo[1,2:6,7]oxocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)but-2-enamide.

Step 11:

[0732] ##STR00310##

[0733] To a solution of (E)-4-chloro-N-(2,6-difluoro-4-(10-(methoxymethyl)-9-methyl-7-(trifluoromethyl)-9,12-dihydro-14H-imidazo[4,5:3,4]benzo[1,2:6,7]oxocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)but-2-enamide (95.6 mg, 0.145 mmol) in DMSO (0.50 mL) was added (S)-tetrahydrofuran-3-amine (63.4 ?L, 0.725 mmol), and the mixture was stirred at room temperature for 3 hours. The mixture was purified by preparative reversed-phase HPLC (water:acetonitrile (0.1% formic acid)). Sat. NaHCO.sub.3 (aq.) was added to the purified fractions containing the title compound, followed by extraction with ethyl acetate. The extract was washed with brine and dried over sodium sulfate. The solvent was evaporated under reduced pressure, thereby obtaining (S,E)-N-(2,6-difluoro-4-(10-(methoxymethyl)-9-methyl-7-(trifluoromethyl)-9,12-dihydro-14H-imidazo[4,5:3,4]benzo[1,2:6,7]oxocino[5,4,3-hi]indolizine-2-carbonyl)phenyl)-4-((tetrahydrofuran-3-yl)amino)but-2-enamide. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.96 (dd, J=7.0, 1.0 Hz, 1H), 7.94 (s, 1H), 7.47 (s, 1H), 7.45 (s, 1H), 7.33 (s, 1H), 7.19-7.04 (m, 4H), 6.28 (d, J=15.3 Hz, 1H), 5.63 (d, J=11.5 Hz, 1H), 4.86 (dd, J=24.0, 12.8 Hz, 2H), 4.65 (d, J=11.5 Hz, 1H), 4.43 (d, J=13.3 Hz, 1H), 4.21 (d, J=13.0 Hz, 1H), 3.99 (s, 3H), 3.97-3.93 (m, 1H), 3.85-3.77 (m, 2H), 3.63 (dd, J=9.0, 3.8 Hz, 1H), 3.49-3.43 (m, 6H), 2.18-2.09 (m, 1H), 1.80-1.72 (m, 1H); ESI-MS [M+H].sup.+: 710.

Synthetic Procedure U

Example 215

(E)-N-(2,6-difluoro-4-(9-(2-methoxyethyl)-12-methyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide

Step 1:

[0734] Mixture of atropisomers of (4-amino-3,5-difluorophenyl)(9-(2-methoxyethyl)-12-methyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (1.46 g) was obtained in the same manner as Example 71. The racemate was separated by CHIRAL ART SB (hexane-IPA) to give 1st-eluting isomer and 2nd-eluting isomer.

Step 2:

[0735] ##STR00311##

[0736] The procedure was performed in a similar manner as Example 90 (Steps 2 and 3) using 2nd-eluting isomer obtained in Step 1, thereby obtaining (E)-N-(2,6-difluoro-4-(9-(2-methoxyethyl)-12-methyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.97 (dd, J=6.8, 1.0 Hz, 1H), 8.13 (s, 1H), 7.83 (s, 1H), 7.42 (d, J=8.0 Hz, 2H), 7.16-7.10 (m, 2H), 7.06 (d, J=7.3 Hz, 11H), 7.00 (t, J=7.0 Hz, 1H), 6.28-6.24 (m, 1H), 4.41 (t, J=5.0 Hz, 2H), 3.79 (t, J=5.1 Hz, 2H), 3.56 (dd, J=5.1, 1.9 Hz, 2H), 3.47-3.43 (m, 1H), 3.39 (s, 3H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.58-2.53 (m, 1H), 2.30 (td, J=13.9, 4.3 Hz, 1H), 1.30 (s, 3H), 0.64 (t, J=5.1 Hz, 2H), 0.42 (dd, J=6.3, 4.5 Hz, 2H); ESI-MS [M+H].sup.+: 707.

Synthetic Procedure V

Example 240

(E)-N-(2,6-difluoro-4-(7-methoxy-9-(2-methoxyethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]thiocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide

Step 1:

[0737] ##STR00312##

[0738] 2-Methoxyethylamine (3.31 mL, 38 mmol) and N,N-diisopropylethylamine (13.3 mL, 76.1 mmol) was slowly added to a solution of 1,3-difluoro-5-methoxy-2-nitrobenzene (6.54 g, 34.6 mmol) in acetonitrile (150 mL) at room temperature. After stirring at room temperature overnight, water and EtOAc were added to the resulting mixture. The organic layer was separated, and washed with brine, followed by drying over sodium sulfate. After evaporation, to the obtained residue was added THF (100 mL), and NBS (6.16 g, 34.6 mmol) was added thereto at 0? C. After stirring for 10 minutes, the precipitates were collected by filtration and washed with diisopropylether to obtain 4-bromo-3-fluoro-5-methoxy-N-(2-methoxyethyl)-2-nitroaniline (4.67 g, 42%). The filtrates were diluted with EtOAc and washed with saturated NaHCO.sub.3 (aq.) and brine, dried over Na.sub.2SO.sub.4 and evaporated. The residue was diluted with diisopropylether, and collected by filtration to obtain 4-bromo-3-fluoro-5-methoxy-N-(2-methoxyethyl)-2-nitroaniline.

Step 2:

[0739] ##STR00313##

[0740] A mixture of 4-bromo-3-fluoro-5-methoxy-N-(2-methoxyethyl)-2-nitroaniline (4.49 g, 10 mmol, 72 wt %), (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone, (5.00 g, 12.9 mmol), S-Phos Pd G3 (360 mg) in THF (70 mL) and 1M K.sub.3PO.sub.4 aq. (15 mL, 15.0 mmol) was evacuated and N.sub.2 back-filled before heating to 75? C. for 1 hour. After cooling, the reaction mixture was diluted with EtOAc and brine. The organic layer was separated, and dried over sodium sulfate. After evaporation, the resulting residue was suspended with diisopropyl ether and collected by filtration to obtain (8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 3:

[0741] ##STR00314##

[0742] N-Iodosuccinimide (1.58 g, 7.02 mmol) and TFA (2.61 mL, 35.1 mmol) were added to a solution of (8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (3.63 g, 7.02 mmol) in THF (100 mL). After stirring at room temperature for 2.5 hours, the mixture was diluted with EtOAc and saturated sodium bicarbonate solution. The organic layer was separated, and washed with brine, followed by drying over sodium sulfate. After evaporation, the precipitate was collected by filtration to obtain crude (8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 4:

[0743] ##STR00315##

[0744] A mixture of crude (8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (3.89 g), 2-[(E)-2-ethoxyvinyl]-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (6.40 mL, 30.2 mmol), Pd(PPh.sub.3).sub.4 (699 mg, 0.605 mmol) in 1,4-dioxane (78 mL) and 2M Na.sub.2CO.sub.3 aq. (15.1 mL, 30.2 mmol) was evacuated and N.sub.2 back-filled before heating to 90? C. for 6 hours. After cooling, the reaction mixture was diluted with EtOAc, washed with H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-CHCl.sub.3) to obtain (E)-(1-(2-ethoxyvinyl)-8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 5:

[0745] ##STR00316##

[0746] To (E)-(1-(2-ethoxyvinyl)-8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (2.58 g, 4.39 mmol) was added TFA (16.0 mL) at room temperature. After stirring at room temperature for 5 minutes, water was added thereto. The resulting mixture was diluted with EtOAc. The organic layer was washed with sat. NaHCO.sub.3 (aq.) and brine, dried over Na.sub.2SO.sub.4 and evaporated. To the residue was added THF (70 mL) and sodium triacetoxyborohydride (4.66 g, 22.0 mmol) at room temperature. After stirring at room temperature for 3 days, sat. NaHCO.sub.3 aq. was slowly added thereto. The mixture was extracted with EtOAc, and the organic layer was washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The residue was purified by column chromatography on silica gel (hexane-CHCl.sub.3-EtOH) to obtain (8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)-1-(2-hydroxyethyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone.

Step 6:

[0747] ##STR00317##

[0748] To a solution of triphenylphosphine (786 mg, 3.00 mmol) in THF (10 mL) was added diisopropyl azodicarboxylate (0.509 mL, 3.00 mmol). After the mixture turned to the suspension, the mixture of (8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)-1-(2-hydroxyethyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (561 mg, 1.00 mmol) and thioacetic acid (0.127 mL, 1.80 mmol) in THF (7 mL) was added thereto. After stirring for 10 minutes, methanol was added thereto, and the mixture was evaporated. The residue was purified by column chromatography on silica gel (hexane-CHCl.sub.1) to obtain crude S-(2-(8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)-3-(3,4,5-trifluorobenzoyl)indolizin-1-yl)ethyl) ethanethioate.

Step 7:

[0749] ##STR00318##

[0750] Potassium carbonate (3.655 g, 25.8 mmol) in methanol (250 mL) was evacuated and N.sub.2 back-filled, and crude S-(2-(8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)-3-(3,4,5-trifluorobenzoyl)indolizin-1-yl)ethyl) ethanethioate (799 mg) in THF (4 mL) was slowly added thereto. After stirred for 20 minutes, the mixture was neutralized with 2N HCl (aq.), and the methanolic solvent was evaporated. The residue was extracted with EtOAc, and the organic layer was dried over Na.sub.2SO.sub.4, and evaporated to obtain crude (9-methoxy-7-((2-methoxyethyl)amino)-6-nitro-3,4-dihydrobenzo[2,3]thiocino[4,5,6-hi]indolizin-1-yl)(3,4,5-trifluorophenyl)methanone.

Step 8:

[0751] ##STR00319##

[0752] The mixture of crude (9-methoxy-7-((2-methoxyethyl)amino)-6-nitro-3,4-dihydrobenzo[2,3]thiocino[4,5,6-hi]indolizin-1-yl)(3,4,5-trifluorophenyl)methanone (719 mg), iron powder (720 mg, 12.9 mmol) and ammonium chloride (690 mg, 12.9 mmol) in ethanol (16 mL) and water (4 mL) was stirred at 75? C. for 1 hour. The resulting mixture was diluted with EtOAc, and the insoluble matters were removed by filtration. The filtrate was washed with saturated NaHCO.sub.3 (aq.) and brine, dried over Na.sub.2SO.sub.4, and the solvent was removed by evaporation. To the residue was added trimethyl orthoacetate (4.68 mL) and concentrated HCl (100 uL). After stirred for 10 minutes, saturated sodium bicarbonate solution was added thereto. The mixture was extracted with EtOAc, washed with brine, followed by drying over sodium sulfate. After evaporation, the residue was purified by column chromatography on silica gel (CHCl.sub.3-ethanol) to obtain (7-methoxy-9-(2-methoxyethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]thiocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone.

Step 9:

[0753] ##STR00320##

[0754] To the mixture of (7-methoxy-9-(2-methoxyethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]thiocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (130 mg, 0.236 mmol) in 1,4-dioxane (1.5 mL) was added 28-30% NH.sub.3 (aq.) (3.0 mL). The reaction mixture was heated at 132? C. by microwave irradiation for 14 hours. After cooling, the mixture was diluted with EtOAc and THF, washed with brine then dried over Na.sub.2SO.sub.4 and evaporated to obtain (4-amino-3,5-difluorophenyl)(7-methoxy-9-(2-methoxy ethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]thiocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 10:

[0755] ##STR00321##

[0756] To the mixture of (4-amino-3,5-difluorophenyl)(7-methoxy-9-(2-methoxyethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]thiocino[4,5,6-hi]indolizin-2-yl)methanone (129 mg, 0.235 mmol), (E)-4-chlorobut-2-enoic acid (36.8 mg, 0.306 mmol) and T3P (50 wt % in THF, 0.735 mL) in THF (3 mL) was added triethylamine (0.257 mL, 1.88 mmol). After stirred at room temperature for 1 hour, the resulting mixture was diluted with EtOAc, washed with NaHCO.sub.3 (aq.), H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. To the residue was added DMSO (0.9 mL) and 1-methylcyclopropanamine (0.186 mL) and the mixture was stirred at 40? C. for 2.5 hours. Water was added thereto, and the mixture was extracted with EtOAc. The extract was washed with brine, dried over sodium sulfate, and evaporated. The residue was purified by column chromatography on silica gel (CHCl.sub.3-ethanol) to obtain (E)-N-(2,6-difluoro-4-(7-methoxy-9-(2-methoxyethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]thiocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide.

[0757] The racemate was separated by CHIRALPAK-ID (hexane-EtOH (0.1% Et.sub.3N): 30/70) to obtain (E)-N-(2,6-difluoro-4-(7-methoxy-9-(2-methoxyethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]thiocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide (2.sup.nd elution). .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 10.03 (dd, J=7.0, 1.0 Hz, H), 7.78 (s, 1H), 7.35-7.32 (m, 2H), 7.19-7.09 (m, 3H), 7.05 (t, J=7.0 Hz, 1H), 7.00 (s, 1H), 6.29 (dd, J=13.6, 1.6 Hz, 1H), 4.30 (t, J=5.4 Hz, 2H), 3.78 (s, 3H), 3.74 (t, J=5.4 Hz, 2H), 3.54 (dd, J=5.0, 1.8 Hz, 2H), 3.35 (s, 3H), 3.30-3.24 (m, 1H), 2.81-2.77 (m, 1H), 2.67 (s, 3H), 2.53 (td, J=12.5, 4.3 Hz, 1H), 2.39-2.31 (m, 1H), 1.29 (s, 3H), 0.60 (dd, J=5.8, 4.5 Hz, 2H), 0.40 (dd, J=6.1, 4.4 Hz, 2H); ESI-MS [M+H].sup.+: 686.

Synthetic Procedure W

Example 246

[0758] (E)-N-(2,6-difluoro-4-(7-methoxy-9-(2-methoxyethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopentyl)amino)but-2-enamide

Steps 1-2:

[0759] ##STR00322##

[0760] To a solution of (8-(2-fluoro-6-methoxy-4-((2-methoxyethyl)amino)-3-nitrophenyl)-1-(2-hydroxyethyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (112 mg, 0.200 mmol) obtained in step 5 (Example 240) in THF (3 mL) was added potassium ten-butoxide (1M in THF, 205 mmol). After stirred at room temperature for 15 minutes, water was added thereto. The resulting mixture was diluted with EtOAc. The organic layer was washed with sat. NaHCO.sub.3 (aq.) and brine, dried over Na.sub.2SO.sub.4 and evaporated. To the residue was added acetic anhydride (2 mL), and the mixture was stirred at 100? C. for 2 hours. The resulting mixture was diluted with EtOAc. The organic layer was washed with sat. NaHCO.sub.3 (aq.) and brine, dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by column chromatography on silica gel (hexane-EtOAc/EtOH (4/1)) to obtain N-(9-methoxy-6-nitro-1-(3,4,5-trifluorobenzoyl)-3,4-dihydrobenzo[2,3]oxocino[4,5,6-hi]indolizin-7-yl)-N-(2-methoxyethyl)acetamide.

Steps 3-4:

[0761] ##STR00323##

[0762] To a solution of N-(9-methoxy-6-nitro-1-(3,4,5-trifluorobenzoyl)-3,4-dihydrobenzo[2,3]oxocino[4,5,6-hi]indolizin-7-yl)-N-(2-methoxyethyl)acetamide (97.3 mg) in EtOAc (5 mL) was added acetic acid (0.05 mL) and palladium hydroxide on carbon (200 mg, 20 wt. % loading (dry basis)). The mixture was stirred at room temperature for 3 days under hydrogen atmosphere. After nitrogen purging, the mixture was filtered, rinsing with EtOAc and MeOH. The filtrate was evaporated, then to the residue was added 1,4-dioxane (1.5 mL) and 28-30% NH.sub.3 (aq.) (3.0 mL). The reaction mixture was heated at 133? C. by microwave irradiation for 14 hours. After cooling, the mixture was diluted with EtOAc and THF, washed with brine then dried over Na.sub.2SO.sub.4 and evaporated to obtain (4-amino-3,5-difluorophenyl)(7-methoxy-9-(2-methoxyethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone.

Step 5:

[0763] ##STR00324##

[0764] To the mixture of (4-amino-3,5-difluorophenyl)(7-methoxy-9-(2-methoxyethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (86.2 mg, 0.161 mmol), (E)-4-chlorobut-2-enoic acid (25.2 mg, 0.209 mmol) and T3P (50 wt % in THF, 0.503 mL) in THF (5 mL) was added triethylamine (0.154 mL, 1.13 mmol). After stirred at room temperature for 1 hour, the resulting mixture was diluted with EtOAc, washed with NaHCO.sub.3 (aq.), H.sub.2O and brine then dried over Na.sub.2SO.sub.4 and evaporated. To the residue was added DMSO (5 mL), 1-methylcyclopentan-1-amine hydrochloride (0.186 mL, 0.805 mmol), KI (103 mg, 0.483 mmol) and K.sub.3PO.sub.4 (205 mg, 0.966 mmol) and the mixture was stirred at room temperature overnight. Water was added thereto, and the mixture was extracted with EtOAc. The extract was washed with brine, dried over sodium sulfate, and evaporated. The residue was purified by preparative HPLC (water:acetonitrile (0.1% formic acid)) to give (E)-N-(2,6-difluoro-4-(7-methoxy-9-(2-methoxyethyl)-10-methyl-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-((1-methylcyclopentyl)amino)but-2-enamide. .sup.1H-NMR: (400 MHz, CHLOROFORM-D) ? 9.98 (dd, J=7.0, 1.0 Hz, 1H), 7.43-7.39 (m, 2H), 7.34 (dd, J=7.3, 1.0 Hz, 1H), 7.19-7.12 (m, 2H), 7.02 (t, J=7.1 Hz, 1H), 6.91 (s, 1H), 6.76 (s, 1H), 6.28 (d, J=15.5 Hz, 1H), 4.80 (dd, J=10.5, 4.8 Hz, 1H), 4.28 (t, J=5.5 Hz, 2H), 4.22-4.16 (m, 1H), 3.83 (s, 3H), 3.75-3.73 (m, 2H), 3.45 (dd, J=5.0, 1.5 Hz, 2H), 3.35 (s, 3H), 3.10-3.02 (m, 1H), 2.64 (s, 3H), 2.62-2.56 (m, 11H), 1.75-1.63 (m, 8H), 1.21 (s, 3H); ESI-MS [M+H].sup.+: 698.

Synthetic Procedure X

Synthesis of Int-252C:

[0765] ##STR00325##

Step A: ethyl (Z)-4-bromo-2-fluorobut-2-enoate (Int-252A)

[0766] A microwave vial was loaded with ethyl (Z)-2-fluorobut-2-enoate (Int-296A) (1.36 g, 10.29 mmol), N-bromosuccinimide (1.83 g, 10.29 mmol). Azobisisobutyronitrile (85 mg, 0.515 mmol) and 12 mL of CCl.sub.4. The vial was sealed and heated to 80? C. for 16 hours. After this time, the mixture was filtered and the CELITE plug was washed with ether. The residue was purified through silica gel chromatography (40 g, Hex/10% EtOAc). Ethyl (Z)-4-bromo-2-fluorobut-2-enoate (Int-252A) was obtained. .sup.1H NMR (600 MHz, Chloroform-d) ? 6.39 (dt, J=29.3, 8.6 Hz, 1H), 4.33 (q, J=7.1 Hz, 2H), 4.08 (dd, J=8.6, 1.9 Hz, 2H), 1.37 (t, J=7.1 Hz, 3H).

Step B: (S,Z)-4-((tert-butoxycarbonyl)(tetrahydrofuran-3-yl)amino)-2-fluorobut-2-enoate (Int-252B)

[0767] Ethyl (Z)-4-bromo-2-fluorobut-2-enoate (Int-252A) (1.55 g, 7.34 mmol) dissolved in 1 mL of THF was added to a solution of (S)-tetrahydrofuran-3-amine hydrochloride (1.815 g, 14.69 mmol) in THF (10 mL), followed by the addition of DIPEA (2.57 mL, 14.69 mmol). The reaction mixture was stirred at 22? C. for 12 h. The reaction mixture was concentrated under reduced pressure. The residue was diluted with DCM (25 mL). The organic layer was washed with brine (3 mL?2), dried over Na.sub.2SO.sub.4 and filtered. The filtrate was concentrated under reduced pressure to give ethyl (S,Z)-2-fluoro-4-((tetrahydrofuran-3-yl)amino)but-2-enoate. The crude product was used in the next step without further purification, and was added to a vial containing sodium carbonate (1.142 mg, 10.77 mmol), THF (5 mL) and H.sub.2O (5 mL). To this mixture, (Boc).sub.2O (2.475 mL, 10.77 mmol) was added in one portion. The reaction mixture was stirred at 22? C. for 20 hours. After this time, the reaction mixture was diluted with EtOAc (25 mL) and H.sub.2O (5 mL). The aqueous layer was separated and extracted with EtOAc (25 mL?3). The mixture was purified by silica gel chromatography, and the desired fraction was eluted with 35% EtOAc in hexanes to yield ethyl (S,Z)-4-((tert-butoxycarbonyl)(tetrahydrofuran-3-yl)amino)-2-fluorobut-2-enoate (Int-252B). .sup.1H NMR (499 MHz, Chloroform-d) ? 6.26-5.92 (m, 1H), 4.55 (s, 1H), 4.25 (q, J=7.0 Hz, 2H), 4.14-3.88 (m, 3H), 3.78-3.70 (m, 1H), 3.69-3.59 (m, 2H), 2.26-2.09 (m, 1H), 1.89-1.76 (m, 1H), 1.42 (s, 9H), 1.29 (t, J=7.1 Hz, 3H).

Step C: (S,Z)-4-((tert-butoxycarbonyl)(tetrahydrofuran-3-yl)amino)-2-fluorobut-2-enoic acid (Int-252C)

[0768] Lithium hydroxide monohydrate was added (88 mg, 3.68 mmol) to a solution of ethyl (S,Z)-4-((tert-butoxycarbonyl)(tetrahydrofuran-3-yl)amino)-2-fluorobut-2-enoate (Int-252B) (292 mg, 0.920 mmol) in THF (2 mL) and H.sub.2O (2 mL), The reaction mixture was stirred at 50? C. for 15 h. The reaction mixture was diluted with H.sub.2O (1 mL) and EtOAc (1 mL). The mixture was acidified by citric acid until pH=7. The reaction mixture was concentrated to yield (S,Z)-4-((tert-butoxycarbonyl)(tetrahydrofuran-3-yl)amino)-2-fluorobut-2-enoic acid (Int-252C). .sup.1H NMR (499 MHz, Chloroform-d) ? 10.08 (s, 1H), 6.19 (d, J=32.2 Hz, 1H), 4.80 (s, 1H), 4.09-3.99 (m, 3H), 3.87-3.77 (m, 1H), 3.76-3.68 (m, 2H), 2.32-2.14 (m, 1H), 1.96-1.76 (m, 1H), 1.46 (s, 9H).

SFC Separation to Prepare (4-amino-3,5-difluorophenyl)(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (Int-AA)

[0769] ##STR00326##

[0770] Atropmixture of (4-amino-3,5-difluorophenyl)(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (20.0 g, 38.0 mmol) was separated by SFC (Column: DAICEL CHIRALPAK AD (250 mm*50 mm, 10 um), Condition: 0.1% IPA in EtOH) to give (4-amino-3,5-difluorophenyl)(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (Int. AA, the first eluting isomer from SFC). MS (ESI): m/z (M+H)+527.

Example 252: (R,Z)-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-2-fluoro-4-((tetrahydrofuran-3-yl)amino)but-2-enamide (Ex. 252)

[0771] ##STR00327##

[0772] A vial was charged with (4-amino-3,5-difluorophenyl)(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (Int. AA) (81 mg, 0.154 mmol). (R,Z)-4-((tert-butoxycarbonyl)(tetrahydrofuran-3-yl)amino)-2-fluorobut-2-enoic acid (Int-252C) (26.1 mg, 0.096 mmol) and a stir bar. The vial was fitted with a septum and placed under nitrogen. Pyridine (0.5 mL) was added via syringe and the reaction was cooled to 0? C. Phosphorus oxy chloride (0.308 mL, 0.308 mmol) was added via syringe as a 1 M solution in pyridine, and the reaction was warmed to 22? C. for 1.5 hours and the solvent was evaporated under reduced pressure. The remaining residue was dissolved in 2 mL of DCM and 1 mL of TFA. The reaction was allowed to stir for 30 min at 22? C. The volatiles were evaporated under reduced pressure and the crude was redissolved in DMSO, filtered and subjected to HPLC purification with a TFA modifier. (R,Z)-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-2-fluoro-4-((tetrahydrofuran-3-yl)amino)but-2-enamide, 2TFA (Ex. 252) was obtained. .sup.1H NMR (499 MHz, DMSO-d.sub.6) ? 10.70 (s, 1H), 9.92 (d, J=6.7 Hz, 1H), 9.07 (s, 2H), 8.09 (s, 1H), 7.65 (s, 1H), 7.63 (s, 1H), 7.37 (s, 1H), 7.29-7.15 (m, 2H), 6.27 (dt, J=33.7, 7.3 Hz, 1H), 4.63-4.51 (m, 2H), 4.13-4.01 (m, 1H), 4.00-3.95 (m, 4H), 3.90 (s, 3H) 3.82-3.73 (m, 2H), 3.72-3.62 (m, 1H), 2.80-2.72 (m, 1H), 2.70-2.65 (m, 1H), 2.60 (s, 3H), 2.27 (d, J=13.8, 7.8 Hz, 1H), 2.02 (d, J=3.9 Hz, 1H). MS (ESI): [M+H].sup.+ m/z: 698.

Synthetic Procedure Y

Synthesis of (Z)-4-bromo-2-fluorobut-2-enoic acid (Int-2% C)

Step A: ethyl (Z)-2-fluorobut-2-enoate (Int-296A)

[0773] ##STR00328##

[0774] A dry 250 ml Schlenk-tube with a stir bar and a rubber septum was loaded with THF (60 ml) and ethyl 2-(diethoxyphosphoryl)-2-fluoroacetate (13.32 g, 55 mmol) under argon. The solution was cooled to ?78? C., and n-BuLi (2.5 M in hexane, 22 ml, 55 mmol) was added dropwise over ca. 10 min. The yellow solution was stirred for 10 min at ?78? C., and then acetaldehyde (3.1 ml, 2.4 g, 50 mmol) was added in one portion. The solution was stirred for 1 h at ?78? C., after which the cooling bath was removed, and the solution was stirred until it reached room temperature (ca. 45 min).

[0775] Next, a saturated aqueous solution of NH.sub.4Cl (60 ml) was added and the heterogeneous solution was transferred to a separatory funnel along with 60 ml ether. The phases were separated and the organic phase was collected. The aqueous phase was extracted with ether (4?60 ml). The organic phases were combined and dried over anhydrous MgSO.sub.4. The Et.sub.2O was evaporated in the rotavapor (750 mbar, 40? C.) and the rest of the solvents were removed by distillation (oil bath 85? C. After the solvents had been distilled, the temperature of the oil bath was increased to 130? C. to remove 2-hexanol (by-product from reaction of BuLi and acetaldehyde). After distilling a few drops, the oil bath was removed and the distillation apparatus was left to cool to room temperature. Next, the liquid residue was distilled under vacuum to give crude ethyl (Z)-2-fluorobut-2-enoate (Int-296A) (38? C., 18 torr, 95 torr). The distillate was used in the next step without further purification. The product was obtained as 90/10 E/Z mixture. .sup.1H NMR (600 MHz, Chloroform-d ? 6.00 (dq, J=21.3, 7.8 Hz, 1H), 4.32 (q, J=7.1 Hz, 2H), 2.03 (dd, J=7.8, 2.9 Hz, 3H), 1.36 (t, J=7.1 Hz, 3H).

Step B: (Z)-2-fluorobut-2-enoic acid (Int-296B)

[0776] Ethyl (Z)-2-fluorobut-2-enoate (Int-296A) (1.3 g, 9.84 mmol) was dissolved in ethanol (5 mL) in a 30 mL vial. Then H.sub.2O (10 mL) and calcium hydroxide (2.4 g, 32.5 mmol) were added. The mixture was stirred at room temperature for 16 hours. The reaction was neutralized by 1 N HCL. The ethanol was evaporated under vacuum and the aqueous solution was extracted by ethyl acetate (3?25 mL). The combined organic layers were dried over Na.sub.2SO.sub.4 and concentrated under vacuum to give (Z)-2-fluorobut-2-enoic acid. The crude compound was crystallized by dissolving the crude mixture in hexanes and allowing it to cool down to ?20? C. for 1 hour, followed by filtration of the solid to obtain (Z)-2-fluorobut-2-enoic acid (Int-296B). .sup.1H NMR (600 MHz, Chloroform-d) ? 10.23 (bs, 1H), 6.19 (dq, J=20.9, 7.8 Hz, 1H), 2.08 (dd, J=7.8, 2.8 Hz, 3H).

Step C: (Z)-4-bromo-2-fluorobut-2-enoic acid (Int-296C)

[0777] A microwave vial was loaded with ethyl (Z)-2-fluorobut-2-enoic acid (Int-296B) (530 mg, 5.09 mmol), N-bromosuccinimide (1.36 g, 7.64 mmol), azobisisobutyronitrile (84 mg, 0.509 mmol) and 10 mL of CCl.sub.4. The vial was sealed and heated to 90? C. for 16 h. After this time, the solvent was evaporated, and the crude mixture was extracted with Et.sub.2O and filtered and the CELITE plug was washed with Et.sub.2O. The solvent was removed under reduced pressure. The residue was purified by silica gel chromatography. The compound is eluted with hexanes/30% EtOAc. (Z)-4-bromo-2-fluorobut-2-enoic acid (Int-296C) was obtained. .sup.1H NMR (600 MHz, Chloroform-d) ? 9.2 (bs, 1H), 6.54 (dt, J=28.8, 8.6 Hz, 1H), 4.10 (dd, J=8.6, 1.4 Hz, 2H).

Example 296: (Z)-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-2-fluoro-4-((4-methyltetrahydro-2H-pyran-4-yl)amino)but-2-enamide (Ex. 296)

[0778] ##STR00329##

Step A: (Z)-4-chloro-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-2-fluorobut-2-enamide (Int. 2% a)

[0779] A solution of anhydrous dimethylacetamide (0.6 mL) and (Z)-4-bromo-2-fluorobut-2-enoic acid (Int-296C) (61 mg, 0.167 mmol, 50% purity) under nitrogen was cooled to 0? C. Thionyl chloride (22 ?L, 0.304 mmol) was added dropwise (via syringe). After stirring for 10 min, (4-amino-3,5-difluorophenyl)(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizin-2-yl)methanone (Int. AA) (80 mg, 0.152 mol) was added dropwise as a solution in DMA (1.0 mL). Upon complete addition, the mixture was warmed to 22? C., and stirred for to 2 h. The reaction was quenched with NaHCO.sub.3 (aqueous), and extracted with EtOAc. The organic phase was combined, dried over Na.sub.2SO.sub.4 and evaporated under reduced pressure. The crude mixture was purified by silica gel chromatography, (ISCO, 12 g, eluting with DCM/MeOH. The desired compound elutes with 20% MeOH in DCM). (Z)-4-chloro-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-2-fluorobut-2-enamide (Int. 296a) was obtained. MS (ESI): m/z (M+H).sup.+ 647.

Step B: (Z)-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-2-fluoro-4-((4-methyltetrahydro-2H-pyran-4-yl)amino)but-2-enamide

[0780] A vial was loaded with 4-methyltetrahydro-2H-pyran-4-amine (10.3 mg, 0.089 mmol) and DIPEA (16.1 ?L, 0.178 mmol) and dissolved in 0.5 mL of DMSO. A solution of (Z)-4-chloro-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-2-fluorobut-2-enamide (Int. 296a) (24 mg, 0.030 mmol) and KI (1.9 mg, 0.059 mmol) in 0.5 mL of DMSO was added via syringe. The mixture was heated to 50? C. for 2 hours. The mixture was filtered, washed with 0.3 mL of DMSO and submitted to HPLC purification using TFA modifier. (Z)-N-(4-(9,10-dimethyl-7-(trifluoromethyl)-13,14-dihydro-9H-imidazo[4,5:5,6]benzo[1,2:2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-2-fluoro-4-((4-methyltetrahydro-2H-pyran-4-yl)amino)but-2-enamide, 2TFA (Ex. 2%) was obtained. .sup.1H NMR (600 MHz, DMSO) ? 10.73 (s, 1H), 9.92 (d, J=7.0 Hz, 1H), 8.99 (s, 2H), 8.07 (s, 1H), 7.64 (d, J=7.9 Hz, 2H), 7.37 (s, 1H), 7.26-7.17 (m, 3H), 7.15 (s, 1H), 7.07 (s, 1H), 6.29 (dt, J=33.5, 7.4 Hz, 11H), 4.58 (dd, J=10.2, 5.0 Hz, 1H), 4.14-3.98 (m, 1H), 3.89 (s, 3H), 3.87-3.66 (m, 3H), 3.49 (t, J=10.9 Hz, 1H), 2.76 (d, J=12.8 Hz, 1H), 2.65 (s, 3H), 2.63-2.54 (m, 1H), 1.86-1.77 (m, 2H), 1.77-1.71 (m, 2H), 1.46 (s, 3H). MS (ESI): m/z: (M+H).sup.+ 726.

Synthetic Procedure Z

SFC Separation to Prepare (4-amino-3,5-difluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int. BB)

[0781] ##STR00330##

[0782] Atropmixture of (4-amino-3,5-difluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (1.95 g, 3.61 mmol) was separated by SFC (Column: DAICEL CHIRALPAK AD (250 mm*50 mm, 10 um), Condition: 0.1% NH.sub.3H.sub.2O/IPA, Mobile phase: A: CO2 B: IPA (0.1% NH.sub.3H.sub.2O)) to give (4-amino-3,5-difluorophenyl)(9,10,12-trimethyl-7-trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int. BB, the first eluting isomer from SFC). MS (ESI): m/z (M+H).sup.+ 540.

Example 285: (E)-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-(3-fluoroazetidin-1-yl)but-2-enamide (Ex. 285)

[0783] ##STR00331##

[0784] A vial with stir bar was charged with (4-amino-3,5-difluorophenyl)(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int. BB) (54 mg, 0.100 mmol) and (E)-4-chlorobut-2-enoic acid (36.2 mg, 0.300 mmol) and placed under nitrogen. Dry DCM (2 mL) and 1-propanephosphonic anhydride solution (50 wt % in EtOAc, 298 ?l, 0.500 mmol) were added via syringe. N,N-diisopropylethylamine (87 ?l, 0.500 mmol) was added dropwise via syringe. After 3 hours, sat. aq. NaHCO.sub.3 (3 mL) and DCM (3 mL) were added, and the contents were transferred to a separatory funnel. The funnel was shaken, and the layers were separated. The aqueous phase was washed with DCM (2?3 mL). The combined organics were washed with brine (3 mL), dried over MgSO.sub.4, filtered, and concentrated. The crude material including (E)-4-chloro-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:56]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)but-2-enamide was used in the next step without further purification.

[0785] A vial with stir bar was charged with (E)-4-chloro-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)but-2-enamide (24 mg, 0.037 mmol) 3-fluoroazetidine hydrochloride (20.85 mg, 0.187 mmol) and potassium iodide (31.0 mg, 0.187 mmol). DMSO (467 ?l) and N,N-diisopropylethylamine (39.2 ?l, 0.224 mmol) were added via syringe and the reaction was heated to 40? C. for 4 hours. After 4 hours, the reaction was diluted with water (4 mL) and EtOAc (4 mL) added, and the contents were transferred to a separatory funnel. The funnel was shaken, and the layers were separated. The aqueous phase was washed with EtOAc (2?4 mL). The combined organics were washed with brine (10 mL), dried over sodium sulfate, filtered, and concentrated. The crude material was subjected to HPLC purification with a TFA modifier. (E)-N-(2,6-difluoro-4-(9,10,12-trimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-(3-fluoroazetidin-1-yl)but-2-enamide, 2TFA (Ex. 285) was obtained. .sup.1H NMR (499 MHz, CD.sub.3OD) ? 9.98 (d, J=7.0 Hz, 1H), 8.20 (s, 1H), 7.52 (d, J=8.0 Hz, 2H), 7.29 (s, 1H), 7.27-7.08 (m, 2H), 6.86 (dt, J=13.8, 6.7 Hz, 1H), 6.62 (d, J=15.3 Hz, 1H), 5.47 (d, J=56.4 Hz, 1H), 4.69-4.56 (m, 2H), 4.54-4.33 (m, 2H), 4.20 (d, J=6.6 Hz, 2H), 4.01 (s, 3H), 3.65-3.46 (m, 1H), 3.08 (d, J=34.7 Hz, 4H), 2.83 (s, 3H), 2.73 (d, J=14.4 Hz, 1H), 2.37-2.10 (m, 11H). [M+H].sup.+ m/z: 681.

Synthetic Procedure AA

SFC Separation to prepare (4-amino-3,5-difluorophenyl)(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int. CC)

[0786] ##STR00332##

[0787] Atropmixture of (4-amino-3,5-difluorophenyl)(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (788 mg, 1.48 mmol) was separated by SFC (Column: IZ (250 mm*21 mm, 5 um), Condition: 40% MeOH w/0.1% NH.sub.4OH) to give (4-amino-3,5-difluorophenyl)(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int. CC, the second eluting isomer from SFC). MS (ESI): m/z (M+H).sup.+ 532.

Example 286: (Z)-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-2-fluoro-4-((1-methylcyclopropyl)amino)but-2-enamide (Ex. 286)

[0788] ##STR00333##

[0789] A vial with stir bar was charged with (4-amino-3,5-difluorophenyl)(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int. CC) (25 mg, 0.047 mmol) and (Z)-4-(tert-butoxycarbonyl)(1-methylcyclopropyl)amino)-2-fluorobut-2-enoic acid (23.14 mg, 0.085 mmol) and placed under nitrogen. Dry pyridine (470 ?l) and phosphorus oxychloride (8.77 ?l, 0.094 mmol) were added via syringe. After 3 hours, sat. aq. NaHCO.sub.3 (3 mL) and DCM (3 mL) were added, and the contents were transferred to a separatory funnel. The funnel was shaken, and the layers were separated. The aqueous phase was washed with DCM (2?3 mL). The combined organics were washed with brine (3 mL), dried over MgSO.sub.4, filtered, and concentrated. The crude material including Ten-butyl (Z)-(4-((2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)amino)-3-fluoro-4-oxobut-2-en-1-yl)(1-methylcyclopropyl)carbamate was taken on in the next step without further purification.

[0790] Tert-butyl (Z)-(4-((2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)amino)-3-fluoro-4-oxobut-2-en-1-yl)(1-methylcyclopropyl)carbamate (37 mg, 0.047 mmol) was placed in a vial with stir bar and dissolved in DCM (313 ?l). TFA (157 ?l) was added dropwise and the reaction was allowed to stir for 30 min. After 30 min, the reaction was concentrated in vacuo. The crude material was subjected to HPLC purification with a TFA modifier. (Z)-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizinc-2-carbonyl)phenyl)-2-fluoro-4-((1-methylcyclopropyl)amino)but-2-enamide, 2TFA was obtained (Ex. 286). .sup.1H NMR (499 MHz, CD.sub.3OD) ? 10.01 (d, J=7.0 Hz, 1H), 7.58-7.46 (m, 4H), 7.33 (s, 1H), 7.22 (t, J=7.1 Hz, 1H), 6.31 (dt, J=32.0, 7.6 Hz, 1H), 4.86 (s, 2H), 4.07 (d, J=7.5 Hz, 2H), 4.01 (s, 3H), 3.93 (s, 4H), 3.50 (d, J=9.0 Hz, 7H), 2.88 (d, J=14.5 Hz, 1H), 2.54-2.35 (m, 1H), 1.55 (s, 3H), 1.11 (m 2H), 0.92-0.84 (m, 2H). [M+H].sup.+ m/z: 687.

Synthetic Procedure BB

Example 287: (E)-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-(((1-fluorocyclopropyl)methyl)amino)but-2-enamide (Ex. 287)

[0791] ##STR00334##

[0792] A vial with stir bar was charged with (4-amino-3,5-difluorophenyl)(7-methoxy-10-(methoxymethyl)-9,12-<dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int. CC) (70 mg, 0.132 mmol) and (E)-4-chlorobut-2-enoic acid (47.6 mg, 0.395 mmol) and placed under nitrogen. Dry DCM (2.6 mL) and 1-propanephosphonic anhydride solution (50 wt % in EtOAc, 392 ?l, 0.658 mmol) were added via syringe. N,N-diisopropylethylamine (115 ?l, 0.658 mmol) was added dropwise via syringe (turned an orange color). After 3 hours, sat. aq. sodium bicarbonate (3 mL) and DCM (3 mL) were added, the layers were shaken, and separated. The aqueous phase was washed with DCM (2?3 mL). The combined organics were washed with brine (3 mL), dried over MgSO.sub.4, filtered, and concentrated. The crude material including (E)-4-chloro-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)but-2-enamide was taken on in the next step without further purification.

[0793] A vial with stir bar was charged with (E)-4-chloro-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)but-2-enamide (28 mg, 0.044 mmol), (1-fluorocyclopropyl)methanamine, HCl (27.7 mg, 0.221 mmol) and potassium iodide (36.7 mg, 0.221 mmol) DMSO (552 ?l) and N,N-diisopropylethylamine (38.6 ?l, 0.221 mmol) were added via syringe and the reaction was heated to 40? C. for 4 hours. After 4 hours, the reaction was diluted with water (4 mL) and EtOAc (4 mL) added, and the contents were transferred to a separatory funnel. The funnel was shaken, and the layers were separated. The aqueous phase was washed with EtOAc (2?4 mL). The combined organics were washed with brine (10 mL), dried over sodium sulfate, filtered, and concentrated. The crude material was subjected to HPLC purification with a TFA modifier. (E)-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-4-(((1-fluorocyclopropyl)methyl)amino)but-2-enamide, 2TFA (Ex. 287) was obtained. .sup.1H NMR (499 MHz, CD.sub.3OD) ? 10.03 (d, J=7.0 Hz, 1H), 7.59-7.45 (m, 4H), 7.36 (s, 1H), 7.24 (t, J=7.1 Hz, 1H), 6.99 (dt, J=14.2, 6.8 Hz, 1H), 6.64 (d, J=15.4 Hz, 1H), 4.87 (s, 3H), 4.06-4.00 (m, 5H), 3.95 (s, 4H), 3.57 (d, J=21.2 Hz, 2H), 3.52 (d, J=8.8 Hz, 6H), 2.90 (d, J=15.0 Hz, 1H), 2.55-2.42 (m, 1H), 1.28 (dd, J=18.7, 7.1 Hz, 2H), 0.97 (q, J=7.6 Hz, 2H). [M+H].sup.+ m/z: 687.

Synthetic Procedure CC

Synthesis of (E)-3-((2S,4R)-1-(tert-butoxycarbonyl)-4-fluoropyrrolidin-2-yl)acrylic acid (Int-293B)

[0794] ##STR00335##

Step A: tert-butyl (2S,4R)-2-((E)-3-ethoxy-3-oxoprop-1-en-1-yl)-4-fluoropyrrolidine-1-carboxylate (Int-293A)

[0795] A vial was loaded with (2S,4R)-tert-butyl 4-fluoro-2-(hydroxymethyl)pyrrolidine-1-carboxylate (320 mg, 1.459 mmol) and dissolved in 15 mL of DCM. The solution was cooled to 0? C., and Dess-Martin periodinane was added (929 mg, 2.19 mmol), followed by water (32 ?L, 1.751 mmol). The reaction was stirred at 0? C. for three hours. After 3 hours at 0? C., the reaction was allowed to stir for 1.5 hours at 22? C. The mixture was diluted with ether, concentrated into a 2 mL of solvent by distillation under reduced pressure. The residue was redissolved in 30 mL of ether and then washed with 15 mL of a 1:1 mixture of a 10% solution of Na.sub.2S.sub.2O.sub.3 and saturated aqueous NaHCO.sub.3, followed by 10 mL of H.sub.2O and 10 mL of brine. The aqueous layers were extracted with Et.sub.2O (2?20 mL), and the combined organic layers were washed with H.sub.2O (10 mL) and brine (10 mL). The combined organic layers were dried with Na.sub.2SO.sub.4 and concentrated. The crude mixture including tert-butyl (2S,4R)-4-fluoro-2-formylpyrrolidine-1-carboxylate was used in the next step without further purification.

[0796] A dry 100 mL flask with a stir bar and a rubber septum was charged under nitrogen atmosphere with dry THF (5 ml) and ethyl 2-(diethoxyphosphoryl)acetate (327 mg, 1.457 mmol). The solution was cooled to ?78? C., and n-BuLi (2.5 M in hexane, 583 ?l, 1.457 mmol) was added dropwise over ca. 10 min. The solution was stirred for 10 min at ?78? C., and then the crude tert-butyl (2S,4R)-4-fluoro-2-formylpyrrolidine-1-carboxylate (1.46 mmol) was added in one portion dissolved in 2 mL of THF. The solution was stirred for 1 h at ?78? C., after which the cooling bath was removed and the solution was stirred until it reached room temperature (ca. 45 min). Next, a saturated aqueous solution of NH.sub.4Cl (5 ml) was added and the heterogeneous solution was transferred to a separatory funnel and diluted with 20 ml ether. The phases were separated and the organic phase collected. The aqueous phase was extracted with ether (3?20 ml). The organic phases were combined and dried over anhydrous MgSO.sub.4. The crude mixture was purified by silica gel chromatography (the desired compound was eluted with 35% EtOAc) to yield tert-butyl (2S,4R)-2-((E)-3-ethoxy-3-oxoprop-1-en-1-yl)-4-fluoropyrrolidine-1-carboxylate (Int-293A). MS (ESI): m/z [M+H-Boc].sup.+=188.

Step B: (E)-3-((2S,4R)-1-(tert-butoxycarbonyl)-4-fluoropyrrolidin-2-yl)acrylic acid (Int-293B)

[0797] A vial was loaded with tert-butyl (2S,4R)-2-((E)-3-ethoxy-3-oxoprop-1-en-1-yl)-4-fluoropyrrolidine-1-carboxylate (Int-293A) (301.4 mg, 0.839 mmol) and LiOH (81 mg, 3.38 mmol). The mixture was dissolved in 2 mL of water and 2 mL of THF. The mixture was allowed to stir at room temperature for 20 minutes. After this time, the mixture was heated to 50? C. for 20 hours. Then, the reaction mixture was diluted with 15 mL of EtOAc, and the reaction was acidified to pH=5-6 with an aqeuous HCl 1 M solution. The aqueous layer was extracted EtOAc (3?15 mL). The combined organic layers were dried over Na.sub.2SO.sub.4 and evaporated under reduced pressure. (E)-3-((2S,4R)-1-(tert-butoxycarbonyl)-4-fluoropyrrolidin-2-yl)acrylic acid (Int-293B) was obtained. MS (ESI): m/z [M+H].sup.+=260.

Example 293: (E)-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-3-((2S,4R)-4-fluoropyrrolidin-2-yl)acrylamide (Ex. 293)

[0798] ##STR00336##

[0799] A vial with stir bar was charged with (4-amino-3,5-difluorophenyl)(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int. CC) (30 mg, 0.056 mmol) and (E)-3-((2S,4R)-1-(tert-butoxycarbonyl)-4-fluoropyrrolidin-2-yl)acrylic acid (Int-293B) (26.3 mg, 0.102 mmol) and placed under nitrogen. Dry pyridine (564 ?l) was added via syringe. Phosphorus oxychloride (10.52 ?l, 0.113 mmol) was added dropwise via syringe. After 3 hours at 0? C. sat. aq. NaHCO.sub.3 (3 mL) and DCM (3 mL) were added, and the contents were transferred to a separatory funnel. The funnel was shaken, and the layers were separated. The aqueous phase was washed with DCM (2?3 mL). The combined organics were washed with brine (3 mL), dried over MgSO.sub.4, filtered, and concentrated. The crude material including tert-butyl (2S,4R)-2-((E)-3-((2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)amino)-3-oxoprop-1-en-1-yl)-4-fluoropyrrolidine-1-carboxylate was taken on in the next step without further purification.

[0800] Tert-butyl (2S,4R)-2-((E)-3-((2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)amino)-3-oxoprop-1-en-1-yl)-4-fluoropyrrolidine-1-carboxylate (43.6 mg, 0.056 mmol) was placed in a vial with stir bar and dissolved in DCM (376 ?l), TFA (188 ?l) was added dropwise and the reaction was allowed to stir for 30 min. After 30 min. LCMS analysis indicates the reaction is complete. The reaction was concentrated in vacuo (room temperature). The crude material was subjected to HPLC purification with a TFA modifier. (E)-N-(2,6-difluoro-4-(7-methoxy-10-(methoxymethyl)-9,12-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)phenyl)-3-((2S,4R)-4-fluoropyrrolidin-2-yl)acrylamide, 2TFA (Ex. 293) was obtained. .sup.1H NMR (499 MHz, CD.sub.3CN) ? 9.94 (d, J=6.8 Hz, 1H), 9.82 (brs, 1H), 8.84 (s, 1H), 7.49 (d, J=8.1 Hz, 2H), 7.43 (d, J=7.2 Hz, 1H), 7.32 (d, J=10.7 Hz, 2H), 7.15 (t, J=7.0 Hz, 11H), 7.04 (dd, J=15.5, 7.6 Hz, 1H), 6.60 (d, J=15.7 Hz, 1H), 5.48 (d, J=52.8 Hz, 1H), 4.77 (s, 2H), 4.69-4.55 (m, 1H), 3.91 (s, 3H), 3.89 (s, 3H) 3.80 (dd, J=34.5, 9.9 Hz, 2H), 3.62 (dd, J=24.6, 13.9 Hz, 2H), 3.52-3.35 (m, 61H), 2.82 (d, J=14.2 Hz, 1H), 2.66-2.52 (m, 1H), 2.43 (t, J=11.9 Hz, 1H), 2.26 (dt, J=35.9, 11.5 Hz, 11H). [M+H].sup.+ m/z: 673.

Synthetic Procedure DD

Example 283: (E)-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazole-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide (Ex. 283)

[0801] ##STR00337## ##STR00338## ##STR00339##

Step A: 4-bromo-2-methyl-5-(trifluoromethyl)aniline (Int-283a)

[0802] To a solution of 2-methyl-5-(trifluoromethyl)aniline (20 g, 114 mmol) in acetonitrile (350 mL) was added NBS (22.3 g, 125 mmol) under 10 TC. After the addition, the mixture was stirred at 25? C. for 90 min. TLC (petroleum ether/ethyl acetate=5:1) showed the new spot was formed. The mixture was quenched by addition of saturated Na.sub.2S.sub.2O.sub.3 solution (50 mL), extracted with EtOAc (3?20 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by silica gel column chromatography using (petroleum ether/ethyl acetate 5:1 as eluent) to give 4-bromo-2-methyl-5-(trifluoromethyl)aniline (Int-283a).

Step B: 5-bromo-6-(trifluoromethyl)-1H-indazole (Int-283b)

[0803] To a solution of 4-bromo-2-methyl-5-(trifluoromethyl)aniline (Int-283a) (11.3 g, 44.4 mmol) in acetic acid (413 mL, 722 mmol) was added sodium nitrite (3.34 g, 48.4 mmol) at 0? C. slowly. After the addition, the mixture was stirred at 25? C. for 2 h. TLC (petroleum ether/ethyl acetate=3:1) showed the new spot was formed. The reaction was quenched by addition of saturated NaHCO.sub.3 solution until pH>7. The mixture was extracted with EtOAc (ca. 60 mL?3). The combined organic layer was washed with brine, and then dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give crude product. The crude product was purified by silica gel column chromatography using (petroleum ether/ethyl acetate 3:1 as eluent) to give 5-bromo-6-(trifluoromethyl)-1H-indazole (Int-283b). MS (EST) [M+H].sup.+: m/z 264, 266.

Step C: 5-bromo-4-nitro-6-(trifluoromethyl)-1H-indazole (Int-283c)

[0804] To a solution of 5-bromo-6-(trifluoromethyl)-1H-indazole (Int-283b) (8 g, 30.2 mmol) in conc. H.sub.2SO.sub.4 (160 mL, 2.94 mol) was added nitric acid fuming (8 mL, 30.2 mmol) at 0? C. slowly. After the addition, the mixture was stirred at 0? C. for 1 h. The reaction solution was poured into 500 mL of ice water, filtered and washed to collect the precipitation, and evaporated under reduced pressure to give 5-bromo-4-nitro-6-(trifluoromethyl)-1H-indazole (Int-283c), the crude product was used in the next step without purification. MS (ESI) [M+H].sup.+: m/z: 310, 312.

Step D: 5-bromo-1-methyl-4-nitro-6-(trifluoromethyl)-1H-indazole (Int-283d) & 5-bromo-2-methyl-4-nitro-6-(trifluoromethyl)-2H-indazole (Int-283dd)

[0805] To a solution of 5-bromo-4-nitro-6-(trifluoromethyl)-1H-indazole (Int-283c) (6.5 g, 21.0 mmol) in THF (60 mL) was added Cs.sub.2CO.sub.3 (13.7 g, 41.9 mmol) at 0? C. The mixture was stirred at 0? C. for 15 min. Then the reaction solution was added iodomethane (2.61 mL, 41.9 mmol) at 25? C., and the mixture was stirred for 15 h. The mixture was diluted with water (40 mL), extracted with EtOAc (3?40 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by silica gel column chromatography using (petroleum ether/ethyl acetate 2:1 as eluent) to give 5-bromo-1-methyl-4-nitro-6-(trifluoromethyl)-1H-indazole (Int-283d) and 5-bromo-2-methyl-4-nitro-6-(trifluoromethyl)-2H-indazole (Int-283dd). MS (ESI) [M+H].sup.+: m/z 324, 326. Int-283d: .sup.1H NMR (CDCl.sub.3, 400 MHz) ? 8.02 (s, 1H), 7.94 (s, 1H), 4.14 (s, 3H) Int-283dd: .sup.1H NMR (CDCl.sub.3, 400 MHz) ? 8.26 (s, 1H), 8.07 (s, 1H), 4.25 (s, 3H).

Step E: 5-bromo-1-methyl-6-(trifluoromethyl)-1H-indazol-4-amine (Int-283e)

[0806] A mixture of 5-bromo-1-methyl-4-nitro-6-(trifluoromethyl)-1H-indazole (Int-283d) (2.5 g, 7.71 mmol), iron powder (1.11 g, 19.9 mmol), and ammonium chloride (1.07 g, 19.9 mmol) in EtOH (40 mL) and water (8 mL) was stirred at 70? C. for 1 h. The mixture was diluted with EtOAc (50 mL), and the insoluble precipitate was filtered off, and water (50 mL) was added. The organic layer was separated, washed with a saturated sodium chloride solution, and then dried over sodium sulfate. After filtration, the organic solvent was removed under reduced pressure and the obtained residue was diluted with diisopropyl ether (100 mL) and the precipitates were collected by filtration to obtain 5-bromo-1-methyl-6-(trifluoromethyl)-1H-indazol-4-amine (Int-283e). .sup.1H NMR (CD.sub.3OD, 400 MHz) ? 8.34 (s, 1H), 7.34 (s, 1H), 3.33 (br, 3H).

Step F: (8-(4-amino-1-methyl-6-(trifluoromethyl)-1H-indazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-283f)

[0807] To a solution of 5-bromo-1-methyl-6-(trifluoromethyl)-1H-indazol-4-amine (Int-283e) (1.7 g, 5.78 mmol), (8-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (3.36 g, 8.67 mmol) in THF (20 mL) was added 1 M aqueous potassium phosphate (8.67 mL, 8.67 mmol) and SPhos Pd G3 (0.451 g, 0.578 mmol) at 25? C. under N.sub.2 atmosphere. The mixture was stirred at 80? C. for 2 h. The mixture was cooled, diluted with water (20 mL), extracted with EtOAc (3?15 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The reaction was quenched by addition of water (ca. 20 mL), extracted with EtOAc (ca. 15 mL?3). The combined organic layer was washed with brine, and then dried over Na.sub.2SO.sub.4, filtered and concentrated under reduced pressure to give the crude product (8-(4-amino-1-methyl-6-(trifluoromethyl)-1H-indazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-283f). MS (ESI) [M+H].sup.+: m/z 489.

Step G: (8-(4-amino-1-methyl-6-(trifluoromethyl)-1H-indazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-283g)

[0808] To a solution of (8-(4-amino-1-methyl-6-(trifluoromethyl)-1H-indazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-283f) (1.5 g, 3.13 mmol) in THF (15 mL) was added TFA (0.542 mL, 7.04 mmol) and NIS (0.739 g, 3.29 mmol) at 25? C. The mixture was stirred at 25? C. for 2 h. The mixture was quenched with sat. aq. NaHCO.sub.3 (15 mL), extracted with EtOAC (3?15 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (ISCO?; 40 g SepaFlash? Silica Flash Column, Eluent of 0?30% EA/PE gradient at 40 mL/min) to give (8-(4-amino-1-methyl-6-(trifluoromethyl)-1H-indazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-283g). MS (ESI) [M+H].sup.+: m/z 615.

Step H: (E)-(8-(4-amino-1-methyl-6-(trifluoromethyl)-1H-indazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-283h)

[0809] To a solution of (8-(4-amino-1-methyl-6-(trifluoromethyl)-1H-indazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-283g) (1.2 g, 1.95 mmol), (E)-2-(2-ethoxyvinyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (1.55 g, 7.81 mmol) in dioxane (12 mL) was added Na.sub.2CO.sub.3 (4.88 mL, 9.77 mmol) and Pd(Ph.sub.3P).sub.4 (0.226 g, 0.195 mmol) at 25? C. under N.sub.2 atmosphere. The mixture was stirred at 95? C. for 4 h. After cooled to room temperature, the reaction mixture was diluted with EtOAc (12 mL), washed with H.sub.2O (12 mL) and brine (2 mL), dried over Na.sub.2SO.sub.4 and evaporated. The residue was triturated by diisopropyl ether (12 mL) and the precipitates were collected by filtration to obtain crude product. The crude product was purified by reversed MPLC to give (E)-(8-(4-amino-1-methyl-6-(trifluoromethyl)-1H-indazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-283h). MS (ESI) [M+H].sup.+: m/z 559.

Step I: (9-methyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)(3,4,5-trifluorophenyl)methanone (Int-283i)

[0810] To a solution of (E)-(8-(4-amino-1-methyl-6-(trifluoromethyl)-1H-indazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-283h) (742 mg, 1.33 mmol) in DCM (8 mL) was added sodium triacetoxyborohydride (563 mg, 2.66 mmol) and TFA (2.047 mL, 26.6 mmol) at 25? C. The mixture was stirred at 25? C. for 30 minutes. LCMS showed the reaction was completed. The reaction was quenched with aqueous sat. NaHCO.sub.3 (8 mL) and 5 M aqueous NaOH (8 mL), then the resulting mixture was diluted with EtOAc (10 mL). The organic layer was washed with brine, dried over Na.sub.2SO.sub.4 and evaporated. The crude product was purified by flash silica gel chromatography (ISCO?; 12 g SepaFlash? Silica Flash Column, Eluent of 0?40% EA/PE gradient at 40 mL/min) to give (9-methyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)(3,4,5-trifluorophenyl)methanone (Int-283i). MS (ESI) [M+H].sup.+: m/z 515.

Step J: (9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)(3,4,5-trifluorophenyl)methanone (Int-283j)

[0811] To a solution of (9-methyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)(3,4,5-trifluorophenyl)methanone (Int-283i) (224 mg, 0.435 mmol) in THF (3 mL) was added aqueous formaldehyde (0.065 mL, 0.871 mmol, 37%) and Zn(BH.sub.3CN).sub.2 (2.18 mL, 0.653 mmol) at 25? C. The mixture was stirred at 25? C. for 1 h. EtOAc (4 mL) and 30% ammonium solution (3 mL) was added thereto, and the organic layer was washed with brine, dried over Na.sub.2SO.sub.4, and evaporated. The crude product was purified by flash silica gel chromatography (ISCO?; 12 g SepaFlash? Silica Flash Column, Eluent of 0?100% EtOAc/Pet. ether gradient @ 40 mL/min) to give (9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)(3,4,5-trifluorophenyl)methanone (Int-283j). MS (ESI) [M+H].sup.+: m/z 529.

Step K: (4-azido-3,5-difluorophenyl)(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)methanone (Int-283k)

[0812] To a solution of (9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)(3,4,5-trifluorophenyl)methanone (Int-283j) (280 mg, 0.526 mmol) in DMSO (3 mL) was added sodium azide (100 mg, 1.538 mmol) at 25? C. The mixture was stirred at 70? C. for 4 h. The mixture was cooled, diluted with water (3 mL), extracted with EtOAc (3?3 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give (4-azido-3,5-difluorophenyl)(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)methanone (Int-283k), used in the next step directly. MS (ESI) [M+H].sup.+: m/z 552.

Step L: (4-amino-3,5-difluorophenyl)(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)methanone (Int-2831)

[0813] To a solution of (4-azido-3,5-difluorophenyl)(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)methanone (Int-283k) (362 mg, 0.656 mmol) in MeOH (5 mL) was added wet Pd/C (6.99 mg, 0.066 mmol, 10%) at 25? C. under H.sub.2 atmosphere (15 psi). The mixture was stirred at 25? C. for 30 min. The mixture was filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (ISCO?; 4 g SepaFlash? Silica Flash Column, Eluent of 0?30% EtOAc/Pet. ether gradient at 40 mL/min) to give (4-amino-3,5-difluorophenyl)(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)methanone (Int-2831). MS (ESI) [M+H].sup.+: m/z 526.

Step M: (E)-4-bromo-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazole-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (Int-283m)

[0814] To a solution of (4-amino-3,5-difluorophenyl)(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazol-2-yl)methanone (Int-2831) (90 mg, 0.171 mmol). (E)-4-bromobut-2-enoic acid (48.0 mg, 0.291 mmol) in CH.sub.2Cl.sub.2 (1 mL) were added T3P (545 mg, 0.856 mmol, 50% in EA) and DIEA (0.179 mL, 1.028 mmol) at 25? C. The mixture was stirred at 25? C. for 2 h. The mixture was diluted with sat.aq. NaHCO.sub.3 (1 mL), extracted with DCM (3?2 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give (E)-4-bromo-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazole-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (Int-283m), used in the next step directly. MS (ESI) [M+H].sup.+: m/z 672, 674.

Step N: (E)-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazole-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide (Int-283n)

[0815] To a solution of (E)-4-bromo-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazole-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (Int-283m) (115 mg, 0.171 mmol) in DMSO (2 mL) was added DIEA (0.149 mL, 0.855 mmol), KI (142 mg, 0.855 mmol) and 3-methyloxetan-3-amine HCl (126 mg, 1.03 mmol) at 25? C. The mixture was stirred at 40? C. for 4 h. The mixture was cooled, diluted with water (2 mL), extracted with EtOAc (3?2 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (ISCO?; 4 g SepaFlash? Silica Flash Column, Eluent of 0?30% EtOAc/Pet. ether gradient at 40 mL/min) to give (E)-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazole-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide (Int-283n). MS (ESI) [M+H].sup.+: m/z 679.

Step O: (E)-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazole-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide (Ex. 283)

[0816] (E)-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazole-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide (Int-283n) (50 mg, 0.074 mmol) was separated by SFC (Column: DAICEL CHIRALCEL IG (250 mm*30 mm, 10 um), Condition: 0.1% NH.sub.3 in EtOH, Flow rate: 80 mL/min.) to give (E)-N-(4-(9,12-dimethyl-7-(trifluoromethyl)-9,12,13,14-tetrahydroindolizino[8,1:4,5,6]azocino[2,3-e]indazole-2-carbonyl)-2,6-difluorophenyl)-4-((3-methyloxetan-3-yl)amino)but-2-enamide (Ex. 283) (the second eluting isomer from SFC). MS (ESI) [M+H].sup.+: m/z 679. .sup.1H NMR (400 MHz, CD.sub.3OD) ? 9.95 (dd, J=6.2, 1.8 Hz, 1H), 8.43 (d, J=0.6 Hz, 1H), 8.13 (s, 1H), 7.51 (d, J=7.9 Hz, 2H), 7.25 (s, 1H), 7.16-7.09 (m, 2H), 6.98 (td, J=15.3 Hz, 6.8, 1H), 6.67 (d, J=15.3 Hz, 1H), 4.81 (d, J=7.9 Hz, 2H), 4.61 (d, J=7.8 Hz, 2H), 4.22 (s, 3H), 4.01 (dd, J=6.8, 1.0 Hz, 2H), 3.31-3.27 (m, 1H), 3.04-2.97 (m, 4H), 2.67 (br dd, J=15.0, 2.0, Hz, 1H), 2.30-2.18 (m, 1H), 1.76 (s, 3H).

Synthetic Procedure EE

Example 300: (E)-N-(4-(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide (Ex. 300)

[0817] ##STR00340## ##STR00341## ##STR00342## ##STR00343##

Step A: 3,5-difluoro-4-nitrophenol (Int-300a)

[0818] To a solution of 1,3,5-trifluoro-2-nitrobenzene (20. g, 110 mmol) in DMSO (240 mL) and water (60 mL) was added potassium hydroxide (12.67 g, 226 mmol) at 25? C. The mixture was stirred at 25? C. for 12 h. The mixture was acidified to pH 6 with aq. HCl (3 N), extracted with EtOAc (3?50 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (Eluent of 0?10% EtOAc/Pet. ether gradient) to give 3,5-difluoro-4-nitrophenol (Int-300a). .sup.1H NMR (500 MHz, CDCl.sub.3) ? 7.89 (s, 1H), 6.51-6.56 (m, 2H).

Step B: 5-(difluoromethoxy)-1,3-difluoro-2-nitrobenzene (Int-300b)

[0819] To a solution of 3,5-difluoro-4-nitrophenol (Int-300a) (3.6 g, 21 mmol) in DMF (50 mL) was added potassium carbonate (11.37 g, 82 mmol) and methyl 2-chloro-2,2-difluoroacetate (8.91 g, 61.7 mmol) at 25? C. The mixture was stirred at 50? C. for 12 h. The mixture was cooled, diluted with water (30 mL), extracted with EtOAc (3?30 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 0?10% EtOAc/Pet. ether gradient) to give 5-(difluoromethoxy)-1,3-difluoro-2-nitrobenzene (Int-300b). .sup.1H NMR (500 MHz, CDCl.sub.3) ? 6.86-6.93 (m, 2H), 6.62 (t, J=71.5 Hz, 1H).

Step C: 5-(difluoromethoxy)-3-fluoro-N-methyl-2-nitroaniline (Int-300c)

[0820] To a solution of 5-(difluoromethoxy)-1,3-difluoro-2-nitrobenzene (Int-300b) (2.4 g, 11 mmol) in EtOH (30 mL) was added methanamine (2.7 g, 29 mmol, 33% in EtOH) at 0? C. The mixture was stirred at 0? C. for 1 h. The mixture was diluted with water (10 mL), extracted with EtOAc (3?10 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 0?30% EtOAc/Pet. ether gradient) to give 5-(difluoromethoxy)-3-fluoro-N-methyl-2-nitroaniline (Int-300c). MS (ESI) [M+H].sup.+: m/z 237.

Step D: 4-bromo-5-(difluoromethoxy)-3-fluoro-N-methyl-2-nitroaniline (Int-300d)

[0821] To a solution of 5-(difluoromethoxy)-3-fluoro-N-methyl-2-nitroaniline (Int-300c) (1.7 g, 7.20 mmol) in DMF (30 mL) was added 1-bromopyrrolidine-2,5-dione (1.345 g, 7.56 mmol) at 25? C. The mixture was stirred at 25? C. for 1.5 h. The mixture was diluted with water (20 mL), extracted with EtOAc (3?10 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 0?30% EtOAc/Pet. ether gradient) to give 4-bromo-5-(difluoromethoxy)-3-fluoro-N-methyl-2-nitroaniline (Int-300d). MS (EST) [M+H].sup.+: m/z 315, 317.

Step E: 4-bromo-5-(difluoromethoxy)-N3,N3-bis(2,4-dimethoxybenzyl)-N1-methyl-2-nitrobenzene-1,3-diamine (Int-300e)

[0822] To a solution of 4-bromo-5-(difluoromethoxy)-3-fluoro-N-methyl-2-nitroaniline (Int-300d) (1.1 g, 3.5 mmol) in EtOH (20 ml) was added N-ethyl-N-isopropylpropan-2-amine (1.829 mL, 10.47 mmol) and N-(2,4-dimethoxybenzyl)-1-(2,5-dimethoxyphenyl)methanamine (2.216 g, 6.98 mmol) at 25? C. The mixture was stirred at 80? C. for 12 h. The mixture was cooled, diluted with water (20 mL), extracted with DCM (3?15 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 0?10% EtOAc/Pet. ether gradient) to give 4-bromo-5-(difluoromethoxy)-N3,N3-bis(2,4-dimethoxybenzyl)-N1-methyl-2-nitrobenzene-1,3-diamine (Int-300e). MS (ESI) [M+H].sup.+: m/z 612, 614.

Step F: 4-bromo-5-(difluoromethoxy)-N3,N3-bis(2,4-dimethoxybenzyl)-N1-methylbenzene-1,2,3-triamine (Int-300f)

[0823] To a solution of 4-bromo-5-(difluoromethoxy)-N3,N3-bis(2,4-dimethoxybenzyl)-N1-methyl-2-nitrobenzene-1,3-diamine (Int-300e) (1.8 g, 2.9 mmol) in MeOH (30 mL) was added nickel(II) chloride (1.14 g, 8.82 mmol) and sodium borohydride (0.556 g, 14.70 mmol) at 25? C. under N.sub.2 atmosphere. The mixture was stirred at 25? C. for 1 h. The mixture was quenched with water (20 mL), extracted with EtOAc (2?15 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude 4-bromo-5-(difluoromethoxy)-N3,N3-bis(2,4-dimethoxybenzyl)-N1-methylbenzene-1,2,3-triamine (Int-300f). MS (ESI) [M+H].sup.+: m/z 582, 584.

Step G: 5-bromo-6-(difluoromethoxy)-N-(2,4-dimethoxybenzyl)-1,2-dimethyl-1H-benzo[d]imidazol-4-amine (Int-300g)

[0824] To a mixture of 4-bromo-5-(difluoromethoxy)-N3,N3-bis(2,4-dimethoxybenzyl)-N1-methylbenzene-1,2,3-triamine (Int-300f) (1.7 g, 2.9 mmol) and 1,1,1-trimethoxyethane (5.26 g, 43.8 mmol) was added acetic acid (0.167 mL, 2.92 mmol) and conc. HCl (0.024 mL, 0.29 mmol) at 25? C. under N.sub.2 atmosphere. The mixture was stirred at 25? C. for 12 h. The mixture was basified to pH 8 with aq. NaOH (2N), diluted with EtOAc (10 mL), washed with water (10 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude 5-bromo-6-(difluoromethoxy)-N-(2,4-dimethoxybenzyl)-1,2-dimethyl-1H-benzo[d]imidazol-4-amine (Int-300g). MS (ESI) [M+H].sup.+: m/z: 456 458.

Step H: 5-bromo-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-4-amine (Int-300h)

[0825] A mixture of 5-bromo-6-(difluoromethoxy)-N-(2,4-dimethoxybenzyl)-1,2-dimethyl-1H-benzo[d]imidazol-4-amine (Int-300g) (1.33 g, 2.91 mmol) and TFA (15 mL, 195 mmol) was stirred at 50? C. for 2 h. The mixture was evaporated under reduced pressure to give the crude product. The residue was purified by reverse preparative HPLC (Column: Boston Uni C18 150*40 mm*5 um; Condition: water (0.01% TFA)-ACN; Begin B-End B: 14-44; Gradient Time (min): 10; 100% B Hold Time (min): 2; FlowRate (mL/min): 60) to give 5-bromo-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-4-amine (Int-300h). MS (ESI) [M+H].sup.+: m/z 306, 308.

Step I: (8-(4-amino-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-300i)

[0826] To a solution of 5-bromo-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-4-amine (Int-300h) (350 mg, 1.14 mmol), (8-(5,5-dimethyl-1,3,2-dioxaborinan-2-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (528 mg, 1.36 mmol) in THF (8 mL) was added potassium phosphate (1.136 ml, 1.704 mmol) and SPhos Pd G3 (89 mg, 0.11 mmol) at 25? C. under N.sub.2 atmosphere. The mixture was stirred at 75? C. for 1.5 h. The mixture was cooled, diluted with water (5 mL), extracted with EtOAc (3?5 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 0?50% EA/PE gradient) to give (84(4-amino-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-300i). MS (ESI) [M+H].sup.+: m/z: 501.

Step J: (8-(4-amino-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-300j)

[0827] To a solution of (8-(4-amino-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-5-yl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-300i) (550. mg, 1.10 mmol) in THF (10 mL) was added 1-iodopyrrolidine-2,5-dione (24.73 mg, 0.110 mmol) and 2,2,2-trifluoroacetic acid (0.191 mL, 2.47 mmol) at 25? C. The mixture was stirred at 25? C. for 1 h. The mixture was quenched with sat. aq. NaHCO.sub.3 (10 mL), extracted with EtOAc (3?10 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 0?50% EtOAc/Pet. ether gradient) to give (8-(4-amino-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-300j). MS (ESI) [M+H].sup.+: m/z 627.

Step K: (E)-(8-(4-amino-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-300k)

[0828] To a solution of (8-(4-amino-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-5-yl)-1-iodoindolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-300j) (550. mg, 0.878 mmol), (E)-2-(2-ethoxyvinyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane (522 mg, 2.63 mmol) in dioxane (10 mL) was added sodium carbonate (2.195 mL, 4.39 mmol, 2M) and Pd(PPh.sub.3).sub.4 (101 mg, 0.088 mmol) at 25? C. under N.sub.2 atmosphere. The mixture was stirred at 95? C. for 4 h. After cooling, the reaction mixture was diluted with EtOAc (20 mL), washed with H.sub.2O (15 mL) and brine (15 mL), dried over Na.sub.2SO.sub.4 and evaporated. The residue was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 50% EtOAc/Pet. ether gradient) to give (E)-(8-(4-amino-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-300k). MS (EST) [M+H].sup.+: m/z 571.

Step L: (7-(difluoromethoxy)-9,10-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (Int-3001)

[0829] To a solution of (E)-(8-(4-amino-6-(difluoromethoxy)-1,2-dimethyl-1H-benzo[d]imidazol-5-yl)-1-(2-ethoxyvinyl)indolizin-3-yl)(3,4,5-trifluorophenyl)methanone (Int-300k) (450 mg, 0.789 mmol) in CH.sub.2Cl.sub.2 (8 mL) was added sodium triacetoxyhydroborate (334 mg, 1.58 mmol) and 2,2,2-trifluoroacetic acid (1.215 mL, 15.78 mmol) at 25? C. The mixture was stirred at 25? C. for 2 h. The mixture was quenched with sat. aq. NaHCO.sub.3 (20 mL), extracted with DCM (3?10 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 0?50% EtOAc/Pet. ether gradient) to give (7-(difluoromethoxy)-9,10-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (Int-3001). MS (ESI) [M+H].sup.+: m/z 527.

Step M: (7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (Int-300m)

[0830] To a solution of (7-(difluoromethoxy)-9,10-dimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (Int-3001) (370. mg, 0.700 mmol) in THF (6 mL) was added formaldehyde (0.104 mL, 1.40 mmol, 37% aqueous) and Zn(BH.sub.3CN).sub.2 (3.50 mL, 1.05 mmol, 0.3 M) at 25? C. The mixture was stirred at 25? C. for 1 h. The mixture was diluted with EtOAc (10 mL) and NH.sub.3.Math.H.sub.2O (1 mL), washed with brine (10 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 0?50% EtOAc/Pet. ether gradient) to give (7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (Int-300m). MS (ESI) [M+H].sup.+: m/z 541.

Step N: (4-azido-3,5-difluorophenyl)(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int-300n)

[0831] To a solution of (7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)(3,4,5-trifluorophenyl)methanone (Int-300m) (150. mg, 0.278 mmol) in DMSO (3 mL) was added sodium azide (200. mg, 3.08 mmol) at 25? C., the reaction was stirred at 70? C. for 5 h. After cooled to room temperature, the mixture was diluted with water (5 mL), extracted with EtOAc (3?5 mL), the organic layer was separated, washed with brine (5 mL), dried over Na.sub.2SO.sub.4, evaporated to give crude (4-azido-3,5-difluorophenyl)(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int-300n). MS (ESI) [M+H].sup.+: m/z 564.

Step O: (4-amino-3,5-difluorophenyl)(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int-3000)

[0832] A mixture of (4-azido-3,5-difluorophenyl)(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (156 mg, 0.277 mmol) and wet Pd/C (58.9 mg, 0.055 mmol, 10%) in EtOAc (10 mL) and MeOH (2 mL) was stirred at 25? C. for 1 h under 15 psi of H.sub.2. The mixture was filtered and the solvent was evaporated under reduced pressure to give the crude product. The crude product was purified by flash silica gel chromatography (Silica Flash Column, Eluent of 0?50% EtOAc/Pet. ether gradient) to give (4-amino-3,5-difluorophenyl)(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int-3000). MS (ESI) [M+H].sup.+: m/z 538.

Step P: (4-amino-3,5-difluorophenyl)(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int-300p)

[0833] (4-amino-3,5-difluorophenyl)(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int-3000) (120 mg, 0.223 mmol) was separated by SFC (Column: DAICEL CHIRALPAK IG (250 mm*30 mm, 10 um), Condition: 0.1% NH.sub.3H.sub.2O/IPA, Mobile phase: A: CO.sub.2 B: IPA (0.1% NH.sub.3H.sub.2O)) to give (4-amino-3,5-difluorophenyl)(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int-300p-1, the first eluting isomer from SFC), (4-amino-3,5-difluorophenyl)(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (Int-300p-2, the second eluting isomer from SFC). MS (EST) [M+H].sup.+: m/z 538.

Step Q: (E)-4-bromo-N-(4-(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (Int-300q)

[0834] To a solution of (4-amino-3,5-difluorophenyl)(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizin-2-yl)methanone (40 mg, 0.074 mmol) (Int-300p-1) and (E)-4-bromobut-2-enoic acid (18. mg, 0.11 mmol) in CH.sub.2Cl.sub.2 (2 mL) was added 2,4,6-tripropyl-1,3,5,2,4,6-trioxatriphosphinane 2,4,6-trioxide (237 mg, 0.372 mmol, 50% in EtOAc) and N-ethyl-N-isopropylpropan-2-amine (0.078 mL, 0.44 mmol) at 25? C. The mixture was stirred at 25? C. for 1 h. The mixture was quenched with sat. aq. NaHCO.sub.3 (2 mL), extracted with DCM (3?2 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give (E)-4-bromo-N-(4-(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (Int-300q). MS (ESI) [M+H].sup.+: m/z 684.0, 686.0.

Step R: (E)-N-(4-(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide (Ex. 300)

[0835] To a solution of (E)-4-bromo-N-(4-(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)but-2-enamide (Int-300q) (50. mg, 0.073 mmol), 1-methylcyclopropan-1-amine, HCl (24 mg, 0.22 mmol) in DMSO (1 mL) was added N-ethyl-N-isopropylpropan-2-amine (0.077 mL, 0.44 mmol) and potassium iodide (61 mg, 0.37 mmol) at 25? C. The mixture was stirred at 40? C. for 1 h. The mixture was cooled, diluted with water (2 mL), extracted with DCM (3?2 mL), dried over Na.sub.2SO.sub.4, filtered and the solvent was evaporated under reduced pressure to give the crude product. The residue was purified by reverse preparative HPLC (Column: Welch Xtimate C18 150*25 mm*5 um; Condition: water (0.01% TFA)-ACN; Begin B-End B: 22-52; Gradient Time (min): 11; 100% B Hold Time (min): 2; FlowRate (mL/min): 25) to give (E)-N-(4-(7-(difluoromethoxy)-9,10,12-trimethyl-9,12,13,14-tetrahydroimidazo[4,5:5,6]benzo[1,2:2,3]azocino[4,5,6-hi]indolizine-2-carbonyl)-2,6-difluorophenyl)-4-((1-methylcyclopropyl)amino)but-2-enamide (Ex. 300). MS (ESI) [M+H].sup.+: m/z 675 .sup.1H NMR (400 MHz, MeOD) ? 10.02 (d, J=6.8 Hz, 1H), 7.75 (s, 1H), 7.50-7.52 (m, 2H), 7.36-7.39 (m, 1H), 7.20-7.22 (m, 1H), 6.93-6.98 (m, 1H), 6.62-6.80 (m, 3H), 4.00-4.06 (m, 2H), 3.60 (s, 3H), 3.58-3.60 (m, 1H), 3.02-3.09 (m, 4H), 2.87 (s, 3H), 2.77-2.80 (m, 1H), 2.47-2.48 (m, 1H), 1.33 (s, 3H), 1.10-1.14 (m, 2H), 0.87-0.91 (m, 2H).

Synthesis of 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-amine

Step 1:

[0836] ##STR00344##

[0837] Methylamine (2M THF solution, 108 mL) was added to 2-fluoro-1-nitro-4-(trifluoromethyl)benzene (15.0 g) in THF (15 mL), and the reaction mixture was stirred at room temperature overnight. After dilution with ethyl acetate, the mixture was washed with water and a saturated sodium chloride solution and dried over sodium sulfate, filtered, concentrated, thereby obtaining N-methyl-2-nitro-5-(trifluoromethyl)aniline (15.6 g).

Step 2:

[0838] ##STR00345##

[0839] N-Bromosuccinimide (13.9 g) was added to N-methyl-2-nitro-5-(trifluoromethyl)aniline (15.6 g) obtained in step 1 in DMA (10 mL). After stirring at 50? C. for 1 hour, sodium thiosulfate and water (150 mL) was added to the reaction mixture. The resulting precipitate was collected by filtration, thereby obtaining 4-bromo-N-methyl-2-nitro-5-(trifluoromethyl)aniline (20.6 g).

Step 3:

[0840] ##STR00346##

[0841] A solution of 4-bromo-N-methyl-2-nitro-5-(trifluoromethyl)aniline (7.0 g) obtained in step 2, iron powder (6.54 g), and ammonium chloride (6.26 g) in methanol (30 mL), THF (30 mL) and water (7 mL) was stirred at 60? C. for 2 hours. The insoluble matter was filtered off, followed by evaporating the solvent under reduced pressure. After dilution with ethyl acetate, the mixture was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography on silica (hexane:acetone), thereby obtaining 4-bromo-N1-methyl-5-(trifluoromethyl)benzene-1,2-diamine.

Step 4:

[0842] ##STR00347##

[0843] T3P in THF (1.6 M, 18 mL) was added to a solution of 4-bromo-N1-methyl-5-(trifluoromethyl)benzene-1,2-diamine (3.51 g) obtained in step 3 and 2-methoxyacetic acid (1.1 mL) in DMF (10 mL). After stirring at room temperature for 15 minutes, triethylamine (7.2 mL) was added to the reaction mixture, followed by stirring at room temperature for 2 hours. After dilution with ethyl acetate, the mixture was washed with saturated sodium bicarbonate, water and a saturated sodium chloride solution, followed by drying over sodium sulfate. After the solvent was evaporated under reduced pressure, acetic acid was added to the residue, followed by stirring at 50? C. for 2 hours. After dilution with ethyl acetate, the organic layer was washed with a saturated sodium bicarbonate solution and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (hexane:acetone), thereby obtaining 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole.

Step 5:

[0844] ##STR00348##

[0845] Potassium nitrate (1.31 g) was added to 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazole (2.79 g) obtained in step 4 in sulfuric acid (10 mL) at 0? C. After stirring at room temperature overnight, the reaction mixture was carefully poured into the crushed ice and 30% ammonia solution and saturated sodium bicarbonate was added. The resulting precipitate was collected by filtration, there by obtaining 5-bromo-2-(methoxymethyl)-1-methyl-4-nitro-6-(trifluoromethyl)-1H-benzo[d]imidazole.

Step 6:

[0846] ##STR00349##

[0847] A solution of 5-bromo-2-(methoxymethyl)-1-methyl-4-nitro-6-(trifluoromethyl)-1H-benzo[d]imidazole (3.09 g) obtained in step 5, iron powder (2.34 g), and ammonium chloride (2.24 g) in ethanol (42 mL), THF (18 mL) and water (12 mL) was stirred at 60? C. for 2 hours. The insoluble matter was filtered off, followed by evaporating the solvent under reduced pressure. After dilution with ethyl acetate, the mixture was washed with water and a saturated sodium chloride solution, followed by drying over sodium sulfate. After evaporation, the obtained residue was purified by column chromatography (hexane:acetone), thereby obtaining 5-bromo-2-(methoxymethyl)-1-methyl-6-(trifluoromethyl)-1H-benzo[d]imidazol-4-amine (2.50 g).

[0848] Other Examples were prepared using the synthetic procedures A to EE and purification notes as shown in the table below. In some instances, the compounds presented in the Examples (including the tables) were isolated and are represented as salts, e.g., trifluoroacetate salts such as Ex. 260. One of ordinary skill in the art will appreciate that, depending on the isolation conditions, the un-ionized form of the compound could be isolated, or a salt form having a counterion other than trifluoroacetate could be isolated. Such un-ionized forms of the compound and alternative salt forms of the compound are within the scope of the present disclosure. Such un-ionized forms of the compound include, without limitation:

##STR00350## ##STR00351## ##STR00352## ##STR00353## ##STR00354## ##STR00355## ##STR00356## ##STR00357## ##STR00358##

TABLE-US-00002 ES-MS Synthetic [M + Example Compound name Compound Structure procedure Purification notes 1H NMR H].sup.+ 51 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)-2,6- difluorophenyl)-4-(oxetan- 3-ylamino)but-2-enamide [00359] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (d, J = 6.8 Hz, 1H), 7.65 (s, 1H), 7.46-7.38 (m, 2H), 7.19-7.00 (m, 5H), 6.28 (d, J = 15.5 Hz, 1H), 4.86 (t, J = 6.8 Hz, 2H), 4.73 (dd, J = 10.4, 4.6 Hz, 1H), 4.47 (t, J = 6.3 Hz, 2H), 4.24-4.16 (m, 1H), 4.06-4.00 (m, 1H), 3.84 (s, 3H), 3.45 (dd, J = 5.0, 1.3 Hz, 2H), 2.91-2.79 (m, 1H), 2.70 (s, 3H), 2.57 (dd, J = 15.4, 2.1 Hz, 1H) 666.4 52 (R,E)-N-(4-(9,10-dimeth- yl-7-(trifluoromethyl)-13, 14-dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((3- methyltetrahydrofuran-3- yl)amino)but-2-enamide or (S,E)-N-(4-(9,10- dimethyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6] benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)-2,6-difluoro- phenyl)-4-((3-methyltetra- hydrofuran-3-ylamino)but- 2-enamide [00360] E CHIRALPAK ART SB(YMC)(hexane-ethanol (0.1% triethylamine)), 1.sup.st- eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (d, J = 6.0 Hz, 1H), 7.65 (s, 1H), 7.44 (d, J = 7.8 Hz, 2H), 7.17-7.13 (m, 3H), 7.03 (d, J = 7.3 Hz, 1H), 6.36-6.24 (m, 1H), 4.75-4.72 (m, 1H), 4.24-4.17 (m, 1H), 4.00 (td, J = 8.4, 6.7 Hz, 1H), 3.92-3.86 (m, 1H), 3.85 (s, 3H), 3,76-3.69 (m, 2H), 3.49-3.47 (m, 3H), 2.89-2.81 (m, 1H), 2.70 (s, 3H), 2.60-2.55 (m, 1H), 2.01- 1.95 (m, 1H), 1.87-1.82 (m, 1H), 1.32 (s, 3H) 694.4 53 (E)-N-(4-17-chloro-9,10- dimethyl-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]loxocino- [4,5,6-hi]indolizine-2- carbonyl)-2.6-difluoro- phenyl)-4-(((1r,4r)-4-meth- oxycyclohexyl)amino)but- 2-enamide [00361] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (d, J = 6.8 Hz, 1H), 7.41-7.34 (m, 4H), 7.16- 7.04 (m, 3H), 6.30 (d, J = 15.3 Hz, 1H), 4.78-4.76 (m, 1H), 4.20 (t, J = 11.5 Hz, 1H), 3.75 (s, 3H), 3.53 (d, J = 4.3 Hz, 2H), 3.35 (s, 3H), 3.15 (d, J = 5.5 Hz, 1H), 3.00-2.92 (m, 1H), 2.64-2.57 (m, 5H), 2.18-1.85 (m, 4H), 1.30- 1.15 (m, 4H) 688.3 54 (E)-N-(2,6-difluoro-4- (8,9,11-trimethyl-6-(tri- fluoromethyl)-8,11,12,13- tetrahydroimidazo[4,5: 5,6]benzo[1,2:5,6][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)phenyl)-4-((3- methyloxetan-3-ylamino)- but-2-enamide [00362] G CHIRALPAK ART SB(YMC)(hexane-ethanol (0.1% triethylamine)), 1st- eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.45 (d, J = 7.0 Hz, 1H), 7.70 (s, 1H), 7.49 (dd, J = 13.1, 7.9 Hz, 3H), 7.36-7.31 (m, 1H), 7.15 (td, J = 10.1. 5.2 Hz, 2H), 6.31 (d, J = 15.3 Hz, 1H), 4.58 (d, J = 6.3 Hz, 2H), 4.44 (d, J = 6.3 Hz, 2H), 3.96-3.88 (m, 1H), 3.83 (s, 3H), 3.68-3.62 (m, 1H), 3.54 (dd, J = 5.0, 1.8 Hz, 2H), 3.39 (d, J = 11.0 Hz, 1H), 3.18-3.09 (m, 4H), 2.68 (s, 3H), 1.51 (s, 3H) 693.4 55 (E)-N-(2,6-difluoro-4- (8,9,11-trimethyl-6-(tri- fluoromethyl)-8,11,12,13- tetrahydroimidazo[4,5: 5,6]benzo[1,2:5,6][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)phenyl)-4- (((1r,4r)-4-methoxycyclo- hexyl)amino)but-2-en- amide [00363] G CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.45 (dd, J = 8.0, 1.0 Hz, 1H), 7.70 (s, 1H), 7.52-7.46 (m, 3H), 7.36-7.30 (m, 1H), 7.16- 7.09 (m, 2H), 6.24 (d, J = 15.5 Hz, 1H), 3.95-3.88 (m, 2H), 3.83 (s, 3H), 3.52 (dd, J = 5.3, 1.8 Hz, 2H), 3.40-3.36 (m, 4H), 3.18- 3.09 (m, 5H), 2.68 (s, 3H), 2.56- 2.51 (m, 1H), 2.10-1.97 (m, 4H), 1.31-1.17 (m, 4H) 735.5 56 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo[4,5: 5,6]benzo[1,2:2,3]oxo- cino[4,5,6-hi]indolizine-2- carbonyl)-2,6-difluoro- phenyl)-4-((1-fluoro-2- methylpropan-2-ylamino)- but-2-enamide [00364] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.00, 0.94 Hz, 1H), 7.65 (s, 1H), 7.41 (d, J = 7.83 Hz, 2H), 7.23-7.20 (brs, 1H), 7.17-7.11 (m, 3H), 7.03 (t, J = 7.09 Hz, 1H), 6.33 (d, J = 15.34 Hz, 1H), 4.75-4.71 (m, 1H), 4.23 (d, J = 47.76 Hz, 2H), 4.23-4.17 (m, 1H), 3.84 (s, 3H), 3.47-3.46 (m, 2H), 2.88-2.80 (m, 1H), 2.70 (s, 3H), 2.59-2.55 (m, 1H), 1.14 (s, 3H), 1.14 (s, 3H) 684.3 57 (E)-N-(2,6-difluoro-4- (7,9,10,12-tetramethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((4-methyltetra- hydro-2H-pyran-4-yl)- amino)but-2-enamide [00365] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (d, J = 5.8 Hz, 1H), 7.44 (s, 1H), 7.42 (s, 1H), 7.17-7.10 (m, 3H), 7.02-7.00 (m, 3H), 6.33 (d, J = 15.3 Hz, 1H), 3.85-3.82 (m, 2H), 3.72 (s, 3H), 3.64-3.61 (m, 2H), 3.50 (d, J = 9.3 Hz, 1H), 3.43 (s, 2H), 3.08 (s, 3H), 2.88-2.82 (m, 1H), 2.63 (s, 3H), 2.53 (d, J = 13.8 Hz, 1H), 2.36-2.36 (m, 1H), 2.36 (s, 3H), 1.58-1.42 (m, 4H), 1.18 (s, 3H) 667.1 58 (E)-N-(2,6-difluoro-4- (1,9,10-trimethyl-7-(tri- fluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)-4-((3-methyl- oxetan-3-yl)amino)but- 2-enamide [00366] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.77 (d, J = 7.0 Hz, 1H), 7,64 (s, 1H), 7.29-7.22 (m, 2H), 7.17-7.06 (m, 2H), 6.90 (t, J = 7.1 Hz, 1H), 6.33 (d, J = 15.3 Hz, 1H), 4.63 (dd, J = 10.4, 4.1 Hz, 1H), 4.58 (d, J = 6.3 Hz, 2H), 4.43 (d, J = 6.3 Hz, 2H), 4.15- 4.08 (m, 1H), 3.84 (s, 3H), 3.53 (dd, J = 5.0, 1,5 Hz, 2H), 2.75- 2.67 (m, 4H), 2.55 (d, J = 15.5 Hz, 1H), 1.91 (s, 3H), 1.52 (s, 3H) 694.0 59 (E)-N-(6-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- pyridin-3-yl)-4-(((1r,4r)- 4-methoxycyclohexyl)- amino)but-2-enamide [00367] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.15 (d, J = 6.0 Hz, 1H), 8.75 (d, J = 2.5 Hz, 1H), 8.32 (dd, J = 8.5, 2.5 Hz, 1H), 8.11 (d, J = 8.5 Hz, 1H), 7.91 (s, 1H), 7.63 (s, 1H), 7.13-7.09 (m, 2H), 7.01-6.98 (m, 1H), 6.20 (d, J = 15.5 Hz, 1H), 4.72 (dd, J = 10.5, 4.3 Hz, 1H), 4.28-4.23 (m, 1H), 3.83 (s, 3H), 3.53 (d, J = 5.3 Hz, 2H), 3.35 (s, 3H), 3.16 (d, J = 10.0 Hz, 1H), 2.92-2.80 (1H), 2.70 (s, 3H), 2.65-2.55 (m, 2H), 2.10-2.01 (m, 4H), 1.30-1.14 (m, 4H) 687.0 60 (E)-N-(6-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- pyridin-3-yl)-4-((3-meth- yloxetan-3-yl)amino)but- 2-enamide [00368] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.16 (dd, J = 7.0, 1.0 Hz, 1H), 8.75 (d, J = 2.0 Hz, 1H), 8.32 (dd, J = 8.5, 2.5 Hz, 1H), 8.12 (d, J = 8.8 Hz, 1H), 7.92 (s, 1H), 7.64 (s, 1H), 7.15 (td, J = 10.1, 5.1 Hz, 2H), 7.01- 6.98 (m, 1H), 6.27 (dd, J = 13.3, 2.0 Hz, 1H), 4.72 (dd, J = 10.5, 4.3 Hz, 1H), 4.57 (d, J = 6.3 Hz, 2H), 4.44 (d, J = 6.5 Hz, 2H), 4.31-4.22 (m, 1H), 3.83 (s, 3H), 3.54 (dd, J = 5.0, 1.8 Hz, 2H), 2.90-2.82 (m, 1H), 2.70 (s, 3H), 2.65-2.60 (m, 1H), 1.51 (d, J = 4.0 Hz, 3H) 644.9 61 (E)-N-(4-(8,11-dimethyl- 6-(trifluoromethyl)- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)-2,6-difluorophenyl)- 4-((3-methyloxetan-3-yl)- amino)but-2-enamide [00369] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.46 (dd, J = 8.00, 1.12 Hz, 1H), 8.02 (s, 1H), 7.83 (s, 1H), 7.51 (s, 1H), 7.45 (d, J = 7.83 Hz, 2H), 7.35 (t, J = 7.71 Hz, 1H), 7.82-7.12 (m, 3H), 6.34 (dt, J = 15.28, 1.72 Hz, 1H), 4.59 (d, J = 6.25 Hz, 2H), 4.44 (d, J = 6.51 Hz, 2H), 3.97 (s, 3H), 3.97- 3.92 (m, 2H), 3.55-3.53 (m, 2H), 3.39-3.36 (m, 1H), 3.21-3.14 (m, 1H), 3.12 (s, 3H), 1.52 (s, 3H) 679.4 62 (E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-(((1r,4r)-4- methoxycyclohexyl- amino)but-2-enamide [00370] G CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 8.0, 1.0 Hz, 1H), 7.50 (s, 1H), 7.46- 7.40 (m, 2H), 7.34 (dd, J = 7.8, 7.8 Hz, 1H), 7.18-7.08 (m, 4H), 6.27 (dt, J = 15.3, 1.6 Hz, 1H), 4.04-3.94 (m, 1H), 3.86 (dd, J = 14.6, 2.6 Hz, 1H), 3.73 (s, 3H), 3.51 (dd, J = 5.3. 1.8 Hz, 2H), 3.47-3.41 (m, 1H), 3.35 (s, 3H), 3.20-3.05 (m, 5H), 2.62 (s, 3H), 2.58-2.50 (m, 1H), 2.40 (s, 3H), 2.13-1.94 (m, 4H), 1.34-1.07 (m, 4H) 681.4 63 (E)-N-(2,6-difluoro-4- (9,10,12-trimethyl-7-(tri- fluoromethyl)-9,12,13,14- tetrahydroimidazo- [4,5:5,6]benzo[1,2: 2,3]azocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)-4-(((1r,4r)-4- methoxycyclohexyl)- amino)but-2-enamide [00371] L CHIRALPAK IA (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.96 (d, J = 6.8 Hz, 1H), 7.67 (s, 1H), 7.43 (d, J = 8.5 Hz, 2H), 7.15-6.97 (m, 4H), 6.26 (d, J = 15.3 Hz, 1H), 3.82 (s, 2H), 3.52 (d, J = 4.5 Hz, 2H), 3.44 (d, J = 9.5 Hz, 1H), 3.35 (s, 3H), 3.15-3.13 (m, 1H), 3.09 (s, 2H), 2.89-2.83 (m, 1H), 2.68 (s, 2H), 2.54 (d, J = 13.0 Hz, 2H), 2.31- 2.24 (m, 1H), 2.10-1.98 (m, 4H), 1.30-0.97 (m, 4H) 735.0 64 (E)-N-(2,6-difluoro-4- (1,9,10-trimethyl-7-(tri- fluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)-4-(((1r,4r)-4- methoxycyclohexyl)- amino)but-2-enamide [00372] E CHIRALART SB (hexane- ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.75 (d, J = 7.0 Hz, 1H), 7.64 (s, 1H), 7.28-7.28 (m, 2H), 7.13-7.06 (m, 2H), 6.90 (t, J = 7.1 Hz, 1H), 6.26 (d, J = 15.5 Hz, 1H), 4.64 (dd, J = 10.4, 4.1 Hz, 1H), 4.14-4.08 (m, 1H), 3.84 (s, 3H), 3.52 (d, J = 4.3 Hz, 2H), 3.35 (s, 3H), 3.17-3.11 (m, 1H), 2.75-2.67 (m, 4H), 2.56-2.53 (m, 2H), 2.04 (dd, J = 36.6, 11.6 Hz, 4H), 1.91 (s, 3H), 1.30-1.12 (m, 4H) 736.0 65 (E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-((3-methyl- oxetan-3-yl)amino)but-2- enamide [00373] G CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, DMSO- D6) ? 8 10.00 (s, 1H), 8.26 (dd, J = 8.0, 1.0 Hz, 1H), 8.12 (s, 1H), 7.61-7.56 (m, 2H), 7.38 (d, J = 0.5 Hz, 1H), 7.27 (dd, J = 7.6, 7.6 Hz, 1H), 7.07 (dd, J = 7.4, 1.1 Hz, 1H), 6.91 (dt, J = 15.5. 5.0 Hz, 1H), 6.38 (dt, J= 15.3, 1.7 Hz, 1H), 4.47 (d, J = 5.8 Hz, 2H), 4.28-4.22 (m, 1H), 4.21 (d, J = 6.0 Hz, 2H), 3.73 (s, 3H), 3.70-3.61 (m, 1H), 3.41- 3.36 (m, 2H), 3.23-3.16 (m, 1H), 3.14-3.05 (m, 1H), 3.00 (s, 3H), 2.54 (s, 3H), 2.33 (s, 3H), 1.40 (s, 3H) 639.4 66 (E)-N-(4-(11-ethyl-6,8,9- trimethyl-8,11,12,13-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:5,6][1,4]diazo- cino[7,8,1-hi]indole-2- carbonyl)-2,6-difluoro- phenyl)-4-(((1r,4r)-4-meth- oxycyclohexyl)amino)but- 2-enamide [00374] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.40 (dd, J = 8.0, 1.3 Hz, 1H), 7.49 (s, 1H), 7.47-7.42 (m, 2H), 7.33 (dd, J = 7.6, 7.6 Hz, 1H), 7.17-7.05 (m, 4H), 6.26 (dt, J = 15.3, 1.8 Hz, 1H), 4.10-3.94 (m, 2H), 3.85 (dd, J = 14.5, 3.0 Hz, 1H), 3.73 (s, 3H), 3.51 (dd, J = 5.3, 1,8 Hz, 2H), 3.49-3.44 (m, 1H), 3.35 (s, 3H), 3.23-3.10 (m, 2H), 2.90-2.80 (m, 1H), 2.61 (s, 3H), 2.58-2.50 (m, 1H), 2.41 (s, 3H), 2.12-1.95 (m, 4H), 1.32- 1.09 (m, 4H), 0.62 (t, J = 7.1 Hz, 3H) 695.5 67 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)-2- fluorophenyl)-4-(((1r,4r)- 4-methoxycyclohexyl)- amino)but-2-enamide [00375] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99-9.97 (m, 1H), 8.55 (t, J = 8.0 Hz, 1H), 7.65-7.63 (m, 2H), 7.60-7.57 (m, 1H), 7.15- 7.07 (m, 3H), 7.00-6.97 (m, 1H), 6.22 (d, J = 15.5 Hz, 1H), 4.73 (dd, J = 10.1, 4.6 Hz, 1H), 4.24- 4.17 (m, 1H), 3.84 (s, 3H), 3.53 (d, J = 4.0 Hz, 2H), 3.35 (s, 3H), 3.18-3.13 (m, 1H), 2.89-2.81 (m, 1H), 2.70 (s, 3H), 2.62-2.54 (m, 2H), 2.17-1.99 (m, 4H), 1.33- 1.12 (m, 4H) 704.9 68 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)-2- fluorophenyl)-4-((3-meth- yloxetan-3-yl)amino)but- 2-enamide [00376] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.56 (t, J = 8.0 Hz, 1H), 7.66-7.63 (m, 2H), 7.54- 7.52 (m, 1H), 7.16-7.10 (m, 3H), 7.01-6.97 (m, 1H), 6.27 (dd, J = 13.3. 2.0 Hz, 1H), 4.73 (dd, J = 10.5, 4.3 Hz, 1H), 4.58 (d, J = 6.3 Hz, 2H), 4.44 (d, J = 6.5 Hz, 2H), 4.24-4.17 (m, 1H), 3.84 (s, 3H), 3.54 (dd, J = 5.0, 1.8 Hz, 2H), 2.90-2.82 (m, 1H), 2.70 (s, 3H), 2.56 (dd, J = 15.4, 2.4 Hz, 1H), 1.51 (d, J = 6.0 Hz, 3H) 662.4 69 (E)-N-(2,6-difluoro-4- (7,9,10,12-tetramethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-(((1r,4r)-4- methoxycyclohexyl)- amino)but-2-enamide [00377] L CHIRALPAK IA (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (d, J = 6.0 Hz, 1H), 7.43 (s, 1H), 7.41 (s, 1H), 7.13-7.09 (m, 4H), 7.03-7.00 (m, 2H), 6.26 (d, J = 15.3 Hz, 1H), 3.72 (s, 3H), 3.52-3.51 (m, 3H), 3.35 (s, 3H), 3.18-3.13 (m, 1H), 3.08 (s, 3H), 2.88-2.82 (m, 1H), 2.63 (s, 3H), 2.57-2.51 (m, 2H), 2.36 (s, 3H), 2.36-2.31 (m, 1H), 2.10-2.07 (m, 2H), 2.01-1.98 (m, 2H), 1.26-1.10 (m, 4H) 681.2 70 (E)-N-(2,6-difluoro-4- (9,10,12-trimethyl-7-(tri- fluoromethyl)-9,12,13,14- tetrahydroimidazo[4,5: 5,6]benzo[1,2:2,3]- azocino[4,5,6-hi]indol- izine-2-carbonyl)phenyl)- 4-((4-methyltetrahydro- 2H-pyran-4-yl)amino)but- 2-enamide [00378] L CHIRALPAK IA (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (d, J = 6.8 Hz, 1H), 7.67 (s, 1H), 7.40 (d, J = 7.5 Hz, 3H), 7.17-7.10 (m, 2H), 7.06 (d, J = 6.8 Hz, 1H), 7.00 (t, J = 6.8 Hz, 1H), 6.37 (d, J = 15.3 Hz, 1H), 3.85-3.75 (m, 5H), 3.63- 3.61 (m, 2H), 3.48-3.43 (m, 3H), 3.09 (s, 3H), 2.89-2.83 (m, 1H), 2.68 (s, 3H), 2.62-2.52 (m, 1H), 2.27 (t, J = 13.1 Hz, 1H), 1.18 (s, 3H) 721.0 72 (E)-N-(4-(11-acetyl-6,8,9- trimethyl-8,11,12,13-tetra- hydroimidazo[4,5: 5,6]benzo[1,2:2,3][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)-2,6-difluoro- phenyl)-4-(((1r,4r)-4- methoxycyclohexyl)- amino)but-2-enamide [00379] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (d, J = 7.8 Hz, 1H), 7.68 (brs, 1H), 7.47-7.30 (m, 4H), 7.18-7.06 (m, 2H), 6.54-6.38 (m, 1H), 4.96-4.89 (m, 1H), 4.19-3.92 (m, 2H), 3.79 (s, 3H), 3.62 (brs, 2H), 3.35-3.24 (m, 4H), 3.19-3.09 (brm, 1H), 2.77 (brs, 1H), 2.63 (s, 3H), 2.48 (s, 3H), 2.15-2.02 (m, 4H), 1.50 (s, 3H), 1.39-1.17 (m, 4H) 709.6 73 (E)-4-((2-oxabicyclo- [2.2.2]octan-4-yl)amino)- N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]- benzo[1,2:5,6][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)phenyl)but- 2-enamide [00380] G 1H-NMR (400 MHz, DMSO- D6) ? 9.98 (s, 1H), 8.25 (dd, J = 7.9, 1.1 Hz, 1H), 8.11 (s, 1H), 7.61-7.54 (m, 2H), 7.38 (s, 1H), 7.27 (dd, J = 7.6, 7.6 Hz, 1H), 7.07 (dd, J = 7.3, 1.0 Hz, 1H), 6.86 (dt, J = 15.4, 4.9 Hz, 1H), 6.34 (d, J = 15.3 Hz, 1H), 4.25 (d, J = 12.5 Hz, 1H), 3.73 (s, 3H), 3.69-3.61 (m, 2H), 3.53 (s, 2H), 3.51-3.46 (m, 1H), 3.43- 3.40 (m, 1H), 3.22-3.16 (m, 1H), 3.14-3.05 (m, 1H), 3.00 (s, 3H), 2.54 (s, 3H), 2.33 (s, 3H), 1.97- 1.50 (m, 8H) 679.4 74 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- (((1r,4r)-4-methoxycyclo- hexyl)amino)but-2-en- amide [00381] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (d, J = 6.3 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.41 (d, J = 8.0 Hz, 2H), 7.14- 7.12 (m, 2H), 7.05 (s, 1H), 7.02- 7.00 (m, 1H), 6.27 (d, J = 15.3 Hz, 1H), 3.96 (s, 3H), 3.51-3.51 (m, 2H), 3.43 (d, J = 9.8 Hz, 1H), 3.35 (s, 3H), 3.15-3.15 (m, 1H), 3.11 (s, 3H), 2.92-2.86 (m, 1H), 2.57-2.54 (m, 2H), 2.31-2.24 (m, 1H), 2.10-2.05 (m, 2H), 2.01- 1.98 (m, 2H), 1.31-1.10 (m, 4H) 721.1 75 (E)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-((3- methyloxetan-3-yl)- amino)but-2-enamide [00382] E CHIRALPAK IC(hexane- ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.00, 1.00 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.44 (d, J = 7.85 Hz, 2H), 7.18-7.12 (m, 3H), 7.03 (t, J = 7.10 Hz, 1H), 6.93-6.1 (brs, 1H), 6.31 (dt, J = 15.28, 1.76 Hz, 1H), 4.78-4.75 (m, 1H), 4.58 (d, J = 6.26 Hz, 2H), 4.43 (d, J = 6.50 Hz, 2H), 4.26-4.19 (m, 1H), 3.97 (s, 3H), 3.54-3.53 (m, 2H), 2.89-2.81 (m, 1H), 2.61-2.56 (m, 1H), 1.52 (s, 3H) 666.4 76 (E)-N-(2,6-difluoro-4- (8,9,11-trimethyl-12- oxo-6-(trifluoromethyl)- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-(((1r,4r)-4- methoxycyclohexyl)- amino)but-2-enamide [00383] I 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.50 (d, J = 7.3 Hz, 1H), 7.88 (s, 1H), 7.63 (s, 1H), 7.50-7.44 (m, 2H), 7.39 (dd, J = 7.6, 7.6 Hz, 1H), 7.19-7.03 (m, 3H), 6.24 (d, J = 15.5 Hz, 1H), 4.91 (d, J = 13.0 Hz, 1H), 4.21 (d, J = 13.3 Hz, 1H), 3.88 (s, 3H), 3.51 (dd, J = 5.0, 1.3 Hz, 2H), 3.39 (s, 3H), 3.35 (s, 3H), 3.18- 3.11 (m, 1H), 2.71 (s, 3H), 2.58- 2.51 (m, 1H), 2.13-1.94 (m, 4H), 1.31-1.10 (m, 4H) 749.5 77 (E)-N-(2,6-difluoro-4- (8,9,11-trimethyl-12- oxo-6-(trifluoromethyl)- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-(13-methyl- oxetan-3-yl)amino)but-2- enamide [00384] I 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.50 (d, J = 7.8 Hz, 1H), 7.88 (s, 1H), 7.63 (s, 1H), 7.49-7.44 (m, 2H), 7.39 (dd, J = 7.6, 7.6 Hz, 1H), 7.19-7.09 (m, 3H), 6.30 (d, J = 15.3 Hz, 1H), 4.91 (d, J = 13.0 Hz, 1H), 4.58 (d, J = 6.3 Hz, 2H), 4.43 (d, J = 6.3 Hz, 2H), 4.21 (d, J = 13.0 Hz, 1H), 3.88 (s, 3H), 3,52 (dd, J = 4.9, 1.4 Hz, 2H), 3.39 (s, 3H), 2.71 (s, 3H), 1.51 (s, 3H) 707.4 78 (E)-N-(2,6-difluoro-4- (7-methoxy-9,10,12-tri- methyl-9,12,13,14-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:2,3]azocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4- (((1r,4r)-4-methoxycyclo- hexyl)amino)but-2-en- amide [00385] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (d, J = 6.3 Hz, 1H), 7.37-7.36 (m, 3H), 7.13-7.08 (m, 2H), 7.04-7.03 (m, 1H), 6.78 (s, 1H), 6.29 (d, J = 15.3 Hz, 1H), 4.13-4.11 (m, 1H), 3.79 (s, 3H), 3.73 (s, 3H), 3.51 (s, 3H), 3.35 (s, 3H), 3.15- 3.15 (m, 1H), 3.06 (s, 3H), 2.89- 2.83 (m, 1H), 2.62 (s, 3H), 2.57- 2.54 (m, 2H), 2.48-2.45 (m, 1H), 2.09-2.05 (m, 2H), 2.01-1.98 (m, 2H), 1.25-1.11 (m, 4H) 697.1 79 (E)-4-(tert-butylamino)- N-(2,6-difluoro-4-(7- methoxy-9,10,12-trimeth- yl-9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)but-2-enamide [00386] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8 9.99 (d, J = 6.5 Hz, 1H), 7.42 (s, 1H), 7.40 (s, 1H), 7.23-7.23 (m, 1H), 7.15 (d, J = 15.5 Hz, 1H), 7.09 (s, 1H), 7.02 (t, J = 7.1 Hz, 1H), 6.93 (s, 1H), 6.77 (s, 1H), 6.27 (d, J = 15.3 Hz, 1H), 3.79 (s, 3H), 3.73 (s, 3H), 3.52 (d, J = 9.5 Hz, 1H), 3.45 (s, 2H), 3.06 (s, 3H), 2.87 (t, J = 11.1 Hz, 1H), 2.62 (s, 3H), 2.58-2.54 (m, 1H), 2.49-2.46 (m, 1H), 1.16 (s, 9H) 641.0 80 (E)-N-(2,6-difluoro-4-(8- methyl-6-(trifluorometh- yl)-12,13-dihydro-8H- imidazo[4,5:3,4]benzo- [1,2:7,8][1,4]oxazocino- [6,5,4-hi]indole-2-carbon- yl)phenyl)-4-((3-methyl- oxetan-3-yl)amino)but-2- enamide [00387] B 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.50 (dd, J = 8.00, 1.20 Hz, 1H), 8.04 (s, 1H), 7.82 (s, 1H), 7.55 (s, 1H), 7.53-7.37 (m, 4H), 7.29-7.27 (m, 1H), 7.13 (dt, J = 15.28, 5.04 Hz, 1H), 6.36 (dt, J = 15.32, 1.72 Hz, 1H), 4.58- 4.42 (m, 7H), 3.98 (s, 3H), 3.93- 3.90 (m, 1H), 3.53-3.51 (m, 2H), 1.51 (s, 3H) 666.4 81 (E)-N-(4-(8,11-dimethyl- 6-(trifluoromethyl)- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)-2,6-difluorophenyl)- 4-((1-fluoro-2-methyl- propan-2-yl)amino)but-2- enamide [00388] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.47 (dd, J = 7.96, 0.80 Hz, 1H), 8.02 (s, 1H), 7.83 (s, 1H), 7.56-7.50 (m, 1H), 7.52 (s, 1H), 7.41 (d, J = 7.75 Hz, 2H), 7.35 (t, J = 7.70 Hz, 1H), 7.18- 7.11 (m, 2H), 6.38 (d, J = 15.35 Hz, 1H), 4.24 (d, J = 47.75 Hz, 2H), 3.96 (s, 3H), 3.96-3.92 (m, 2H), 3.48-3.47 (m, 2H), 3.38-3.36 (m, 1H), 3.21-3.14 (m, 1H), 3.11 (s, 3H), 1.15 (s, 3H), 1.15 (s, 3H) 683.5 82 (E)-N-(2,6-difluoro-4- (8,9,11-trimethyl-6- (trifluoromethyl)- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-((1-fluoro-2- methylpropan-2-yl)- amino)but-2-enamide [00389] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.45 (dd, J = 8.0, 1.0 Hz, 1H), 7.70 (s, 1H), 7.52- 7.46 (m, 3H), 7.36-7.31 (m, 1H), 7.18-7.11 (m, 2H), 6.31 (d, J = 15.5 Hz, 1H), 4.29 (s, 1H), 4.17 (s, 1H), 3.95-3.91 (m, 2H), 3.83 (s, 3H), 3.47 (d, J = 3.5 Hz, 1H), 3.39 (d, J = 11.0 Hz, 1H), 3.09 (s, 3H), 2.65 (d, J = 24.0 Hz, 5H), 1.15 (d, J = 1.8 Hz, 6H) 697.3 83 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((3- methyloxetan-3-ylamino)- but-2-enamide [00390] L CHIRALPAK IA (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (d, J = 6.0 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.41-7.37 (m, 3H), 7.17-7.12 (m, 2H), 7.06 (s, 1H), 7.02-7.01 (m, 1H), 6.35 (d, J = 15.3 Hz, 1H), 4.58-4.58 (m, 2H), 4.44-4.44 (m, 2H), 3.96 (s, 3H), 3.53 (s, 2H), 3.44 (d, J = 9.8 Hz, 1H), 3.11 (s, 3H), 2.89 (t, J = 11.5 Hz, 1H), 2.55 (d, J = 14.5 Hz, 1H), 2.28 (t, J = 13.8 Hz, 1H), 1.52 (s, 3H) 679.0 84 (E)-4-((2-oxaspiro[3.3]- heptan-6-yl)amino)-N- (2,6-difluoro-4-(6,8,9,11- tetramethyl-8,11,12,13- tetrahydroimidazo[4,5: 5,6]benzo[1,2:5,6]- [1,4]diazocino[7,8,1-hi]- indole-2-carbonyl)phenyl) but-2-enamide [00391] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 7.9, 1.1 Hz, 1H), 7.50 (s, 1H), 7.43- 7.33 (m, 4H), 7.16 (s, 1H), 7.14 (dd, J = 7.3. 1.0 Hz, 1H), 7.07 (dt, J = 15.3, 5.3 Hz, 1H), 6.27 (dt, J = 15.3, 1.8 Hz, 1H), 4.71 (s, 2H), 4.62 (s, 2H), 4.06-3.92 (m, 1H), 3.86 (dd, J = 14.6, 2.6 Hz, 1H), 3.73 (s, 3H), 3.44 (d, J = 11.0 Hz, 1H), 3.39 (dd, J = 5.3, 1.8 Hz, 2H), 3.23-3.07 (m, 5H), 2.65-2.55 (m, 5H), 2.40 (s, 3H), 1.95-1.88 (m, 2H) 665.5 85 (E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-(2-methyl-3- oxobutan-2-ylamino)but- 2-enamide [00392] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 7.9, 1.1 Hz, 1H), 7.50 (s, 1H), 7.48- 7.43 (m, 2H), 7.34 (dd, J = 7.6, 7.6 Hz, 1H), 7.16 (s, 1H), 7.14- 7.07 (m, 2H), 7.00 (s, 1H), 6.31 (dt, J = 15.3, 1.8 Hz, 1H), 4.04- 3.93 (m, 1H), 3.87 (dd, J = 14.6, 2.6 Hz, 1H), 3.73 (s, 3H), 3.47- 3.41 (m, 1H), 3.32 (dd, J = 5.0, 2.0 Hz, 2H), 3.19-3.10 (m, 1H), 3.09 (s, 3H), 2.62 (s, 3H), 2.41 (s, 3H), 2.22 (s, 3H), 1.31 (s, 6H) 653.4 86 (E)-4-((1-acetyl-4-methyl- piperidin-4-yl)amino)-N- (4-(9,12-dimethyl-7- (trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)but-2- enamide [00393] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.96 (dd, J = 6.9, 1.1 Hz, 1H), 8.02 (s, 1H), 7.80 (s, 1H), 7.43 (s, 1H), 7.41 (s, 1H), 7.33 (s, 1H), 7.17-7.11 (m, 2H), 7.06-7.04 (m, 1H), 6.99 (t, J = 7.0 Hz, 1H), 6.35 (d, J = 15.3 Hz, 1H), 3.95 (s, 3H), 3.90-3.83 (m, 1H), 3.58-3.51 (m, 1H), 3.46- 3.38 (m, 5H), 3.10 (s, 3H), 2.92- 2.85 (m, 1H), 2.57-2.53 (m, 1H), 2.31-2.23 (m, 1H), 2.08 (s, 3H), 1.61-1.35 (m, 4H), 1.16 (s, 3H) 748.3 87 (S,E)-N-(2,6-difluoro-4- (8,9,11-trimethyl-6- (trifluoromethyl)- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00394] G CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.45 (dd, J = 8.0, 1.3 Hz, 1H), 7.70 (s, 1H), 7.52-7.46 (m, 3H), 7.36-7.31 (m, 2H), 7.13 (td, J = 10.1, 4.9 Hz, 1H), 6.27 (d, J = 15.3 Hz, 1H), 3.99-3.90 (m, 3H), 3.85-3.77 (m, 5H), 3.66- 3.62 (m, 1H), 3.50-3.45 (m, 3H), 3.39 (d, J = 11.0 Hz, 1H), 3.15- 3.09 (m, 4H), 2.68 (s, 3H), 2.17- 2.03 (m, 1H), 1.79-1.72 (m, 1H) 693.4 88 (E)-4-(((1r,4r)-4-methoxy- cyclohexyl)amino)-N- (6-(8,9,11-trimethyl-6- (trifluoromethyl)- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)pyridin-3-yl)but-2- enamide [00395] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.85 (s, 1H), 8.59 (d, J = 8.0 Hz, 1H), 8.24-8.15 (m, 2H), 7.68 (s, 1H), 7.36-7.28 (m, 2H), 7.09 (t, J = 7.4 Hz, 2H), 6.21-6.42 (1H), 3.99-3.92 (m, 2H), 3.82 (s, 3H), 3.66-3.58 (m, 2H), 3.39-3.30 (m, 4H), 3.18- 3.06 (m, 5H), 2.69-2.62 (m, 4H), 2.12-2.04 (m, 4H), 1.25-1.12 (m, 4H) 700.5 89 (S,E)-N-(4-(9,12-dimeth- yl-7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbon- yl)-2,6-difluorophenyl)- 4-((tetrahydrofuran-3-yl)- amino)but-2-enamide [00396] I CHIRALPAK IA (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.81 (s, 1H), 7.63-7.52 (m, 1H), 7.40 (s, 1H), 7.38 (s, 1H), 7.15-7.06 (m, 3H), 7.03-7.00 (m, 1H), 6.34 (d, J = 15.0 Hz, 1H), 4.00-3.93 (m, 1H), 3.95 (s, 3H), 3.86-3.77 (m, 2H), 3.64 (dd, J = 9.0, 3.8 Hz, 1H), 3.54-3.42 (m, 4H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.55 (dd, J = 14.8, 1.8 Hz, 1H), 2.27 (td, J = 14.0, 4.2 Hz, 1H), 2.18- 2.10 (m, 1H), 1.80-1.73 (m, 1H) 679.3 91 (E)-N-(4-(8,9-dimethyl- 6-(trifluoromethyl)-12,13- dihydro-8H-imidazo- [4,5:3,4]benzo[1,2: 7,8][1,4]oxazocino[6,5,4- hi]indole-2-carbonyl)-2,6- difluorophenyl)-4-((3- methyloxetan-3-ylamino)- but-2-enamide [00397] B 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.48 (dd, J = 7.96, 1.12 Hz, 1H), 7.88 (s, 1H), 7.69 (s, 1H), 7.55 (s, 1H), 7.39-7.36 (m, 3H), 7.28-7.24 (m, 1H), 7.11 (dt, J = 15.32, 5.08 Hz, 1H), 6.38 (dt, J = 15.32, 1.60 Hz, 1H), 4.57-4.40 (m, 7H), 3.92-3.3.89 (m, 1H), 3.84 (s, 3H), 3.51-3.49 (m, 2H), 2.68 (s, 3H), 1.50 (s, 3H) 680.5 93 (E)-N-(2,6-difluoro-4- (7-methoxy-9,10,12- trimethyl-9,12,13,14- tetrahydroimidazo[4,5: 5,6]benzo[1,2:2,3]- azocino[4,5,6-hi]indol- izine-2-carbonyl)phenyl)- 4-((1-fluoro-2-methyl- propan-2-ylamino)but-2- enamide [00398] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 6.9, 1.1 Hz, 1H), 7.41 (s, 1H), 7.39 (s, 1H), 7.25 (dd, J = 7.1, 1.1 Hz, 1H), 7.14 (dt, J = 15.3, 5.0 Hz, 1H), 7.09 (s, 1H), 7.04-7.00 (m, 2H), 6.78 (s, 1H), 6.30 (d, J = 15.3 Hz, 1H), 4.23 (d, J = 47.8 Hz, 2H), 3.79 (s, 3H), 3.73 (s, 3H), 3.54-3.50 (m, 1H), 3.46 (dd, J = 5.0, 1.8 Hz, 2H), 3.06 (s, 3H), 2.90-2.83 (m, 1H), 2.62 (s, 3H), 2.58-2.54 (m, 1H), 2.49- 2.45 (m, 1H), 1.14 (s, 3H), 1.14 (s, 3H) 659.4 94 (E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]- benzo[1,2:5,6][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)phenyl)-4- ((2-(dimethylamino)-2- oxoethyl)amino)but-2- enamide [00399] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.40 (dd, J = 8.0, 1.3 Hz, 1H), 7.51 (s, 1H), 7.48- 7.42 (m, 2H), 7.34 (dd, J = 7.6, 7.6 Hz, 1H), 7.21 (brs, 1H), 7.16 (s, 1H), 7.14-7.05 (m, 2H), 6.33- 6.29 (m, 1H), 4.04-3.94 (m, 1H), 3.87 (dd, J = 14.6, 2.6 Hz, 1H), 3.73 (s, 3H), 3.52 (dd, J = 4.9, 1.9 Hz, 2H), 3.47-3.41 (m, 3H), 3.19-3.05 (m, 4H), 2.99 (s, 3H), 2.97 (s, 3H), 2.62 (s, 3H), 2.40 (s, 3H) 654.6 95 (R,E)-N-(2,6-difluoro-4- (8,9,11-trimethyl-6- (trifluoromethyl)- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00400] G CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.45 (dd, J = 8.0, 1.3 Hz, 1H), 7.70 (s, 1H), 7.49 (q, J = 7.5 Hz, 3H), 7.35-7.31 (m, 1H), 7.16-7.09 (m, 2H), 6.28 (d, J = 15.3 Hz, 1H), 3.97- 3.91 (m, 2H), 3.84-3.81 (m, 4H), 3.77-3.73 (m, 1H), 3.68-3.62 (m, 1H), 3.50-3.44 (m, 3H), 3.39 (d, J = 11.0 Hz, 1H), 3.18-3.09 (m, 4H), 2.68 (s, 3H), 2.19-2.04 (m, 1H), 1.87-1.84 (m, 1H), 1.76 (td, J = 13.1, 3.8 Hz, 1H) 693.4 96 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((2- hydroxyethyl)amino)but- 2-enamide [00401] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.45 (s, 1H), 7.43 (s, 1H), 7.14-7.04 (m, 4H), 7.00 (t, J = 7.0 Hz, 1H), 6.27 (d, J = 14.3 Hz, 1H), 3.96 (s, 3H), 3.72-3.70 (m, 2H), 3.53 (dd, J = 5.0, 1.8 Hz, 2H), 3.45-3.42 (m, 1H), 2.92-2.89 (m, 1H), 2.87-2.85 (m, 2H), 2.56 (dd, J = 14.9. 1.9 Hz, 1H), 2.31-2.27 (m, 1H) 653.4 97 (E)-N-(2,6-difluoro-4-(9- (methoxymethyl)-8,11- dimethyl-6-(trifluorometh- yl)-8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-((3-methyl- oxetan-3-yl)amino)but-2- enamide [00402] G CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.46 (d, J = 8.0 Hz, 1H), 7.77 (s, 1H), 7.51 (s, 1H), 7.47 (s, 1H), 7.45 (s, 1H), 7.34 (t, J = 7.6 Hz, 1H), 7.17-7.13 (m, 3H), 6.33 (d, J = 15.3 Hz, 1H), 4.80 (d, J = 1.5 Hz, 2H), 4.59 (d, J = 6.3 Hz, 2H), 4.44 (d, J = 6.5 Hz, 2H), 3.95-3.91 (m, 5H), 3.55-3.54 (m, 2H), 3.48 (s, 3H), 3.39 (d, J = 11.0 Hz, 1H), 3.16-3.10 (m, 4H), 1.52 (s, 3H) 723.1 98 (S,E)-N-(2,6-difluoro-4- (10-(methoxymethyl)- 9,12-dimethyl-7-(trifluoro- methyl)-9,12,13,14-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:2,3]azocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4- ((tetrahydrofuran-3-yl)- amino)but-2-enamide [00403] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 7.74 (s, 1H), 7.42 (d, J = 8.0 Hz, 2H), 7.21 (s, 1H), 7.15-7.08 (m, 2H), 7.07-7.05 (m, 1H), 7.00 (t, J = 7.0 Hz, 1H), 6.30 (d, J = 15.3 Hz, 1H), 4.81 (d, J = 1.8 Hz, 2H), 3.99-3.94 (m, 4H), 3.86-3.76 (m, 2H), 3.64 (dd, J = 9.0, 3,5 Hz, 1H), 3.50- 3.43 (m, 7H), 3.10 (s, 3H), 2.90- 2.84 (m, 1H), 2.54 (dd, J = 14.8, 2.0 Hz, 1H), 2.27 (td, J = 14.0, 4.4 Hz, 1H), 2.18-2.08 (m, 1H), 1.80-1.73 (m, 1H) 723.4 99 (E)-N-(2,6-difluoro-4-(10- (methoxymethyl)-9-meth- yl-7-(trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((3-methyl- oxetan-3-yl)amino)-but-2- enamide [00404] E CHIRAL ART SB(hexane- ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.04, 0.96 Hz, 1H), 7.73 (s, 1H), 7.43 (d, J = 7.84 Hz, 2H), 7.18-7.11 (m, 3H), 7.03 (t, J = 7.09 Hz, 2H), 6.31 (dt, J = 15.28, 1.76 Hz, 1H), 4.87 (d, J = 12.84 Hz, 1H), 4.81 (d, J = 12.80 Hz, 1H), 4.76- 4.72 (m, 1H), 4.58 (d, J = 6.27 Hz, 2H), 4.43 (d, J = 6.52 Hz, 2H), 4.26-4.19 (m, 1H), 3.96 (s, 3H), 3.54-3.52 (m, 2H), 3.46 (s, 3H), 2.89-2.80 (m, 1H), 2.60- 2.55 (m, 1H), 1.52 (s, 3H) 710.5 100 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- (((1R,2R)-2-hydroxy- cyclohexyl)amino)but-2- enamide [00405] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.43 (dd, J = 7.9, 2.4 Hz, 3H), 7.26 (s, 3H), 7.15-6.99 (m, 4H), 6.31 (d, J = 15.5 Hz, 1H), 3.95 (s, 3H), 3.66 (ddd, J = 16.9, 4.9, 1.4 Hz, 1H), 3.46-3.40 (m, 2H), 3.28-3.22 (m, 1H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.56 (dd, J = 14.9, 1.9 Hz, 1H), 2.36-2.24 (m, 2H), 2.12-2.03 (m, 2H), 1.75-1.72 (m, 2H), 1.33-1.19 (m, 3H), 1.04-0.90 (m, 1H) 707.3 101 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- (((1S,2S)-2-hydroxycyclo- hexylamino)but-2-enamide [00406] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.8, 1.0 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.80-7.64 (m, 1H), 7.42- 7.39 (m, 2H), 7.15-7.05 (m, 3H), 7.03-6.99 (m, 1H), 6.33 (d, J = 15.3 Hz, 1H), 3.95 (s, 3H), 3.68- 3.63 (m, 1H), 3.45-3.39 (m, 2H), 3.29-3.23 (m, 1H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.56 (dd, J = 14.8, 1.5 Hz, 1H), 2.36-2.21 (m, 2H), 2.12-1.99 (m, 2H), 1.74 (d, J = 6.3 Hz, 2H), 1.36-1.21 (m, 3H), 1.04-0,95 (m, 1H) 707.1 102 (E)-4-(((1r,4r)-4-(diethyl- amino)cyclohexyl)amino)- N-(2,6-difluoro-4-(8,9,11- trimethyl-6-(trifluoro- methyl)-8,11,12,13-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:5,6][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)phenyl)but-2- enamide [00407] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.45 (dd, J = 8.0, 1.0 Hz, 1H), 7.70 (s, 1H), 7.49 (q, J = 7.9 Hz, 3H), 7.33 (t, J = 7.8 Hz, 1H), 7.16-7.09 (m, 2H), 6.24 (d, J = 15.3 Hz, 1H), 3.95- 3.88 (m, 1H), 3.83 (s, 3H), 3.52 (dd, J = 5.1, 1.9 Hz, 2H), 3.39 (d, J = 11.3 Hz, 1H), 3.18-3.09 (m, 4H), 2.68 (s, 3H), 2.62-2.44 (m, 3H), 2.07-1.92 (m, 4H), 1.35- 1.25 (m, 8H), 1.18-1.07 (m, 6H) 776.7 103 (E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-((1-(dimeth- ylamino)-2-methyl-1-oxo- propan-2-ylamino)but-2- enamide [00408] G 1H-NMR (400 MHz, DMSO- D6) ? 10.01 (s, 1H), 8.26 (dd, J = 7.9, 1.1 Hz, 1H), 8.12 (s, 1H), 7.61-7.56 (m, 2H), 7.38 (d, J = 0.5 Hz, 1H), 7.27 (dd, J = 7.6, 7.6 Hz, 1H), 7.07 (dd, J = 7.4, 1.1 Hz, 1H), 6.89 (dt, J = 15.5, 5.1 Hz, 1H), 6.36 (d, J = 15.3 Hz, 1H), 4.25 (brd, J = 12.3 Hz, 1H), 3.73 (s, 3H), 3.70-3.61 (m, 1H), 3.22-3.16 (m, 3H), 3.14-3.06 (m, 1H), 3.00 (s, 3H), 2.54 (s, 3H), 2.33 (s, 3H), 1.29 (s, 6H) 682.6 104 (E)-4-(cyclohexylamino)- N-(2,6-difluoro-4-(7- methoxy-9,10,12-trimeth- yl-9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbon- yl)phenyl)but-2-enamide [00409] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 7.41-7.36 (m, 2H), 7.25 (dd, J = 7.3. 1.0 Hz, 1H), 7.15-7.08 (m, 2H), 7.02 (t, J = 7.1 Hz, 1H), 6.78 (s, 1H), 6.27 (d, J = 15.3 Hz, 1H), 3.79 (s, 3H), 3.73 (s, 3H), 3.53-3.50 (m, 3H), 3.06 (s, 3H), 2.90-2.83 (m, 1H), 2.62 (s, 3H), 2.58-2.45 (m, 3H), 1.95-1.90 (m, 2H), 1.78-1.73 (m, 2H), 1.33-1.06 (m, 6H) 667.3 105 (E)-N-(2,6-difluoro-4-(10- (methoxymethyl)-7,9,12- trimethyl-9,12,13,14-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:2,3]azocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4- (((1r,4r)-4-methoxycyclo- hexyl)amino)but-2-en- amide [00410] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (q, J = 2.8 Hz, 1H), 7.44 (d, J = 7.8 Hz, 2H), 7.20 (s, 1H), 7.15-7.09 (m, 2H), 7.04-6.99 (m, 2H), 6.23 (d, J = 15.3 Hz, 1H), 4.76 (dd, J = 17.3, 12.3 Hz, 2H), 3.84 (s, 3H), 3.51 (m, 3H), 3.45 (s, 3H), 3.36 (s, 3H), 3.18-3.13 (m, 1H), 3.09 (s, 3H), 2.88-2.84 (m, 1H), 2.56- 2.50 (m, 2H), 2.35 (m, 4H), 2.09-1.97 (m, 4H), 1.28-1.22 (m, 4H) 711.6 106 (S,E)-N-(2,6-difluoro-4- (10-(methoxymethyl)- 7,9,12-trimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00411] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 5.6, 2.4 Hz, 1H), 7.44 (d, J = 8.0 Hz, 2H), 7.20 (d, J = 0.5 Hz, 1H), 7.15-7.08 (m, 2H), 7.04-7.00 (m, 2H), 6.27 (d, J =15.3 Hz, 1H), 4.76 (dd, J = 17.4, 12.4 Hz, 2H), 3.96 (dd, J = 14.9. 7.9 Hz, 1H), 3.85-3.77 (m, 5H), 3.68-3.62 (m, 2H), 3.53-3.45 (m, 6H), 3.09 (s, 3H), 2.89-2.83 (m, 1H), 2.54- 2.51 (m, 1H), 2.38-2.29 (m, 4H), 2.18-2.04 (m, 1H), 1.80-1.72 (m, 1H) 669.5 107 (S,E)-N-(2,6-difluoro-4- (7,9,10,12-tetramethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbon- yl)phenyl)((tetrahydro- furan-3-yl)amino)but-2- enamide [00412] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.0, 2.0 Hz, 1H), 7.44-7.40 (m, 2H), 7.15-7.07 (m, 4H), 7.05-6.98 (m, 3H), 6.28 (d, J = 15.3 Hz, 1H), 5.01 (s, 1H), 3.98-3.93 (m, 1H), 3.85-3.79 (m, 2H), 3.72 (s, 3H), 3.63 (dd, J = 9.1, 3.6 Hz, 1H), 3.52-3,44 (m, 4H), 3.08 (s, 3H), 2.88-2.82 (m, 1H), 2.62 (s, 3H), 2.52 (dd, J = 14.5. 2.0 Hz, 1H), 2.38-2.30 (m, 1H), 2.36 (s, 3H), 2.18-2.09 (m, 1H), 1.80-1.72 (m, 1H) 639.4 108 (E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-(2-methyl-4- oxopentan-2-yl)amino)- but-2-enamide [00413] G 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 8.0, 1.3 Hz, 1H), 7.50 (s, 1H), 7.46- 7.40 (m, 2H), 7.34 (dd, J = 7.6, 7.6 Hz, 1H), 7.21 (brs, 1H), 7.17-7.10 (m, 3H), 6.29 (dt, J = 15.3, 1.8 Hz, 1H), 4.04-3.93 (m, 1H), 3.86 (dd, J = 14.6, 2.6 Hz, 1H), 3.73 (s, 3H), 3.47-3.38 (m, 3H), 3.17-3.09 (m, 4H), 2.62 (s, 3H), 2.60 (s, 2H), 2.40 (s, 3H), 2.17 (s, 3H), 1.19 (s, 6H) 667.5 109 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((1- (hydroxymethyl)cyclo- pentyl)amino)but-2- enamide [00414] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 7.0, 1.3 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.47-7.43 (m, 2H), 7.17- 7.11 (m, 2H), 7.06-6.98 (m, 3H), 6.31 (d, J = 15.3 Hz, 1H), 3.96 (s, 3H), 3.45-3.40 (m, 2H), 3.42 (s, 3H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.58-2.54 (m, 1H), 2.32-2.25 (m, 1H), 1.75-1.55 (m, 8H) 707.3 110 (E)-N-(2,6-difluoro-4- (7,9,12-trimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbon- yl)phenyl)-4-(((1r,4r)-4- methoxycyclohexyl)- amino)but-2-enamide [00415] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (q, J = 2.8 Hz, 1H), 7.83 (d, J = 6.5 Hz, 1H), 7.45-7.42 (m, 2H), 7.27-7.25 (m, 1H), 7.15-7.09 (m, 2H), 7.04- 7.00 (m, 2H), 6.24 (d, J = 15.5 Hz, 1H), 3.85 (d, J = 4.5 Hz, 3H), 3.68-3,62 (m, 1H), 3.52-3.48 (m, 3H), 3.35 s, 3H), 3.18-3.10 (m, 4H), 2.91-2.85 (m, 1H), 2.57- 2.52 (m, 2H), 2.38-2.29 (m, 4H), 2.11-1.98 (m, 4H), 1.31-1.20 (m, 4H) 667.5 111 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- (ethylamino)but-2-enamide [00416] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.45-7.41 (m, 2H), 7.15- 7.09 (m, 2H), 7.06-7.04 (m, 1H), 7.00 (t, J = 7.0 Hz, 1H), 6.28 (dt, J = 15.3, 1.7 Hz, 1H), 3.96 (s, 3H), 3.52 (dd, J = 5.3, 1.8 Hz, 2H), 3.45-3.42 (m, 1H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.75 (q, J = 7.2 Hz, 2H), 2.58-2.53 (m, 1H), 2.32-2.24 (m, 1H), 1.17 (t, J = 7.1 Hz, 3H) 637.2 112 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((2- hydroxy-2-methylpropyl)- amino)but-2-enamide [00417] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 6.9, 1.1 Hz, 1H), 8.05 (s, 1H), 7.83 (s, 1H), 7.47 (dt, J = 13.0, 2.4 Hz, 2H), 7.20 (s, 1H), 7.15-7.07 (m, 3H), 7.04-7.01 (m, 1H), 6.32- 6.28 (m, 1H), 3.98 (s, 3H), 3.58 (dd, J = 5.1, 1.6 Hz, 2H), 3.48- 3.44 (m, 1H), 3.13 (s, 3H), 2.95- 2.89 (m, 1H), 2.65 (s, 2H), 2.60- 2.56 (m, 1H), 2.30 (td, J = 14.0, 4.4 Hz, 1H), 1.25 (s, 6H) 681.3 113 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((3- hydroxy-2,2-dimethyl- propyl)amino)but-2- enamide [00418] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 7.0, 1.3 Hz, 1H), 8.02 (s, 1H), 7.80 (s, 1H), 7.61-7.59 (m, 1H), 7.41 (d, J = 8.0 Hz, 2H), 7.12 (s, 1H), 7.10-7.03 (m, 2H), 7.01-6.98 (m, 1H), 6.26 (d, J = 15.5 Hz, 1H), 3.95 (s, 3H), 3.52 (s, 2H), 3.47- 3.41 (m, 3H), 3.10 (s, 3H), 2.92- 2.85 (m, 1H), 2.66 (s, 2H), 2.57- 2.53 (m, 1H), 2.27 (td, J = 14.0, 4.2 Hz, 1H), 0.95 (s, 6H) 695.3 114 (S,E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-(2-(hydroxy- methyl)pyrrolidin-1-yl)- but-2-enamide [00419] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 7.9, 1.1 Hz, 1H), 7.51 (s, 1H), 7.48- 7.43 (m, 2H), 7.35 (dd, J = 7.6, 7.6 Hz, 1H), 7.20-7.04 (m, 4H), 6.26 (dt, J = 15.3, 1.5 Hz, 1H), 4.04-3.94 (m, 1H), 3.90-3.83 (m, 1H), 3.73 (s, 3H), 3.69-3.60 (m, 2H), 3.48-3.40 (m, 2H), 3.25-3.09 (m, 6H), 2.78-2.72 (m, 1H), 2.62 (s, 3H), 2.40-2.32 (m, 4H), 1.99-1.72 (m, 4H) 653.5 115 (E)-N-(2,6-difluoro-4- (7,9,12-trimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbon- yl)phenyl)-4-((1-methyl- cyclopropyl)amino)but-2- enamide [00420] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (q, J = 2.8 Hz, 1H), 7.84 (s, 1H), 7.43 (d, J = 8.0 Hz, 2H), 7.27-7.25 (m, 1H), 7.16- 7.09 (m, 2H), 7.04-7.00 (m, 2H), 6.26 (d, J = 15.3 Hz, 1H), 3.85 (s, 3H), 3.58 (d, J = 3.5 Hz, 2H), 3.49 (dd, J = 10.1, 3.1 Hz, 1H), 3.10 (s, 3H), 2.91-2.85 (m, 1H), 2.54 (d, J = 14.8 Hz, 1H), 2.38- 2.29 (m, 4H), 1.31 (s, 3H), 0.61- 0.59 (m, 2H), 0.42-0.35 (m, 2H) 609.6 116 (E)-N-(2,6-difluoro- 4-(7,9,12-trimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((4-methyltetra- hydro-2H-pyran-4-yl- amino)but-2-enamide [00421] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (q, J = 2.8 Hz, 1H), 7.84 (s, 1H), 7.46-7.43 (m, 2H), 7.27-7.25 (m, 1H), 7.19- 7.11 (m, 2H), 7.04-7.00 (m, 2H), 6.33 (d, J = 15.3 Hz, 1H), 3.87- 3.81 (m, 5H), 3,68-3.59 (m, 2H), 3.51-3.44 (m, 3H), 3.10 (s, 3H), 2.92-2.85 (m, 1H), 2.54 (d, J = 14.8 Hz, 1H), 2.38-2.30 (m, 4H), 1.57-1.55 (m, 4H), 1.19 (s, 3H) 653.5 117 (S,E)-N-(2,6-difluoro- 4-(7,9,12-trimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbon- yl)phenyl)4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00422] L CHIRALPAK IG (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (q, J = 2.8 Hz, 1H), 7.84 (s, 1H), 7.46-7.42 (m, 2H), 7.27-7.25 (m, 1H), 7.15- 7.08 (m, 2H), 7.04-7.02 (m, 2H), 6.27 (d, J = 15.3 Hz, 1H), 3.96 (dd, J = 15.0, 8.0 Hz, 1H), 3.85- 3.77 (m, 5H), 3.66-3.62 (m, 1H), 3.51-3.44 (m, 4H), 3.10 (s, 3H), 2.91-2.85 (m, 1H), 2.54 (dd, J = 14.8, 2.0 Hz, 1H), 2.38-2.30 (m, 4H), 2.18-2.04 (m, 1H), 1.80- 1.72 (m, 1H) 625.5 118 (S,E)-N-(2,6-difluoro-4- (10-(methoxymethyl)-9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00423] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.04, 1.04 Hz, 1H), 7.73 (s, 1H), 7.41 (d, J = 7.80 Hz, 2H), 7.32-7.29 (brs, 1H), 7.17-7.15 (m, 2H), 7.11 (dt, J = 15.32, 5.16 Hz, 1H), 7.03 (t, J = 7.10 Hz, 1H), 6.30 (dt, J = 15.36, 1.64 Hz, 1H), 4.87 (d, J = 12.84 Hz, 1H), 4.81 (d, J = 12.80 Hz, 1H), 4.76-4.72 (m, 1H), 4.25- 4.19 (m, 1H), 3.99-3.92 (m, 1H), 3.96 (s, 3H), 3.85-3.77 (m, 2H), 3.65-3.62 (m, 2H), 3.50-3.46 (m, 2H), 3.46 (s, 3H), 2.88-2.80 (m, 1H), 2.60-2.56 (m, 1H), 2.18- 2.09 (m, 1H), 1.80-1.73 (m, 1H) 710.5 119 (E)-4-((2-oxabicyclo- [2.2.2]octan-4-yl)amino)- N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)but-2-enamide [00424] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 8.0, 1.3 Hz, 1H), 7.50 (s, 1H), 7.45- 7.39 (m, 2H), 7.34 (dd, J = 7.8, 7.8 Hz, 1H), 7.21 (brs, 1H), 7.17- 7.05 (m, 3H), 6.29 (dt, J = 15.3, 1.9 Hz, 1H), 4.04-3.93 (m, 1H), 3.90-3.82 (m, 1H), 3.81-3.77 (m, 1H), 3.73 (s, 3H), 3.70 (brs, 2H), 3.47-3.40 (m, 3H), 3.19-3.07 (m, 4H), 2.62 (s, 3H), 2.40 (s, 3H), 2.16-2.04 (m, 2H), 1.79-1.64 (m, 6H) 679.7 121 (E)-4-((2-oxabicyclo- [2.2.2]octan-4-ylamino)- N-(2,6-difluoro-4-(7- methoxy-9,10,12-trimeth- yl-9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)but-2-enamide [00425] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.3 Hz, 1H), 7.42-7.38 (m, 2H), 7.26-7.24 (m, 1H), 7.12-7.00 (m, 4H), 6.78 (s, 1H), 6.26 (dt, J = 15.2, 1.8 Hz, 1H), 3.80-3.79 (m, 1H), 3.79 (s, 3H), 3.73 (s, 3H), 3.70-3.70 (m, 2H), 3.54-3.50 (m, 1H), 3.43 (dd, J = 5.1, 1.9 Hz, 2H), 3.06 (s, 3H), 2.90-2.83 (m, 1H), 2.62 (s, 3H), 2.58-2.54 (m, 1H), 2.47 (dd, J = 13.5, 4.5 Hz, 1H), 2.13-2.06 (m, 2H), 1.75- 1.65 (m, 6H) 695.5 122 (S,E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-(2-(2- hydroxypropan-2-yl)- pyrrolidin-1-yl)but-2- enamide [00426] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 8.0, 1.0 Hz, 1H), 7.52 (s, 1H), 7.48- 7.45 (m, 2H), 7.34 (dd, J = 7.6, 7.6 Hz, 1H), 7.16-7.05 (m, 4H), 6.29 (dt, J = 15.3, 1.6 Hz, 1H), 4.03-3.95 (m, 1H), 3.88 (dd, J = 14.6, 2.6 Hz, 1H), 3.73-3.68 (m, 4H), 3.46-3.37 (m, 2H), 3.18- 3.08 (m, 5H), 2.70 (dd, J = 8.4, 4.6 Hz, 1H), 2.62 (s, 3H), 2.50- 2.44 (m, 1H), 2.41 (s, 3H), 1.90- 1.73 (m, 4H), 1.20 (s, 3H), 1.15 (s, 3H) 681.7 123 (E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-((2,2-dimeth- yltetrahydrofuran-3-yl)- amino)but-2-enamide [00427] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 8.0, 1.3 Hz, 1H), 7.51 (d, J = 6.8 Hz, 1H), 7.48-7.44 (m, 2H), 7.35 (t, J = 7.6 Hz, 1H), 7.16-7.08 (m, 4H), 6.30 (d, J = 15.3 Hz, 1H), 4.03-3.78 (m, 4H), 3.74 (s, 3H), 3.68-3.43 (m, 3H), 3.18-3.11 (m, 1H), 3.09 (s, 3H), 2.96 (t, J = 7.6 Hz, 1H), 2.62 (s, 3H), 2.41 (s, 3H), 2.35-2.27 (m, 1H), 1.79- 1.70 (m, 1H), 1.29 (s, 3H), 1.17 (s, 3H) 667.6 124 (E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-((5,5-dimeth- yltetrabydrofuran-3-yl)- amino)but-2-enamide [00428] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 7.9, 1.1 Hz, 1H), 7.49 (dd, J = 19.6, 7.6 Hz, 3H), 7.36-7.31 (m, 1H), 7.16-7.07 (m, 3H), 6.28 (d, J = 15.5 Hz, 1H), 4.02-3.96 (m, 2H), 3.87 (dd, J = 14.5, 2.5 Hz, 1H), 3.74 (s, 3H), 3.68-3.62 (m, 1H), 3.54-3.43 (m, 4H), 3.18-3.12 (m, 1H), 3.09 (s, 3H), 2.62 (s, 3H), 2.41 (s, 3H), 2.12-2.04 (m, 1H), 1.62-1.60 (m, 1H), 1.36 (s, 3H), 1.13 (s, 3H) 667.7 125 (E)-4-((2-oxabicyclo- [2.2.2]octan-4-ylamino)- N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)but-2-enamide [00429] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.47-7.40 (m, 2H), 7.20-7.14 (m, 2H), 7.09 (dt, J = 15.3, 5.0 Hz, 1H), 7.03 (dd, J = 7.0, 7.0 Hz, 1H), 6.97 (brs, 1H), 6.26 (dt, J = 15.3, 1.8 Hz, 1H), 4.76 (dd, J = 10.6, 4.4 Hz, 1H), 4.25-4.19 (m, 1H), 4.08-4.15 (0H), 3.97 (s, 3H), 3.82-3.77 (m, 1H), 3.69 (s, 2H), 3.43 (dd, J = 5.1, 1.9 Hz, 2H), 2.88-2.80 (m, 1H), 2.58 (dd, J = 15.5, 2.3 Hz, 1H), 2.17-2.03 (m, 2H), 1.77-1.65 (m, 6H) 706.6 126 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((2- methoxyethyl)amino)but- 2-enamide [00430] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.8, 1.3 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.52-7.41 (m, 2H), 7.14- 7.04 (m, 4H), 7.02-6.98 (m, 1H), 6.27 (dt, J = 15.3, 1.8 Hz, 1H), 3.96 (s, 3H), 3.56-3.51 (m, 4H), 3.45-3.42 (m, 1H), 3.39 (s, 3H), 3.11 (s, 3H), 2.93-2.84 (m, 3H), 2.58-2.54 (m, 1H), 2.35-2.24 (m, 1H) 667.4 127 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((1- (methoxymethyl)cyclo- pentyl)amino)but-2-en- amide [00431] 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.45-7.40 (m, 2H), 7.17- 7.11 (m, 3H), 7.06-7.04 (m, 1H), 7.00 (t, J = 7.0 Hz, 1H), 6.31 (dt, J = 15.3, 1.8 Hz, 1H), 3.95 (s, 3H), 3.45-3.38 (m, 6H), 3.28 (s, 2H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.58-2.53 (m, 1H), 2.28 (td, J = 14.0, 4.4 Hz, 1H), 1.78-1.69 (m, 2H), 1.63-1.53 (m, 6H) 721.4 128 (S,E)-N-(4-(9,12-dimeth- yl-7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((1- hydroxy-3-methoxy- propan-2-yl)amino)but- 2-enamide [00432] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.44-7.40 (m, 2H), 7.34 (s, 1H), 7.14-6.99 (m, 4H), 6.33 (d, J = 15.3 Hz, 1H), 3.96 (s, 3H), 3.71 (dd, J = 11.1, 4.4 Hz, 1H), 3.56-3.49 (m, 4H), 3.49- 3.42 (m, 2H), 3.37 (s, 3H), 3.11 (s, 3H), 2.94-2.86 (m, 2H), 2.58- 2.54 (m, 1H), 2.28 (td, J = 14.0, 4.3 Hz, 1H) 697.3 129 (S,E)-N-(2,6-difluoro-4- (7-methoxy-9.10,12- trimethyl-9,12,13,14- tetrahydroimidazo[4,5: 5,6]benzo[1,2:2,3]- azocino[4,5,6-hi]indol- izine-2-carbonyl)phenyl)- 4-((tetrahydrofuran-3-yl)- amino)but-2-enamide [00433] L CHIRALPAK IG (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 7.48 (s, 1H), 7.38- 7.36 (m, 1H), 7.34 (s, 1H), 7.24 (d, J = 1.0 Hz, 1H), 7.10 (dt, J = 15.1, 4.9 Hz, 2H), 7.03 (t, J = 7.0 Hz, 1H), 6.77 (s, 1H), 6.31 (d, J = 15.5 Hz, 1H), 3.95 (q, J = 7.6 Hz, 1H), 3.85-3.80 (m, 2H), 3.78 (s, 3H), 3.72 (s, 3H), 3.63 (dd, J = 9.0, 3.5 Hz, 1H), 3.52- 3.44 (m, 4H), 3.05 (s, 3H), 2.89- 2.82 (m, 1H), 2.61 (s, 3H), 2.55 (dd, J = 14.3, 2.5 Hz, 1H), 2.48- 2.43 (m, 1H), 2.17-2.09 (m, 1H), 1.79-1.72 (m, 1H) 655.3 132 (S,E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]- benzo[1,2:5,6][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)phenyl)-4-(2- (hydroxymethyl)azetidin- 1-yl)but-2-enamide [00434] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 8.0, 1.3 Hz, 1H), 7.51 (s, 1H), 7.48- 7.40 (m, 2H), 7.39-7.31 (m, 2H), 7.16 (s, 1H), 7.13 (dd, J = 7.4, 1.1 Hz, 1H), 6.95 (td, J = 10.4, 5.1 Hz, 1H), 6.26 (dt, J = 15.3, 1.6 Hz, 1H), 4.02-3.95 (m, 1H), 3.87 (dd, J = 14.6. 2.6 Hz, 1H), 3.73 (s, 3H), 3.66-3.59 (m, 1H), 3.53-3.39 (m, 5H), 3.25 (ddd, J = 16.1, 5.5, 1.6 Hz, 1H), 3.18-3.11 (m, 1H), 3.09 (s, 3H), 2.99-2.90 (m, 1H), 2.62 (s, 3H), 2.40 (s, 3H), 2.33-2.20 (m, 1H), 2.05- 1.95 (m, 1H) 639.6 133 (R,E)-N-(2,6-difluoro-4- (7-methoxy-9,10,12-tri- methyl-9,12,13,14-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:2,3]azocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4- ((tetrahydro-2H-pyran- 3-ylamino)but-2-enamide [00435] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 7.46-7.39 (m, 2H), 7.26-7.23 (m, 1H), 7.13-7.06 (m, 2H), 7.04-7.00 (m, 1H), 6.95 (s, 1H), 6.78 (s, 1H), 6.28-6.24 (m, 1H), 3.92-3.88 (m, 1H), 3.79 (s, 3H), 3.78-3.75 (m, 1H), 3.73 (s, 3H), 3.54-3.44 (m, 4H), 3.26 (dd, J = 11.0, 7.8 Hz, 1H), 3.06 (s, 3H), 2.90-2.83 (m, 1H), 2.74- 2.68 (m, 1H), 2.62 (s, 3H), 2.58- 2.54 (m, 1H), 2.50-2.41 (m, 1H), 2.01-1.96 (m, 1H), 1.76-1.69 (m, 1H), 1.66-1.60 (m, 1H), 1.48- 1.39 (m, 1H) 669.4 134 (E)-4-(12-oxabicyclo- [2.2.2]octan-4-yl)amino)- N-(2,6-difluoro-4-(7,9,12- trimethyl-9,12,13,14- tetrahydroimidazo[4,5: 5,6]benzo[1,2:2,3]- azocino[4,5,6-hi]indol- izine-2-carbonyl)phenyl)- but-2-enamide [00436] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 5.6, 2.4 Hz, 1H), 7.84 (s, 1H), 7.44 (d, J = 8.0 Hz, 2H), 7.11-7.00 (m, 4H), 6.36-6.28 (m, 1H), 3.85 (s, 3H), 3.77 (d, J = 24.3 Hz, 2H), 3.65 (t, J = 6.1 Hz, 1H), 3.52-3.42 (m, 3H), 3.10 (s, 3H), 2.92-2.81 (m, 1H), 2.54-2.51 (m, 1H), 2.38-2.28 (m, 4H), 2.11-2.02 (m, 2H), 1.73-1.68 (m, 4H), 1.33-1.21 (m, 2H) 665.6 135 (E)-4-(((1R,2S,4S)-7- oxabicyclo[2.2.1]heptan- 2-ylamino)-N-(2,6- difluoro-4-(6,8,9,11-tetra- methyl-8,11,12,13-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:5,6][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)phenyl)but-2- enamide and (E)-4- (((1S,2R,4R)-7-oxa- bicyclo-[2.2.1]heptan-2- yl)amino)-N-(2,6-difluoro- 4-(6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)but-2-enamide [00437] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 7.9, 1.1 Hz, 1H), 7.49 (dd, J = 19.9, 7.9 Hz, 3H), 7.34 (t, J = 7.6 Hz, 1H), 7.16-7.04 (m, 3H), 6.29 (d, J = 15.3 Hz, 1H), 4.60 (t, J = 4.9 Hz, 1H), 4.46 (d, J = 5.3 Hz, 1H), 4.02-3.95 (m, 1H), 3.87 (dd, J = 14.6, 2.6 Hz, 1H), 3.74 (s, 3H), 3.68-3.62 (m, 1H), 3.52-3.43 (m, 2H), 3.18-3.09 (m, 4H), 2.92 (dd, J = 7.5, 3.0 Hz, 1H), 2.62 (s, 3H), 2.41 (s, 3H), 1.87 (dd, J = 12.5, 7.5 Hz, 1H), 1.76-1.67 (m, 1H), 1.56-1.52 (m, 1H), 1.45 (d, J = 22.8 Hz, 1H), 1.40-1.33 (m, 1H), 0.92-0.90 (m, 1H) 665.7 136 (E)-4-(((1S.2S,4R)-7-oxa- bicyclo[2.2.1]heptan-2- yl)amino)-N-(2,6-difluoro- 4-(6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino [7,8,1-hi]indole-2-carbon- yl)phenyl)but-2-enamide and (E)-4-(((1R,2R,4S)-7- oxabicyclo[2.2.1]heptan- 2-yl)amino)-N-(2,6- difluoro-4-(6,8,9,11-tetra- methyl-8,11,12,13-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:5,6][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)phenyl)but-2-enamide [00438] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 8.0, 1.3 Hz, 1H), 7.52-7.45 (m, 3H), 7.36-7.33 (m, 1H), 7.16-7.07 (m, 3H), 6.27 (d, J = 15.3 Hz, 1H), 4.54-4.49 (m, 2H), 4.03-3.96 (m, 1H), 3.87 (dd, J = 14.8. 2.5 Hz, 1H), 3.74 (s, 3H), 3.68-3.61 (m, 1H), 3.48-3.38 (m, 2H), 3.31- 3.27 (m, 1H), 3.18-3.09 (m, 4H), 2.62 (s, 3H), 2.41 (s, 3H), 2.19- 2.05 (m, 2H), 1.78-1.73 (m, 1H), 1.66-1.60 (m, 1H), 1.00 (dd, J = 11.9, 4.4 Hz, 1H), 0.88-0.85 (m, 1H) 665.6 137 (E)-N-(2,6-difluoro-4- (9,10,12-trimethyl-7- (trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbon- yl)phenyl)-4-(((3R,4S)- 4-hydroxytetrahydro- furan-3-ylamino)but-2- enamide [00439] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.96 (d, J = 6.3 Hz, 1H), 7,67 (s, 1H), 7.44 (s, 1H), 7.42 (s, 1H), 7.21 (s, 1H), 7.12- 7.05 (m, 3H), 7.00 (t, J = 7.0 Hz, 1H), 6.29 (d, J = 15.3 Hz, 1H), 4.21-4.20 (m, 1H), 4.13 (dd, J = 9.3, 5.5 Hz, 1H), 4.04 (dd, J = 9.9, 4.4 Hz, 1H), 3.82 (s, 3H), 3.74 (dd, J = 9.9, 1.9 Hz, 1H), 3.60 (dd, J = 9.3, 3.3 Hz, 1H), 3.54 (d, J = 4.3 Hz, 2H), 3.45 (dd, J = 10,3, 3.3 Hz, 1H), 3.29- 3.25 (m, 1H), 3.09 (s, 3H), 2.89- 2.83 (m, 1H), 2.68 (s, 3H), 2.54 (d, J = 14.8 Hz, 1H), 2.28 (td, J = 13.9, 4.3 Hz, 1H) 709.3 138 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- (((3R,4S)-4-hydroxytetra- hydrofuran-3-yl)amino)- but-2-enamide [00440] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (d, J = 6.8 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.43 (s, 1H), 7.41 (s, 1H), 7.12- 6.99 (m, 4H), 6.30 (d, J = 15.3 Hz, 1H), 4.22-4.19 (m, 1H), 4.12 (dd, J = 9.3, 5.5 Hz, 1H), 4.04 (q, J = 4.8 Hz, 1H), 3.96 (s, 3H), 3.73 (d, J = 10,0 Hz, 1H), 3.60 (dd, J = 9.4, 3.1 Hz, 1H), 3.53 (d, J = 4.3 Hz, 2H), 3.43 (dd, J = 10.3, 3.3 Hz, 1H), 3.29-3.25 (m, 1H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.58-2.54 (m, 1H), 2.27 (td, J = 14.1, 4.3 Hz, 1H) 695.3 139 (S,E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-(2-(2- hydroxypropan-2-yl)- azetidin-1-yl)but-2-en- amide [00441] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 7.9, 1.1 Hz, 1H), 7.51 (s, 1H), 7.48- 7.40 (m, 2H), 7.35 (dd, J = 7.6, 7.6 Hz, 1H), 7.27 (brs, 1H), 7.16 (d, J = 0.5 Hz, 1H), 7.13 (dd, J = 7.4, 1.1 Hz, 1H), 6.98 (ddd, J = 15.5, 5.5, 4.5 Hz, 1H), 6.26 (dt, J = 15.3, 1.8 Hz, 1H), 4.03-3.95 (m, 1H), 3.87 (dd, J = 14.6, 2.6 Hz, 1H), 3.73 (s, 3H), 3.58 (ddd, J = 16.7, 4.3, 2.2 Hz, 1H), 3.50- 3.39 (m, 2H), 3.27 (ddd, J = 16.8, 5.5, 1.5 Hz, 1H), 3.22-3.10 (m, 2H), 3.09 (s, 3H), 2.86-2.77 (m, 1H), 2.62 (s, 3H), 2.40 (s, 3H), 2.27-2.15 (m, 1H), 2.01- 1.90 (m, 1H), 1.14 (s, 3H), 1.03 (s, 3H) 667.6 141 (E)-N-(2,6-difluoro-4- (7-methoxy-9,10,12- trimethyl-9,12,13,14- tetrahydroimidazo[4,5: 5,6]benzo[1,2:2,3]- azocino[4,5,6-hi]indol- izine-2-carbonyl)phenyl)- 4-((3-methyloxetan-3-yl)- amino)but-2-enamide [00442] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.02 (dd, J = 7.0, 1.0 Hz, 1H), 7.45-7.40 (m, 2H), 7.28-7.26 (m, 1H), 7.16 (dt, J = 15.3, 5.1 Hz, 1H), 7.11 (s, 1H), 7.08 (s, 1H), 7.05 (t, J = 7.1 Hz, 1H), 6.80 (s, 1H), 6.34 (d, J = 15.3 Hz, 1H), 4.61 (d, J = 6.0 Hz, 2H), 4.46 (d, J = 6.8 Hz, 2H), 3.81 (s, 3H), 3.76 (s, 3H), 3.56-3.53 (m, 3H), 3.09 (s, 3H), 2.92-2.86 (m, 1H), 2.64 (s, 3H), 2.61-2.56 (m, 1H), 2.52-2.45 (m, 1H), 1.54 (s, 3H) 655.3 142 (E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-((1S,2S,4R)- 2-hydroxy-7-azabicyclo- [2.2.1]heptan-7-yl)but-2- enamide and (E)-N-(2,6- difluoro-4-(6,8,9,11- tetramethyl-8,11,12,13- tetrahydroimidazo[4,5: 5,6]benzo[1,2:5,6][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)phenyl)-4- ((1R,2R,4S)-2-hydroxy- 7-azabicyclo[2.2.1]heptan- 7-yl)but-2-enamide [00443] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.40 (dd, J = 8.0, 1.3 Hz, 1H), 7.50 (s, 1H), 7.46- 7.39 (m, 2H), 7.37-7.31 (m, 2H), 7.16 (d, J = 0.5 Hz, 1H), 7.13 (dd, J = 7.5, 1.3 Hz, 1H), 7.06 (dt, J = 15.3, 5.4 Hz, 1H), 6.30 (dt, J = 15.4, 1.7 Hz, 1H), 4.39- 4.31 (m, 1H), 4.02-3.95 (m, 1H), 3.87 (dd, J = 14.8, 2.8 Hz, 1H), 3.73 (s, 3H), 3.47-3.40 (m, 1H), 3.35 (t, J = 4.4. 4.4 Hz, 1H), 3.32-3.20 (m, 3H), 3.18-3.11 (m, 1H), 3.09 (s, 3H), 2.62 (s, 3H), 2.40 (s, 3H), 2.27-2.18 (m, 1H), 2.17-2.08 (m, 1H), 1.90- 1.79 (m, 1H), 1.55-1.47 (m, 1H), 0.97 (dd, J = 12.5, 3.3 Hz, 1H) 665.7 143 (E)-4-(((1R,5S,6r)-3-oxa- bicyclo[3.1.0]hexan-6- yl)amino)-N-(2,6-difluoro- 4-(6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)but-2-enamide [00444] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.42 (dd, J = 7.80, 1.12 Hz, 1H), 7.87-7.82 (brs, 1H), 7.51 (s, 1H), 7.38-7.33 (m, 3H), 7.16-7.06 (m, 3H), 6.32 (d, J = 15.41 Hz, 1H), 4.02-3.85 (m, 4H), 3.73 (s, 3H), 3.69 (d, J = 8.31 Hz, 2H), 3.55-3.52 (m, 2H), 3.45-3.42 (m, 1H), 3.17-3.10 (m, 1H), 3.08 (s, 3H), 2.62 (s, 3H), 2.40 (s, 3H), 2.16 (t, J = 2.18 Hz, 1H), 1.72-1.71 (m, 2H) 651.6 144 (E)-N-(2,6-difluoro-4- (6,8,9,11-tetramethyl- 8,11,12,13-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:5,6][1,4]diazocino- [7,8,1-hi]indole-2-carbon- yl)phenyl)-4-((1S,2R,4R)- 2-hydroxy-7-azabicyclo- [2.2.1]heptan-7-yl)but-2- enamide and (E)-N-(2,6- difluoro-4-(6,8,9,11-tetra- methyl-8,11,12,13-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:5,6][1,4]- diazocino[7,8,1-hi]indole- 2-carbonyl)phenyl)-4- ((1R,2S,4S)-2-hydroxy- 7-azabicyclo[2.2.1]- heptan-7-yl)but-2-enamide [00445] M 1H-NMR (400 MHz, CHLORO- FORM-D) ? 8.41 (dd, J = 8.0, 1.0 Hz, 1H), 7.52 (s, 1H), 7.48- 7.41 (m, 2H), 7.36-7.31 (m, 2H), 7.16 (d, J = 0.5 Hz, 1H), 7.14- 7.04 (m, 2H), 6.34 (dt, J = 15.3, 1.8 Hz, 1H), 4.02-3.95 (m, 1H), 3.87 (dd, J = 14.8, 2.8 Hz, 1H), 3.73 (s, 3H), 3.71 (dd, J = 7.0, 1.8 Hz, 1H), 3.47-3.41 (m, 1H), 3.39-3.35 (m, 1H), 3.31-3.05 (m, 7H), 2.62 (s, 3H), 2.40 (s, 3H), 1.80-1.72 (m, 2H), 1.60-1.53 (m, 2H), 1.30-1.18 (m, 2H) 665.3 145 (E)-N-(2,6-difluoro-4- (7,9,10,12-tetramethyl- 10,12,13,14-tetrahydro- indolizino[8,1:4,5,6]- azocino[3,2-g]indazole- 2-carbonyl)phenyl)4-((3- methyloxetan-3-yl)- amino)-but-2-enamide [00446] L CHIRALPAK IC(hexane- ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (dd, J = 6.8, 1.5 Hz, 1H), 7.43-7.36 (m, 3H), 7.17-7.01 (m, 4H), 6.35 (d, J = 15.3 Hz, 1H), 4.59 (d, J = 6.3 Hz, 2H), 4.44 (d, J = 6.8 Hz, 2H), 4.11 (s, 3H), 3.54-3.50 (m, 3H), 3.02 (s, 3H), 2.84-2.78 (m, 1H), 2.61 (s, 3H), 2.55-2.40 (m, 2H), 2.26 (d, J = 0.8 Hz, 3H), 1.51 (d, J = 7.8 Hz, 3H) 639.2 147 (E)-4-(((1R,5S,6r)-3-oxa- bicyclo[3.1.0]hexan-6- yl)amino)-N-(2,6-difluoro- 4-(9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)but-2- enamide [00447] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.04, 1.00 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.43 (d, J = 7.82 Hz, 2H), 7.19-7.15 (m, 2H), 7.14-7.02 (m, 3H), 6.21 (dt, J = 15.32, 1.60 Hz, 1H), 4.78-4.74 (m, 1H), 4.26- 4.19 (m, 1H), 3.97 (s, 3H), 3.87 (d, J = 8.40 Hz, 2H), 3.70 (d, J = 8.35 Hz, 2H), 3.53-3.51 (m, 2H), 2.89-2.80 (m, 1H), 2.61-2.56 (m, 1H), 2.15-2.14 (m, 1H), 1.70- 1.69 (m, 2H) 678.6 149 (E)-N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-(pyrrolidin-1- yl)but-2-enamide [00448] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (d, J = 6.5 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.47-7.40 (m, 2H), 7.20-7.14 (m, 2H), 7.13-6.98 (m, 3H), 6.24 (d, J = 15.5 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.33 (dd, J = 5.8, 1.3 Hz, 2H), 2.90-2.78 (m, 1H), 2.67-2.54 (m, 5H), 1.87- 1.79 (m, 4H) 650.5 150 (S,E)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-(3- hydroxypyrrolidin-1-yl)- but-2-enamide [00449] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.47-7.40 (m, 2H), 7.22 (brs, 1H), 7.19-7.15 (m, 2H), 7.11-7.01 (m, 2H), 6.27 (dt, J = 15.3, 1.6 Hz, 1H), 4.76 (dd, J = 10.6, 4.4 Hz, 1H), 4.43-4.37 (m, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.34 (dd, J = 5.9, 1.1 Hz, 2H), 2.99 (ddd, J = 8.4, 8.4, 5.2 Hz, 1H), 2.90-2.77 (m, 2H), 2.61-2.56 (m, 2H), 2.38 (ddd, J = 8.8, 8.8, 6.4 Hz, 1H), 2.28- 2.17 (m, 1H), 1.84-1.75 (m, 1H) 666.5 151 (R,E)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-(3- hydroxypyrrolidin-1-yl)- but-2-enamide [00450] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.39 (m, 2H), 7.32 (brs, 1H), 7.19-7.15 (m, 2H), 7.11-7.00 (m, 2H), 6.28 (dt, J = 15.3, 1.5 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.42-4.36 (m, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.34 (dd, J = 5.8, 1.5 Hz, 2H), 3.00 (ddd, J = 8.4, 8,4, 5.2 Hz, 1H), 2.90-2.77 (m, 2H), 2.62-2.57 (m, 2H), 2.38 (ddd, J = 8.8, 8.8, 6.8 Hz, 1H), 2.28-2.17 (m, 1H), 1,84-1.76 (m, 1H) 666.6 153 (E)-N-(4-(9-cyclopropyl- 12-methyl-7-(trifluoro- methyl)-9,12,13,14-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:2,3]azocino- [4,5,6-hi]indolizine-2- carbonyl)-2,6-difluoro- phenyl)-4-((3-methyloxe- tan-3-yl)amino)but-2- enamide [00451] L CHIRAL ART SB(bexane- ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (dd, J = 6.88, 1.12 Hz, 1H), 8.07 (s, 1H), 7.96 (s, 1H), 7.42-7.35 (m, 3H), 7.17- 7.11 (m, 2H), 7.06 (d, J = 7.12 Hz, 1H), 7.00 (t, J = 6.98 Hz, 1H), 6.35 (d, J = 15.32 Hz, 1H), 4.59 (d, J = 6.28 Hz, 2H), 4.44 (d, J = 6,48 Hz, 2H), 3.54-3.52 (m, 2H), 3.49-3.41 (m, 2H), 3.09 (s, 3H), 2.92-2.85 (m, 1H), 2.57- 2.53 (m, 1H), 2.33-2.25 (m, 1H), 1.52 (s, 3H), 1.29-1.25 (m, 2H), 1.16-1.13 (m, 2H) 705.7 154 (S,E)-N-(2,6-difluoro-4- (9,10,12-trimethyl-7- (trifluoromethyl)- 10,12,13,14-tetrahydro- indolizino[8,1:4,5,6]- azocino[3,2-g]indazole- 2-carbonyl)phenyl)-4- ((tetrahydrofuran-3-yl)- amino)but-2-enamide [00452] L CHIRALPAK SB(bexane- ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (500 MHz, CHLORO- FORM-D) ? 9.97 (d, J = 7.0 Hz, 1H), 8.00 (s, 1H), 7.47-7.40 (m, 2H), 7.14-7.09 (m, 3H), 7.01 (t, J = 7.2 Hz, 1H), 6.32 (d, J = 15.3 Hz, 1H), 4.17 (s, 3H), 3.96 (dd, J = 15.0, 7.9 Hz, 1H), 3.85-3.78 (m, 2H), 3.65 (dd, J = 9.0, 3.5 Hz, 1H), 3.54-3.43 (m, 4H), 3.02 (s, 3H), 2.85-2.80 (m, 1H), 2.69 (s, 3H), 2.54 (dd, J = 15.0, 2.1 Hz, 1H), 2.36 (td, J = 14.0, 4.5 Hz, 1H), 2.18-2.11 (m, 1H), 1.81-1.75 (m, 1H) 693.7 155 (E)-N-(2,6-difluoro-4- (9,10,12-trimethyl-7- (trifluoromethyl)- 10,12,13,14-tetrahydro- indolizino[8,1:4,5,6]- azocino[3,2-g]indazole- 2-carbonyl)phenyl)-4- ((1-methylcyclopropyl)- amino)but-2-enamide [00453] L CHIRALPAK SB(hexane- ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (500 MHz, CHLORO- FORM-D) ? 9.96 (d, J = 7.0 Hz, 1H), 8.00 (s, 1H), 7.42 (d, J = 7.9 Hz, 2H), 7.15-7.05 (m, 3H), 7.00 (t, J = 7.0 Hz, 1H), 6.24 (d, J = 15.3 Hz, 1H), 4.17 (d, J = 5.2 Hz, 3H), 3.56 (dd, J = 5.2, 1.8 Hz, 2H), 3.46-3.43 (m, 1H), 3.02 (s, 3H), 2.85-2.80 (m, 1H), 2.69 (s, 3H), 2.54 (dd, J = 15.0, 2.1 Hz, 1H), 2.36 (td, J = 14.0, 4.5 Hz, 1H), 1.29 (s, 3H), 0.63 (t, J = 5.0 Hz, 2H), 0.42 (dd, J = 6.3, 4.4 Hz, 2H) 677.6 156 (E)-4-(((1R,5S,6s)-3- oxabicyclo[3.1.0]hexan- 6-yl)amino)-N-(2,6- difluoro-4-(9-methyl-7- (trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)but-2-enamide [00454] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.04, 1.00 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.43 (d, J = 7.83 Hz, 2H), 7.18-7.11 (m, 4H), 7.03 (t, J = 7.10 Hz, 1H), 6.30 (dt, J = 15.32, 1.64 Hz, 1H), 4.78-4.74 (m, 1H), 4.25-4.19 (m, 1H), 4.00- 3.94 (m, 7H), 3.57-3.55 (m, 2H), 2.89-2.80 (m, 1H), 2.60-2.56 (m, 1H), 2.42 (t, J = 6.86 Hz, 1H), 1.79-1.77 (m, 2H) 678.2 157 (E)-N-(4-(8,11-dimethyl- 6-(trifluoromethyl)- 8,11,12,13-tetrahydro- 1,2a,8,10,11-pentaaza- cycloocta[1,2,3-cd:5,4-e]- diindene-2-carbonyl)-2,6- difluorophenyl)-4-((3- methyloxetan-3-yl)- amino)but-2-enamide [00455] O CHIRALPAK IA (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.89-9.85 (m, 1H), 8.23-8.20 (m, 2H), 8.06 (s, 1H), 7.84 (s, 1H), 7.17-7.10 (m, 3H), 6.29 (d, J = 15.3 Hz, 1H), 4.58 (d, J = 6.3 Hz, 2H), 4.47 (s, 1H), 4.43 (d, J = 6.8 Hz, 2H), 3.97 (s, 3H), 3.59-3.51 (m, 3H), 3.08- 3.05 (m, 3H), 3.06-2.96 (m, 1H), 2.52-2.43 (m, 1H), 1.50 (s, 3H) 680.5 159 (S,E)-N-(2,6-difluoro-4- (7-methoxy-9,12-dimeth- yl-9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbon- yl)phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00456] L CHIRALPAK IE (hexane- ethanol (0.1%triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.01 (dd, J = 7.0, 1.0 Hz, 1H), 7.80 (s, 1H), 7.37 (d, J = 8.0 Hz, 3H), 7.26 (dd, J = 7.1, 1.1 Hz, 1H), 7.14-7.08 (m, 2H), 7.04 (t, J = 7.0 Hz, 1H), 6.86 (s, 1H), 6.31 (d, J = 15.5 Hz, 1H), 3.99-3.93 (m, 1H), 3.86 (s, 3H), 3.81 (s, 3H), 3.84-3.79 (m, 2H), 3.64 (dd, J = 9.0, 3.5 Hz, 1H), 3.53-3.45 (m, 4H), 3.08 (s, 3H), 2.93-2.86 (m, 1H), 2.59- 2.55 (m, 1H), 2.49-2.42 (m, 1H), 2.18-2.10 (m, 1H), 1.80-1.73 (m, 1H) 641.2 160 (E)-N-(2,6-difluoro-4-(7- methoxy-9,12-dimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbon- yl)phenyl)-4-((1-methyl- cyclopropyl)amino)but-2- enamide [00457] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.01 (d, J = 7.0 Hz, 1H), 7.80 (s, 1H), 7.56-7.38 (m, 1H), 7.35 (dd, J = 7.9, 4.4 Hz, 2H), 7.26-7,25 (m, 1H), 7.16- 7.09 (m, 2H), 7.04 (t, J = 7.0 Hz, 1H), 6.86 (s, 1H), 6.28 (d, J = 15.5 Hz, 1H), 3.86 (s, 3H), 3.81 (s, 3H), 3.55 (dd, J = 5.3, 1.8 Hz, 2H), 3,50 (dd, J = 10.0, 3.3 Hz, 1H), 3.08 (s, 3H), 2.92-2.86 (m, 1H), 2.59-2.55 (m, 1H), 2.44 (td, J = 13,8, 4.3 Hz, 1H), 1.30 (s, 3H), 0.63-0.60 (m, 2H), 0.42- 0.40 (m, 2H) 625.2 161 (E)-4-(azetidin-1-yl)-N- (2,6-difluoro-4-(9-methyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)but-2-enamide [00458] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.45-7.39 (m, 2H), 7.21 (brs, 1H), 7.19-7.14 (m, 2H), 7.03 (dd, J = 7.2, 7.2 Hz, 1H), 6.95 (dt, J = 15.3, 4.9 Hz, 1H), 6.20 (dt, J = 15.5, 1.8 Hz, 1H), 4.76 (dd, J = 10.3, 4.5 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.29 (t, J = 7.1 Hz, 4H), 3.26 (dd, J = 5.0, 1.8 Hz, 2H), 2.88-2.80 (m, 1H), 2.58 (dd, J = 15.3, 2.3 Hz, 1H), 2.14 (tt, J = 6.8. 6.8 Hz, 2H) 636.1 162 (S,E)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-(2- (2-hydroxypropan-2-yl)- azetidin-1-yl)but-2- enamide [00459] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.47-7.41 (m, 2H), 7.20- 7.15 (m, 2H), 7.08 (brs, 1H), 7.04 (dd, J = 7.0, 7.0 Hz, 1H), 6.97 (ddd, J = 15.4, 5.7, 4.3 Hz, 1H), 6.23 (dt, J = 15.3, 1.7 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.26-4.19 (m, 1H), 3.97 (s, 3H), 3.57 (ddd, J = 16.8, 4.3, 2.3 Hz, 1H), 3.47-3.43 (m, 1H), 3.26 (ddd, J = 16.8, 5.6, 1.2 Hz, 1H), 3.19 (dd, J = 8.0, 8.0 Hz, 1H), 2.90-2.76 (m, 2H), 2.59 (dd, J = 15.4, 2.4 Hz, 1H), 2.25-2.15 (m, 1H), 1.99-1.91 (m, 1H), 1.13 (s, 3H), 1.03 (s, 3H) 694.2 163 (E)-N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((3aR,6S,6aS)- 6-hydroxyhexahydro- cyclopenta[b]pyrrol- 1(2H)-yl)but-2-enamide and (E)-N-(2,6-difluoro- 4-(9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4- (3aS,6R,6aR)-6-hydroxy- hexahydrocyclopenta[b]- [00460] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.40 (m, 2H), 7.22 (brs, 1H), 7.19-7.14 (m, 2H), 7.12-7.00 (m, 2H), 6.24 (dt, J = 15.3, 1.5 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.25-4.19 (m, 1H), 4.06-4.03 (m, 1H), 3.97 (s, 3H), 3.54 (ddd, J = 15.3, 5.7, 1.7 Hz, 1H), 3.28 (ddd, J = 15.3, 6.3, 1.2 Hz, 1H), 3.04-2.98 (m, 1H), 2.90-2.70 (m, 3H), 2.58 (dd, J = 15.4, 2.4 Hz, 1H), 2.26-2.20 (m, 1H), 2.04-1.90 (m, 3H), 1.49- 1.33 (m, 2H) 706.1 pyrrol-1(2H)-yl)but-2- enamide 164 (E)-N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((3aR,6R,6aS)- 6-hydroxy-hexabydro- cyclopenta[b]pyrrol- 1(2H)-yl)but-2-enamide and (E)-N-(2,6-difluoro- 4-(9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo-[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4- ((3aS,6S,6aR)-6-hydroxy- hexahydrocyclopenta[b]- [00461] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.40 (m, 2H), 7.37 (brs, 1H), 7.19-7.15 (m, 2H), 7.07-7.00 (m, 2H), 6.25 (dt, J = 15,5, 1.5 Hz, 1H), 4.76 (dd, J = 10.5, 4.3 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.90-3.85 (m, 1H), 3.53 (dd, J = 16.0, 5.8 Hz, 1H), 3.37-3.28 (m, 2H), 3.09 (dd, J = 5.2, 5.2 Hz, 1H), 2.88-2.80 (m, 1H), 2.68-2.57 (m, 3H), 2.04-1.97 (m, 1H), 1.95-1.89 (m, 1H), 1.78-1.62 (m, 2H), 1.56- 1.43 (m, 2H) 706.1 pyrrol-1(2H)-yl)but-2- enamide 165 (S,E)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-(2- (hydroxymethyl)azetidin- 1-yl)but-2-enamide [00462] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.40 (m, 2H), 7.28 (brs, 1H), 7.20-7.15 (m, 2H), 7.04 (dd, J = 7.1, 7.1 Hz, 1H), 6.95 (dt, J = 15.5, 5.3 Hz, 1H), 6.23 (dt, J = 15.3, 1.6 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.64-3.59 (m, 1H), 3.49-3.41 (m, 4H), 3.23 (ddd, J = 16.3, 5.4, 1.6 Hz, 1H), 2.95-2.89 (m, 1H), 2.88-2.80 (m, 1H), 2.58 (dd, J = 15.3, 2.3 Hz, 1H), 2.30-2.21 (m, 1H), 2.03-1.95 (m, 1H) 666.1 166 (S,E)-N-(4-(9-cycloprop- yl-12-methyl-7-(trifluoro- methyl)-9,12,13,14-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:2,3]azocino- [4,5,6-hi]indolizine-2- carbonyl)-2,6-difluoro- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00463] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (dd, J = 6.84, 1.00 Hz, 1H), 8.07 (s, 1H), 7.96 (s, 1H), 7.54-7.49 (brs, 1H), 7.39 (d, J = 7.88 Hz, 2H), 7.15-7.06 (m, 3H), 7.01 (t, J = 6.98 Hz, 1H), 6.33 (d, J = 15.39 Hz, 1H), 3.99-3.93 (m, 1H), 3.86-3.77 (m, 2H), 3.66-3.62 (m, 1H), 3.50- 3.41 (m, 5H), 3.09 (s, 3H), 2.92- 2.85 (m, 1H), 2.57-2.53 (m, 1H), 2.33-2.25 (m, 1H), 2.18-2.10 (m, 1H), 1.80-1.73 (m, 1H), 1.28- 1.26 (m, 2H), 1.16-1.13 (m, 2H) 705.3 167 (S,E)-N-(4-(8,11-dimeth- yl-6-(trifluoromethyl)- 8,11,12,13-tetrahydro- 1,2a,8,10,11-pentaaza- cycloocta[1,2,3-cd:5,4-e]- diindene-2-carbonyl)-2,6- difluorophenyl)-4-((tetra- hydrofuran-3-yl)amino)- but-2-enamide [00464] O CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.89-9.85 (m, 1H), 8.21 (dt, J = 13.4, 2.3 Hz, 2H), 8.05 (s, 1H), 7.84 (s, 1H), 7.14- 7.07 (m, 3H), 6.28-6.24 (m, 1H), 3.97-3.92 (m, 4H), 3.85-3.77 (m, 2H), 3.64-3.55 (m, 2H), 3.49- 3.44 (m, 3H), 3.08 (s, 3H), 3.06- 2.96 (m, 2H), 2.51-2,43 (m, 1H), 2.18-2.09 (m, 1H), 1.79-1.72 (m, 1H), 2.18-2.09 (m, 1H), 1.79- 1.72 (m, 1H) 680.5 168 (S,E)-N-(2,6-difluoro-4- (7-methoxy-9,12-dimeth- yl-10-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00465] CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.02 (dd, J = 7.0, 1.0 Hz, 1H), 7.61-7.47 (m, 1H), 7.36 (d, J = 7.8 Hz, 2H), 7.26 (s, 1H), 7.23 (dd, J = 7.1, 0.9 Hz, 1H), 7.14-7.08 (m, 2H), 7.04 (t, J = 7.1 Hz, 1H), 6.84 (s, 1H), 6.33 (d, J = 15.3 Hz, 1H), 3.99- 3.91 (m, 1H), 3.94 (s, 3H), 3.84 (s, 3H), 3.86-3.76 (m, 1H), 3.66- 3.61 (m, 1H), 3.54-3.40 (m, 4H), 3.07 (s, 3H), 2.93-2.86 (m, 1H), 2.62-2.56 (m, 1H), 2.42 (td, J = 13.9, 4.4 Hz, 1H), 2.18-2.05 (m, 1H), 1.80-1.67 (m, 1H) 709.2 169 (S,E)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-(2- (methoxymethyl)azetidin- 1-yl)but-2-enamide [00466] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.39 (m, 2H), 7.22- 7.13 (m, 3H), 7.03 (dd, J = 7.1, 7.1 Hz, 1H), 6.96 (dt, J = 15.5, 5.5 Hz, 1H), 6.21 (dt, J = 15.3, 1.6 Hz, 1H), 4.76 (dd, J = 10.5, 4.3 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.52-3.32 (m, 8H), 3.21 (ddd, J = 15.9, 5.5, 1.6 Hz, 1H), 2.90-2.78 (m, 2H), 2.58 (dd, J = 15.3, 2.3 Hz, 1H), 2.08-1.99 (m, 2H) 680.3 170 (E)-N-(2,6-difluoro-4-(7- methoxy-10-(methoxy- methyl)-9,12-dimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((3-methyl- oxetan-3-yl)amino)but-2- enamide [00467] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.01 (d, J = 7.0 Hz, 1H), 7.47-7.36 (m, 3H), 7.26- 7.25 (m, 1H), 7.14 (dt, J = 15.3, 5.1 Hz, 1H), 7.08 (s, 1H), 7.03 (t, J = 7.0 Hz, 1H), 6.81 (s, 1H), 6.35 (d, J = 15.5 Hz, 1H), 4.75 (dd, J = 15.8, 12.5 Hz, 2H), 4.59 (d, J = 6.3 Hz, 2H), 4.44 (d, J = 6.5 Hz, 2H), 3.85 (s, 3H), 3.81 (s, 3H), 3.54-3.51 (m, 3H), 3.45 (s, 3H), 3.07 (s, 3H), 2.91-2.84 (m, 1H), 2.58-2.54 (m, 1H), 2.44 (td, J = 13.8, 4.3 Hz, 1H), 1.52 (s, 3H) 685.3 171 (S,E)-N-(2,6-difluoro-4- (7-methoxy-10-(methoxy- methyl)-9,12-dimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00468] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1.0 Hz, 1H), 7.40 (s, 1H), 7.38 (s, 1H), 7.26-7.24 (m, 1H), 7.14- 7.08 (m, 3H), 7.03 (t, J = 7.0 Hz, 1H), 6.81 (s, 1H), 6.29 (d, J = 15.3 Hz, 1H), 4.79-4.71 (m, 2H), 3.96 (q, J = 7.7 Hz, 1H), 3.85- 3.77 (m, 8H), 3.63 (dd, J = 9.0, 3.8 Hz, 1H), 3.54-3.45 (m, 7H), 3.07 (s, 3H), 2.91-2.84 (m, 1H), 2.58-2.54 (m, 1H), 2.49-2.41 (m, 1H), 2.18-2.10 (m, 1H), 1.80- 1.72 (m, 1H) 685.3 172 (E)-N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((1S,2S,4R)-2-hydroxy-7-azabicyclo- [2.2.1]heptan-7-yl)but-2- enamide and (E)-N-(2,6- difluoro-4-(9-methyl-7- (trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)-4-((1R,2R,4S)-2- hydroxy-7-zabicyclo- [2.2.1]-heptan-7-yl)but- 2-enamide [00469] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.39 (m, 2H), 7.21- 7.14 (m, 3H), 708-7.01 (m, 2H), 6.28 (dt, J = 15.3, 1.6 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.36-4.32 (m, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H) 3.38-3.18 (m, 4H), 2.88-2.80 (m, 1H), 2.58 (dd, J = 15.4, 2.4 Hz, 1H), 2.26- 2.17 (m, 1H), 2.16-2.09 (m, 1H), 1.88-1.78 (m, 1H), 1.54-1.47 (m, 1H), 0.97 (dd, J = 12.6, 3.4 Hz, 1H) 692.4 173 (E)-N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((1S,2R,4R)- 2-hydroxy-7-azabicyclo- [2.2.1]heptan-7-yl)but-2- enamide and (E)-N-(2,6- difluoro-4-(9-methyl-7- (trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]indolizine-2-carbonyl)- phenyl)-4-((1R,2S,4S)-2- hydroxy-7-azabicyclo- [2.2.1]heptan-7-yl)but-2- enamide [00470] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.40 (m, 2H), 7.35 (brs, 1H), 7.20-7.15 (m, 2H), 7.11-7.01 (m, 2H), 6.33 (dt, J = 15.3, 1.6 Hz, 1H), 4.76 (dd, J = 10.5, 4.3 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.71 (dd, J = 7.0, 1.5 Hz, 1H), 3.39-3.34 (m, 1H), 3.30-3.18 (m, 3H), 2.88- 2.80 (m, 1H), 2.59 (dd, J = 15.4, 2.4 Hz, 1H), 1.78-1.69 (m, 3H), 1.60-1.52 (m, 1H), 1.26-1.17 (m, 2H) 692.4 175 (S,E)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-(2- (fluoromethyl)azetidin-1- yl)but-2-enamide [00471] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.1, 0.9 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.40 (m, 2H), 7.19- 7.15 (m, 2H), 7.09 (brs, 1H), 7.03 (dd, J = 7.1, 7,1 Hz, 1H), 6.96 (dt, J = 15.4, 5.3 Hz, 1H), 6.23 (dt, J = 15.3, 1.6 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.41 (dd, J = 47.8, 4.5 Hz, 2H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.53-3.42 (m, 3H), 3.25 (ddd, J = 16.1, 5.5, 1.6 Hz, 1H), 2.94- 2.80 (m, 2H), 2.58 (dd, J = 15.3, 2.3 Hz, 1H), 2.14-2.03 (m, 2H) 668.4 176 (S,E)-N-(2,6-difluoro- 4-(8,9,11-trimethyl-6- (trifluoromethyl)- 9,11,12,13-tetrahydro- 1,2a,9,10,11-pentaaza- cycloocta[1,2,3-cd:5,4- e]diindene-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00472] O CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.86 (dd, J = 6.8, 1.3 Hz, 1H), 8.22-8.19 (m, 2H), 8.04 (s, 1H), 7.17-7.07 (m, 3H), 6.25 (d, J = 15.5 Hz, 1H), 4.18 (s, 3H), 3.95 (q, J = 7.7 Hz, 1H), 3.85-3.77 (m, 2H), 3.68-3.56 (m, 2H), 3.49-3.44 (m, 3H), 2.99- 2.92 (m, 5H), 2.71 (s, 3H), 2.59- 2.51 (m, 1H), 2.18-2.09 (m, 1H), 1.79-1.72 (m, 1H) 694.2 177 (S,E)-N-(2,6-difluoro-4- (6-methoxy-9-(methoxy- methyl)-8,11-dimethyl- 8,11,12,13-tetrahydro- 1,2a,8,10,11-pentaaza- cycloocta[1,2,3-cd:5,4- e]diindene-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00473] O CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.88 (dd, J = 6.9, 0.9 Hz, 1H), 8.17 (d, J = 8.8 Hz, 2H), 7.32 (dd, J = 7.1, 0.9 Hz, 1H), 7.16-7.06 (m, 2H), 6.83 (s, 1H), 6.24 (d, J =15.3 Hz, 1H), 4.75 (dd, J = 15.5, 12.5 Hz, 2H), 3.94 (q, J = 7.7 Hz, 1H), 3.86- 3.76 (m, 8H), 3.68-3.59 (m, 3H), 3.47-3.43 (m, 6H), 3.05-2.96 (m, 5H), 2.68-2.59 (m, 1H), 2.17- 2.08 (m, 1H), 1.78-1.71 (m, 1H) 686.1 178 (E)-N-(2,6-difluoro-4-(9- (2-methoxyethyl)-12- methyl-7-(trifluorometh- yl)-9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((3-methyl- oxetan-3-yl)amino)but- 2-enamide [00474] CHIRALPAK IG(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (dd, J = 6.88, 1.08 Hz, 1H), 8.13 (s, 1H), 7.83 (s, 1H), 7.42 (d, J = 7.85 Hz, 2H), 7.26-7.23 (brs, 1H), 7.18- 7.12 (m, 2H), 7.07 (d, J = 7.14 Hz, 1H), 7.00 (t, J = 7.01 Hz, 1H), 6.34 (d, J = 15.31 Hz, 1H), 4.59 (d, J =6.30 Hz, 2H), 4.45- 4.40 (m, 4H), 3.79 (t, J = 5.04 Hz, 2H), 3.54-3.53 (m, 2H), 3.47-3.44 (m, 1H), 3.39 (s, 3H), 3.12 (s, 3H), 2.93-2.86 (m, 1H), 2.58-2.54 (m, 1H), 2.34-2.26 (m, 1H), 1.52 (s, 3H) 723.3 179 (E)-N-(2,6-difluoro-4-(12- methyl-7-(trifluorometh- yl)-9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((3-methyloxe- tan-3-yl)amino)but-2- enamide [00475] L CHIRALPAK IG(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.96, 1.12 Hz, 1H), 8.21 (s, 1H), 8.10- 8.02 (brs, 1H), 7.45 (d, J = 7.87 Hz, 2H), 7.18-7.12 (m, 2H), 7.08 (d, J = 7.15 Hz, 1H), 7.02-6.99 (m, 2H), 6.32 (dt, J = 15.28, 1.80 Hz, 1H), 4.58 (d, J = 6.26 Hz, 2H), 4.44 (d, J = 6.55 Hz, 2H), 3.55-3.53 (m, 1H), 3.39-3.34 (m, 1H), 3.05-3.07 (brs, 3H), 2.93-2.81 (m, 3H), 2.59-2.55 (m, 1H), 2.37-2.29 (m, 1H), 1.52 (s, 3H) 665.2 180 (S,E)-N-(4-(9,12-dimeth- yl-7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-(2- (2-hydroxypropan-2-yl)- azetidin-1-yl)but-2-en- amide [00476] L CHIRALPAK ID(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.02 (s, 1H), 7.80 (s, 1H), 7.48-7.41 (m, 2H), 7.12 (s, 1H), 7.08-6.93 (m, 4H), 6.23 (dt, J = 15.5, 1.8 Hz, 1H), 3.95 (s, 3H), 3.57 (ddd, J = 16.8, 4.3, 2.0 Hz, 1H), 3.49-3.40 (m, 2H), 3.26 (ddd, J = 16.7, 5.7, 1.4 Hz, 1H), 3.19 (t, J = 8.0 Hz, 1H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.84-2.78 (m, 1H), 2.61-2.51 (m, 1H), 2.32-2.15 (m, 2H), 1.99- 1.91 (m, 1H), 1.13 (s, 3H), 1.03 (s, 3H) 707.2 181 (E)-N-(2,6-difluoro-4-(6- methoxy-9-(methoxy- methyl)-8,11-dimethyl- 8,11,12,13-tetrahydro- 1,2a,8,10,11-pentaaza- cycloocta[1,2,3-cd:5,4-e]- diindene-2-carbonyl)phen- yl)-4-((1-methylcyclo- propyl)amino)but-2-en- amide [00477] O CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.89 (dd, J = 7.0, 0.8 Hz, 1H), 8.18-8.15 (m, 2H), 7.32 (dd, J = 7.1. 0.9 Hz, 1H), 7.16-7.08 (m, 2H), 6.83 (s, 1H), 6.22-6.23 (0H), 6.19 (d, J = 15.5 Hz, 1H), 4.76 (dd, J = 15.4, 12.4 Hz, 2H), 3.86 (s, 3H), 3.84 (s, 3H), 3.69-3.65 (m, 1H), 3.54 (dd, J = 5.1, 1.9 Hz, 2H), 3.46 (s, 3H), 3.06-2.96 (m, 5H), 2.68- 2.60 (m, 2H), 1.29 (s, 3H), 0.60 (t, J = 5.1 Hz, 2H), 0.40 (dd, J = 6.4, 4.4 Hz, 2H) 670.7 182 (E)-N-(4-(8,11-dimethyl- 6-(trifluoromethyl)- 8,11,12,13-tetrahydro- 1,2a,8,10,11-pentaaza- cycloocta[1,2,3-cd:5,4- e]diindene-2-carbonyl)- 2,6-difluorophenyl)-4- ((1-methylcyclopropyl- amino)but-2-enamide [00478] O CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.89-9.85 (m, 1H), 8.22-8.19 (m, 2H), 8.05 (s, 1H), 7.84 (s, 1H), 7.15-7.09 (m, 3H), 6.19 (dt, J = 15.3, 1.8 Hz, 1H), 3.99 (d, J = 16.3 Hz, 3H), 3.59- 3.53 (m, 3H), 3.08-2.91 (m, 5H), 2.51-2.43 (m, 1H), 1.31 (s, 3H), 0.61-0.59 (m, 2H), 0.42-0.35 (m, 2H) 664.3 183 (E)-N-(2,6-difluoro-4-(7- (2-oxopyrrolidin-1-yl)-9- (trifluoromethyl)-3,4- dihydrobenzo[2,3]oxocino- [4,5,6-hi]indolizine-1- carbonyl)phenyl)-4-((3- methyloxetan-3-yl)- amino)-but-2-enamide [00479] E CHIRALPAK IC(hexane- ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 7.00, 1.04 Hz, 1H), 7.93 (d, J = 2.20 Hz, 1H), 7.84 (d, J = 2.24 Hz, 1H), 7.42 (d, J = 7.80 Hz, 2H), 7.18-7.10 (m, 4H), 7.02 (t, J = 7.09 Hz, 1H), 6.33 (dt, J = 15.32, 1.64 Hz, 1H), 4.58 (d, J = 6.27 Hz, 2H), 4.44 (d, J = 6.54 Hz, 2H), 4.28-4.24 (m, 1H), 4.16- 4.09 (m, 1H), 3.97-3.93 (m, 2H), 3.54-3.53 (m, 2H), 2.99-2.90 (m, 1H), 2.69 (t, J = 8.10 Hz, 2H), 2.61-2.57 (m, 1H), 2.29- 2.21 (m, 2H), 1.52 (s, 3H) 695.2 185 (E)-N-(2,6-difluoro-4-(9- (methoxymethyl)-8,11- dimethyl-6-(trifluorometh- yl)-8,11,12,13-tetrahydro- 1,2a,8,10,11-pentaaza- cycloocta[1,2,3-cd:5,4- e]diindene-2-carbonyl)- phenyl)-4-((1-methyl- cyclopropyl)amino)but-2- enamide [00480] R 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.88-9.84 (m, 1H), 8.23-8.16 (m, 2H), 7.78 (s, 1H), 7.15-7.08 (m, 3H), 6.91 (brs, 1H), 6.19 (dt, J = 15.3, 1.8 Hz, 1H), 4.85-4.78 (m, 2H), 3.95 (s, 3H), 3.60-3.53 (m, 3H), 3.49 (s, 3H), 3.07 (s, 3H), 3.03-2.92 (m, 2H), 2.51-2.43 (m, 1H), 1.29 (s, 3H), 0.60 (dd, J = 6.0, 4.8 Hz, 2H), 0.40 (dd, J = 6.1, 4.4 Hz, 2H) 708.6 186 (S,E)-N-(2,6-difluoro-4- (9-(2-methoxyethyl)-12- methyl-7-(trifluorometh- yl)-9,12,13,14-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:2,3]azocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4- ((tetrahydrofuran-3-yl)- amino)but-2-enamide [00481] L CHIRALPAK OZ-II(hex- ane-ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.92, 1.16 Hz, 1H), 8.13 (s, 1H), 7.82 (s, 1H), 7.45 (d, J = 7.88 Hz, 2H), 7.14-7.05 (m, 3H), 7.00 (t, J = 7.00 Hz, 1H), 6.95-6,97 (brs, 1H), 6.27 (dt, J = 15.32, 1.72 Hz, 1H), 4.41 (t, J = 4.95 Hz, 2H), 3.98-3.93 (m, 1H), 3.85-3.77 (m, 4H), 3.65-3.62 (m, 1H), 3.50- 3.43 (m, 4H), 3.39 (s, 3H), 3.11 (s, 3H), 2.94-2.86 (m, 1H), 2.58- 2.54 (m, 1H), 2.34-2.26 (m, 1H), 2.18-2.09 (m, 1H), 1.80-1.72 (m, 1H) 723.3 188 (E)-N-(2,6-difluoro-4-(7- methoxy-10-(methoxy- methyl)-9,12-dimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-(pyrrolidin-1- yl)but-2-enamide [00482] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1.0 Hz, 1H), 7.41-7.36 (m, 2H), 7.26-7.22 (m, 1H), 7.13-7.06 (m, 2H), 7.03 (t, J = 7.0 Hz, 1H), 6.81 (s, 1H), 6.27 (d, J = 15.3 Hz, 1H), 4.75 (dd, J = 15.8, 12.5 Hz, 2H), 3.85 (s, 3H), 3.81 (s, 3H), 3.53 (dd, J = 10.1, 3.1 Hz, 1H), 3.45 (s, 3H), 3.33 (dd, J = 5.8, 1.5 Hz, 2H), 3.07 (s, 3H), 2.91-2.84 (m, 1H), 2.62-2.54 (m, 5H), 2.44 (td, J = 13.9, 4.5 Hz, 1H), 1.87-1.78 (m, 4H) 669.1 189 (E)-4-((1S,4S)-2-oxa-5- azabicyclo[2.2.1]heptan- 5-yl)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)but-2- enamide [00483] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1,0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.47-7.39 (m, 2H), 7.21- 7.15 (m, 2H), 7.11 (brs, 1H), 7.09-7.01 (m, 2H), 6.28 (dt, J = 15.3, 1.6 Hz, 1H), 4.76 (dd, J = 10.5. 4.5 Hz, 1H), 4.44 (s, 1H), 4.25-4.19 (m, 1H), 4.04 (d, J = 7.8 Hz, 1H), 3.97 (s, 3H), 3.67 (dd, J = 7.8, 1.8 Hz, 1H), 3.54 (s, 1H), 3.51-3.37 (m, 2H), 2.94 (dd, J = 10.1, 1.6 Hz, 1H), 2.89-2.80 (m, 1H), 2.66-2.54 (m, 2H), 1.88 (dd, J = 9.8, 2.0 Hz, 1H), 1.81- 1.74 (m, 1H) 678.2 190 (E)-4-((1R,4R)-2-oxa-5- azabicyclo[2.2.1]heptan- 5-yl)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)but-2- enamide [00484] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1,0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.47-7.40 (m, 2H), 7.21- 7.14 (m, 2H), 7.10-7.00 (m, 3H), 6.27 (dt, J = 15.3, 1.8 Hz, 1H), 4.76 (dd, J = 10.5, 4.3 Hz, 1H), 4.44 (s, 1H), 4.26-4.19 (m, 1H), 4.04 (d, J = 7.8 Hz, 1H), 3.97 (s, 3H), 3.68 (dd, J = 7.8, 1.8 Hz, 1H), 3.54 (s, 1H), 3.51-3.37 (m, 2H), 2.94 (dd, J = 10.1, 1.6 Hz, 1H), 2.89-2.80 (m, 1H), 2.66- 2.54 (m, 2H), 1.88 (dd, J = 9.8, 2.0 Hz, 1H), 1.81-1.74 (m, 1H) 678.4 191 (S,E)-N-(2,6-difluoro-4- (9-methoxy-5-methyl-7- (2-oxopyrrolidin-1-yl)- 4,5-dihydro-3H-benzo- [2,3]azocino[4,5,6-hi]- indolizine-1-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00485] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 7.56 (d, J = 2.0 Hz, 1H), 7.40 (d, J = 7.8 Hz, 2H), 7.20 (dd, J = 7.3, 1.0 Hz, 1H), 7.15-7.08 (m, 2H), 7.06-7.00 (m, 3H), 6.28 (d, J = 15.3 Hz, 1H), 3.99-3.93 (m, 3H), 3.85- 3.75 (m, 6H), 3.64 (dd, J = 9.0, 3.5 Hz, 1H), 3.50-3.44 (m, 3H), 2.90-2.86 (m, 1H), 2.74-2.62 (m, 6H), 2.59-2.57 (m, 2H), 2.28-2.10 (m, 3H), 1.79-1.74 (m, 1H) 670.0 192 (S,E)-4-(2-(acetamido- methyl)azetidin-1-yl)-N- (2,6-difluoro-4-(9-meth- yl-7-(trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)but-2-enamide [00486] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.52 (brs, 1H), 7.46- 7.40 (m, 2H), 7.20-7.14 (m, 2H), 7.08-7.01 (m, 1H), 6.92 (dt, J = 15.5, 5.6 Hz, 1H), 6.23 (dt, J = 15.4, 1.7 Hz, 1H), 6.06 brm, 1H), 4.76 (dd, J = 10.5, 4.3 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.47-3.17 (m, 6H), 2.93- 2.78 (m, 2H), 2.58 (dd, J = 15.3, 2.3 Hz, 1H), 2.05 (s, 3H), 2.04- 1.93 (m, 2H) 707.2 193 (E)-N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-(1,4-oxazepan- 4-yl)but-2-enamide [00487] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (d, J = 7.0 Hz, 1H), 8.05 (s, 1H), 7.78 (s, 1H), 7.44 (s, 1H), 7.42 (s, 1H),7.21- 7.14 (m, 2H), 7.10-7.00 (m, 2H), 6.27 (d, J = 15.3 Hz, 1H), 4.76 (dd, J = 10.4, 4.6 Hz, 1H), 4.26- 4.19 (m, 1H), 3.97 (s, 3H), 3.83 (t, J = 6.0 Hz, 2H), 3.77-3.75 (m, 2H), 3.38-3.37 (m, 2H), 2.89-2.81 (m, 1H), 2.78-2.74 (m, 4H), 2.59 (dd, J = 15.1, 2.1 Hz, 1H), 1.97-1.91 (m, 2H) 680.0 194 (E)-N-(2,6-difluoro-4-(7- methoxy-9,10-dimethyl- 13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2::2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((1-methyl- cyclopropyl)amino)but-2- enamide [00488] W 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (dd, J = 6.9, 1.1 Hz, 1H), 7.39 (dt, J = 12.9, 2.5 Hz, 2H), 7.35 (dd, J = 7.2, 1.2 Hz, 1H), 7.15-7.09 (m, 2H), 7.03 (t, J = 7.1 Hz, 1H), 6.99 (s, 1H), 6.72 (s, 1H), 6.22 (d, J = 15.5 Hz, 1H), 4.79 (dd, J = 10.3, 4.5 Hz, 1H), 4.21-4.11 (m, 1H), 3.84 (d, J = 3.5 Hz, 3H), 3.74 (d, J = 5.5 Hz, 3H), 3.55 (dd, J = 5.1, 1.9 Hz, 2H), 3.07-2.99 (m, 1H), 2.62 (d, J = 2.8 Hz, 3H), 2.58 (dd, J = 15.1, 2.4 Hz, 1H), 0.61 (t, J = 4.9 Hz, 2H), 0.41 (dd, J = 6.1, 4.4 Hz, 2H) 626.0 195 (R,E)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- meth-yl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-(3- hydroxy-3-methylpiper- idin-1-yl)but-2-enamide [00489] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (d, J = 6.8 Hz, 1H), 8.05 (s, 1H), 7.78 (s, 1H), 7.44-7.42 (m, 3H), 7.19- 7.17 (m, 2H), 7.06-6.99 (m, 2H), 6.25 (d, J = 15.5 Hz, 1H), 4.76 (dd, J = 10.4, 4.6 Hz, 1H), 4.26- 4.19 (m, 1H), 3.97 (s, 3H), 3.24 (d, J = 5.5 Hz, 2H), 2.87-2.80 (m, 2H), 2.67-2.58 (m, 2H), 2.06-1.99 (m, 2H), 1.88-1.78 (m, 3H), 1.67-1.57 (m, 2H), 1.26 (td, J = 12.9, 4.4 Hz, 1H), 1.19 (s, 3H) 693.9 196 (S,E)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-(3- hydroxy-3-methylpiper- idin-1-yl)but-2-enamide [00490] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (d, J = 6.8 Hz, 1H), 8.05 (s, 1H), 7.78 (s, 1H), 7.44 (s, 1H), 7.42 (s, 1H), 7.36 (s, 1H), 7.19-7.17 (m, 2H), 7.05- 6.99 (m, 2H), 6.25 (d, J = 15.5 Hz, 1H), 4.76 (dd, J = 10.3, 4.5 Hz, 1H), 4.26-4.20 (m, 1H), 3.97 (s, 3H), 3.24 (d, J = 5.3 Hz, 2H), 2.87-2.80 (m, 2H), 2.68-2.58 (m, 2H), 2.07-2.00 (m, 2H), 1.88-1.79 (m, 3H), 1.67-1.57 (m, 2H), 1.32-1.23 (m, 1H), 1.19 (s, 3H) 694.0 197 (E)-4-((1R,5S)-3-oxa-8- azabicyclo[3.2.1]octan-8- yl)-N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]- benzo[1,2:2,3oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)but-2- enamide [00491] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.40 (m, 2H), 7.20- 7.15 (m, 2H), 7.12 (brs, 1H), 7.10-7.00 (m, 2H), 6.34 (dt, J = 15.2, 1.7 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.76 (d, J = 10.3 Hz, 2H), 3.55 (dd, J = 10.3, 1.8 Hz, 2H), 3.14 (dd, J = 5.3, 1.8 Hz, 2H), 3.08 (s, 2H), 2.89- 2.80 (m, 1H), 2.59 (dd, J = 15.3, 2.3 Hz, 1H), 1.93 (d, J = 1.8 Hz, 4H) 692.2 198 (E)-N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)but-2-enamide [00492] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.40 (m, 2H), 7.19- 7.15 (m, 2H), 7.08-7.01 (m, 2H), 6.93 (dt, J = 15.5, 5.0 Hz, 1H), 6.17 (dt, J = 15.3, 1.6 Hz, 1H), 4.80-4.73 (m, 5H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.45 (s, 4H), 3.23 (dd, J = 5.1, 1.9 Hz, 2H), 2.89-2.80 (m, 1H), 2.58 (dd, J = 15.4, 2.4 Hz, 1H) 678.4 201 (S,E)-N-(2,6-difluoro-4- (7-methoxy-9-(2-meth- oxyethyl)-10,12-dimeth- yl-9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00493] L CHIRALPAK IG(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 6.96, 1.08 Hz, 1H), 7.38 (d, J = 7.86 Hz, 2H), 7.28-7.24 (m, 2H), 7.14-7.08 (m, 2H), 7.03 (t, J = 7.08 Hz, 1H), 6.81 (s, 1H), 6.30 (d, J = 15.35 Hz, 1H), 4.33-4.23 (m, 2H), 3.98-3.93 (m, 1H), 3.86-3.79 (m, 2H), 3.77 (s, 3H), 3.75-3.72 (m, 2H), 3.65-3.62 (m, 1H), 3.54-3.45 (m, 4H), 3.36 (s, 3H), 3.06 (s, 3H), 2.90-2.83 (m, 1H), 2.63 (s, 3H), 2.58-2.43 (m, 2H), 2.18-2.09 (m, 1H), 1.80-1.72 (m, 1H) 699.2 202 (E)-N-(2,6-difluoro-4-(7- methoxy-9-(2-methoxy- ethyl)-12-methyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((1-methyl- cyclopropyl)amino)but- 2-enamide [00494] L CHIRALPAK ID(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.01 (dd, J = 6.92, 1,00 Hz, 1H), 7.90 (s, 1H), 7.38 (d, J = 7.88 Hz, 2H), 7.26-7.24 (m, 1H), 7.30-7.21 (brs, 1H), 7.16-7.09 (m, 2H), 7.04 (t, J = 7,07 Hz, 1H), 6.91 (s, 1H), 6.25 (dt, J = 15.36, 1.68 Hz, 1H), 4.33 (t, J = 5.18 Hz, 2H), 3,79-3.77 (m, 5H), 3.61-3.50 (m, 3H), 3.39 (s, 3H), 3.08 (s, 3H), 2.92-2.83 (m, 1H), 2.59-2.43 (m, 2H), 1.30 (s, 3H), 0.63-0.60 (m, 2H), 0.43- 0.40 (m, 2H) 669.2 203 (S,E)-N-(2,6-difluoro-4- (7-methoxy-9-(2-meth- oxyethyl)-12-methyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00495] S CHIRALPAK ID(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.01 (dd, J = 6.96, 1.04 Hz, 1H), 7.90 (s, 1H), 7.65- 7.70 (brs, 1H), 7.35 (d, J = 7.84 Hz, 2H), 7.27-7.25 (m, 1H), 7.14-7.08 (m, 2H), 7.04 (t, J = 7.06 Hz, 1H), 6.91 (s, 1H), 6.34 (d, J = 15.36 Hz, 1H), 4.33 (t, J = 5.16 Hz, 2H), 3.99-3.93 (m, 1H), 3.86-3.77 (m, 7H), 3.65- 3.62 (m, 1H), 3.53-3.45 (m, 4H), 3.39 (s, 3H), 3.08 (s, 3H), 2.92- 2.84 (m, 1H), 2.59-2.42 (m, 2H), 2.18-2.09 (m, 1H), 1.80-1.73 (m, 1H) 685.5 204 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((S)-2-((R)-1-hydroxyeth- yl)-2-methylpyrrolidin-1- yl)but-2-enamide or (E)- N-(4-(9,12-dimethyl-7- (trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((S)-2-((S)-1-hydroxyeth- [00496] S CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.46 (d, J = 7.8 Hz, 2H), 7.13-6.98 (m, 4H), 6.23 (d, J = 15.3 Hz, 1H), 3.96 (s, 3H), 3.72- 3.61 (m, 2H), 3.52 (q, J = 6.5 Hz, 1H), 3.46-3.43 (m, 1H), 3.21- 3.10 (m, 5H), 2.96-2.87 (m, 1H), 2.59-2.54 (m, 1H), 2.42 (dd, J = 16.6, 7.9 Hz, 1H), 2.32-2.24 (m, 1H), 1.99-1.93 (m, 1H), 1.77- 1.68 (m, 2H), 1.14 (m, 6H) 721.2 yl)-2-methylpyrrolidin-1- yl)but-2-enamide 205 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((S)-2-((S)-1-hydroxy- ethyl)-2-methylpyrrolidin- 1-yl)but-2-enamide or (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((S)-2-((R)-1-hydroxy- [00497] S CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.8, 1.3 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.48-7.44 (m, 2H), 7.13 (s, 1H), 7.07-6.98 (m, 3H), 6.20 (d, J = 15.5 Hz, 1H), 3.96 (s, 3H), 3,68-3.61 (m, 1H), 3.57 (q, J = 6.3 Hz, 1H), 3.51-3.42 (m, 2H), 3.26-3.21 (m, 1H), 3.11 (s, 3H), 2.98-2.87 (m, 2H), 2.59- 2.54 (m, 1H), 2.42 (q, J = 8.8 Hz, 1H), 2.28 (td, J = 13.9, 4.2 Hz, 1H), 2.11-2.04 (m, 1H), 1.85- 1.73 (m, 2H), 1.41-1.34 (m, 1H), 1.15 (d, J = 6.5 Hz, 3H), 0.92 (s, 3H) 721.3 ethyl)-2-methylpyrrolidin- 1-yl)but-2-enamide 206 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((1R,28,4S)-2-hydroxy-7- azabicyclo[2.2.1]heptan- 7-yl)but-2-enamide or (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((1S,2R,4R)-2-hydroxy- 7-azabicyclo[2.2.1]heptan- 7-yl)but-2-enamide [00498] S CHIRALPAK IC (hexane- ethanol (0.1% triethyl- amine)), 1st-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.45 (d, J = 7.8 Hz, 2H), 7.13-6.98 (m, 5H), 6.29 (d, J = 15.3 Hz, 1H), 3.96 (s, 3H), 3.72- 3.62 (m, 2H), 3.44 (dd, J = 10.3, 3.0 Hz, 1H), 3.36 (t, J = 4.3 Hz, 1H), 3.28-3.24 (m, 3H), 3.11 (s, 3H), 2.93-2.87 (m, 1H), 2.56 (dd, J = 14.8, 2.0 Hz, 1H), 2.28 (td, J = 14.0, 4.4 Hz, 1H), 1.78- 1.70 (m, 3H), 1.25-1.20 (m, 2H) 705.2 207 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((1S,2R,4R)-2-hydroxy- 7-azabicyclo[2.2.1]heptan- 7-yl)but-2-enamide or (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((1R,2S,4S)-2-hydroxy-7- azabicyclo[2.2.1]heptan- [00499] S CHIRALPAK IC (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 7.0, 1.3 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.46 (d, J = 7.8 Hz, 2H), 7.13-6,98 (m, 5H), 6.29 (d, J = 15.3 Hz, 1H), 3.96 (s, 3H), 3.72- 3.62 (m, 2H), 3.44 (dd, J = 10.0, 4.5 Hz, 1H), 3.36 (t, J = 4.4 Hz, 1H), 3.28-3.24 (m, 3H), 3.11 (s, 3H), 2.93-2.87 (m, 1H), 2.59- 2.51 (m, 1H), 2.30 (dd, J = 14.0, 4.3 Hz, 1H), 1.78-1.70 (m, 2H), 1.33-1.21 (m, 3H) 705.0 7-yl)but-2-enamide 208 (E)-4-((1S,4S)-2-oxa-5- azabicyclo[2.2.1]heptan- 5-yl)-N-(4-(9,12-dimeth- yl-7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)but-2- enamide [00500] S 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.45 (d, J = 7.8 Hz, 2H), 7.12 (s, 1H), 7.09-6.98 (m, 3H), 6.27 (d, J = 15.3 Hz, 1H), 4.45 (s, 1H), 4.04 (d, J = 8.0 Hz, 1H), 3.96 (s, 3H), 3.69-3.61 (m, 1H), 3.54 (s, 1H), 3.51-3.39 (m, 3H), 3.11 (s, 3H), 2.96-2.86 (m, 2H), 2.56 (dd, J = 15.0, 2.0 Hz, 1H), 2.28 (td, J = 13.9, 4.3 Hz, 1H), 1.90-1.88 (m, 1H), 1.78 (d, J = 10.0 Hz, 1H) 691.1 210 (E)-N-(2,6-difluoro-4- (9)-methoxy-7-(2-oxo- pyrrolidin-1-yl)-3,4- dihydrobenzo[2,3]oxo- cino[4,5,6-hi]indolizine- 1-carbonyl)phenyl)-4- ((1-methylcyclopropyl)- amino)but-2enamide [00501] E 1H-NMR (500 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 7.0, 1.2 Hz, 1H), 7.66 (d, J = 2.1 Hz, 1H), 7.38 (dd, J = 10.7, 2.7 Hz, 2H), 7.33 (dd, J = 7.2, 1.1 Hz, 1H), 7.15-7.10 (m, 2H), 7.04- 7.01 (m, 2H), 6.83 (d, J = 2.1 Hz, 1H), 6.22 (dt, J = 15.3, 1.8 Hz, 1H), 4.23 (dd,J = 10.7, 4.6 Hz, 1H), 4.14-4.06 (m, 1H), 3.91 (ddd, J = 17.6, 7.2, 2.5 Hz, 2H), 3.83 (s, 3H), 3.55 (dd, J = 4.9, 1.8 Hz, 2H), 3,12 (dd, J =13.3, 9.9 Hz, 1H), 2.67 (t, J = 8.1 Hz, 2H), 2.57 (dd, J =15.1, 2.3 Hz, 1H), 2.24-2.18 (m, 2H), 1.30 (s, 3H), 0.61 (dd, J = 5.6, 4.7 Hz, 2H), 0.41 (dd, J = 6.3, 4.4 Hz, 641.0 2H) 211 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((S)-2-((R)-1-hydroxy- ethyl)pyrrolidin-1-yl)but- 2-enamide [00502] S 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.46-7.40 (m, 2H), 7.19-6.97 (m, 5H), 6.25 (d, J = 15.5 Hz, 1H), 3.95 (s, 3H), 3.88 (qd, J = 6.4, 2.4 Hz, 1H), 3.67 (ddd, J = 15.8, 4.8, 1.9 Hz, 1H), 3.44 (ddd, J = 10.3, 4.4, 1.4 Hz, 1H), 3.25-3.20 (m, 1H), 3.15- 3.07 (m, 4H), 2.93-2.86 (m, 1H), 2.60-2.52 (m, 1H), 2.51-2.45 (m, 1H), 2.37-2.22 (m, 2H), 1.90- 1.82 (m, 1H), 1.79-1.66 (m, 3H), 1.14 (d, J = 6.3 Hz, 3H) 707.3 212 (E)-4-(3-oxa-6-azabicyclo- [3.1.1]heptan-6-yl)-N- (2,6-difluoro-4-(9-meth- yl-7-(trifluoromethyl)- 13,14-dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)but-2-enamide [00503] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.39 (m, 2H), 7.20- 7.15 (m, 2H), 7.12-7.01 (m, 3H), 6.29 (dt, J = 15.3, 1.8 Hz, 1H), 4,76 (dd, J = 10.5, 4.5 Hz, 1H), 4.28-4.16 (m, 3H), 3.97 (s, 3H), 3.77 (d, J = 10.8 Hz, 2H), 3.58 (d, J = 6.3 Hz, 2H), 3.54 (dd, J = 5.0, 1.8 Hz, 2H), 2.88-2.80 (m, 1H), 2.71 (dd, J = 14.0, 6.5 Hz, 1H), 2.58 (dd, J = 15.4, 2.4 Hz, 1H), 1.89 (d, J = 8.3 Hz, 1H) 678.1 213 (E)-N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((3aR,6aS)- tetrahydro-1H-furo[3,4- c]pyrrol-5(3H)-yl)but-2- enamide [00504] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.47-7.40 (m, 2H), 7.19- 7.15 (m, 2H), 7.14-7.01 (m, 3H), 6.25 (dt, J = 15.3, 1.5 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.81 (dd, J = 9.0, 6.8 Hz, 2H), 3.61 (dd, J = 8.9, 3.1 Hz, 2H), 3.27 (dd, J = 5.8, 1.5 Hz, 2H), 2.90-2.79 (m, 3H), 2.74 (dd, J = 9.0, 7.3 Hz, 2H), 2.59 (dd, J = 15.3, 2.3 Hz, 1H), 2.43 (dd, J = 9.0, 3.5 Hz, 2H) 692.2 214 (E)-N-(4-(9.12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((1- methylcyclopropyl)amino)- but-2-enamide [00505] S 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.44 (dt, J = 13.0, 2.4 Hz, 2H), 7.13 (dt, J = 15.5, 5.1 Hz, 2H), 7.05 (d, J = 7.3 Hz, 1H), 7.00 (t, J = 6.9 Hz, 1H), 6.25 (d, J = 15.5 Hz, 1H), 3.95 (s, 3H), 3.57 (dd, J = 5.3. 1.8 Hz, 2H), 3.43 (dd, J = 10.3, 3.0 Hz, 1H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.58-2.53 (m, 1H), 2.28 (td, J = 14,1, 4.2 Hz, 1H), 1.30 (s, 3H), 0.65 (brs, 2H), 0.43 (dd, J = 6.1, 4.4 Hz, 2H) 663.2 216 (E)-N-(4-(10,13-dimethyl- 7-(trifluoromethyl)-14,15- dihydro-13H-[1,2,4]- triazolo[4,3:1,2]pyrido- [3,4:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((3- methyloxetan-3-yl)- amino)but-2-enamide [00506] L CHIRALPAK IA(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1.0 Hz, 1H), 8.95 (s, 1H), 7.46- 7.42 (m, 2H), 7.18-7.09 (m, 3H), 7.02 (t, J = 7.0 Hz, 1H), 6.36- 6.31 (m, 1H), 4.59 (d, J = 6.3 Hz, 2H), 4.44 (d, J = 6.5 Hz, 2H), 3.54 (dd, J = 5.0, 1.8 Hz, 2H), 3.46-3.42 (m, 1H), 3.01 (s, 3H), 2.91-2.84 (m, 1H), 2.72- 2.67 (m, 3H), 2.65-2.63 (m, 1H), 2.46-2.38 (m, 1H), 1.52 (s, 3H) 680.2 218 (S,E)-N-(2,6-difluoro-4- (12-methyl-7-(trifluoro- methyl)-9,12,13,14-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:2,3]azocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-((tetra- hydrofuran-3-yl)amino)- but-2-enamide [00507] L CHIRALPAK IG(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.50-9.95 (brs, 1H), 9.97 (dd, J = 6.92, 1.04 Hz, 1H), 8.20 (s, 1H), 8.10-7.90 (brs, 1H), 7.43-7.40 (m, 3H), 7.16- 7.08 (m, 3H), 7.01 (t, J = 7.02 Hz, 1H), 6.34 (d, J = 15.36 Hz, 1H), 3.99-3.94 (m, 1H), 3.85- 3.78 (m, 2H), 3.66-3.63 (m, 1H), 3.51-3.44 (m, 3H), 3.41-3.30 (m, 1H), 3.10-2.83 (m, 4H), 2.55-2.52 (m, 1H), 2.35-2.25 (m, 1H), 2.19-2.10 (m, 1H), 1.80-1.71 (m, 1H) 665.1 219 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((S)-2-((S)-1-hydroxy- ethyl)pyrrolidin-1-yl)but- 2-enamide [00508] S 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 7.0, 1.0 Hz, 1H), 8.02 (s, 1H), 7.80 (s, 1H), 7.47-7.41 (m, 2H), 7.19- 6.97 (m, 5H), 6.27 (dt, J = 15.4, 1.6 Hz, 1H), 3.95 (s, 3H), 3.63 (ddd, J = 16.3, 4,9, 1.9 Hz, 1H), 3.47-3.34 (m, 3H), 3.14-3.06 (m, 4H), 2.93-2.86 (m, 1H), 2.66- 2.60 (m, 1H), 2.59-2.52 (m, 1H), 2.51-2.45 (m, 1H), 2.34-2.22 (m, 1H), 1.97-1.88 (m, 1H), 1.86- 1.72 (m, 2H), 1.57-1.49 (m, 1H), 1.16 (d, J = 6.3 Hz, 3H) 707.2 220 (E)-4-(2-oxa-5-aza- bicyclo[2.2.2]octan-5-yl)- N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)but-2-enamide [00509] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.39 (m, 2H), 7.22- 7.13 (m, 3H), 7.08-7.00 (m, 2H), 6.29 (dt, J = 15.3. 1.6 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.28 (dt, J = 9.1, 2.3 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.84 (dd, J = 9.1, 1.6 Hz, 1H), 3.80-3.75 (brm, 1H), 3.51-3.39 (m, 2H), 3.10 (dt, J = 10.8, 2.6 Hz, 1H), 3.01 (dd, J = 10.8, 1,8 Hz, 1H), 2.88-2.80 (m, 1H), 2.69-2.65 (brm, 1H), 2.63-2.56 (m, 1H), 2.14-2.02 (m, 2H), 1.83-1.70 (m, 2H) 692.2 221 (E)-4-(3-oxa-9-azabicyclo- [3.3.1]nonan-9-yl)-N- (2,6-difluoro-4-(9-methyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo[4,5: 5,6]benzo[1,2:2,3]oxo- cino[4,5,6-hi]indolizine-2- carbonyl)phenyl)but-2- enamide [00510] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.40 (m, 2H), 7.20- 7.14 (m, 2H), 7.08-6.97 (m, 3H), 6.31 (dt, J = 15.3, 1.6 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.26-4.19 (m, 1H), 4.00 (dt, J = 11.0, 2.3 Hz, 2H), 3.97 (s, 3H), 3.82 (d, J = 11.3 Hz, 2H), 3.58 (dd, J = 5.3, 1.8 Hz, 2H), 2.89- 2.80 (m, 1H), 2.64-2.55 (m, 3H), 2.54-2.41 (m, 1H), 2.10-1.97 (m, 2H), 1.69-1.50 (m, 3H) 706.2 222 (S,E)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)-4-(2- (hydroxymethyl)piperidin- 1-yl)but-2-enamide [00511] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1,0 Hz, 1H), 8.04 (s, 1H), 7.78 (s, 1H), 7.44 (t, J = 7.8 Hz, 2H), 7.19-6.95 (m, 4H), 6.23 (d, J = 15.5 Hz, 1H), 4.77 (dd, J = 10.6, 4.4 Hz, 1H), 4.26-4.20 (m, 1H), 3.97 (s, 3H), 3.81 (dd, J = 11.3, 4.0 Hz, 1H), 3.68-3.62 (m, 1H), 3.51 (dd, J = 11.0, 3.5 Hz, 1H), 3.28-3.22 (m, 1H), 2.98 (dd, J = 15.8, 3.8 Hz, 1H), 2.89-2.81 (m, 1H), 2.65-2.57 (m, 1H), 2.46 (dd, J = 8.9, 3.9 Hz, 1H), 2.36- 2.30 (m, 1H), 1.67-1.42 (m, 6H) 694.2 223 (E)-N-(4-(10,13-dimethyl- 7-(trifluoromethyl)-14,15- dihydro-13H-[1,2,4]- triazolo[4,3:1,2]- pyrido[3,4:2,3]azocino- [4,5,6-hi]indolizine-2- carbonyl)-2,6-difluoro- phenyl)-4-((1-methyl- cyclopropyl)amino)but- 2-enamide [00512] L CHIRALPAK IA(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1.0 Hz, 1H), 8.95 (s, 1H), 7.41 (d, J = 8.0 Hz, 2H), 7.30 (brs, 1H), 7.17-7.09 (m, 3H), 7.02 (t, J = 7.0 Hz, 1H), 6.28-6.24 (m, 1H), 3.56 (dd, J = 5.1, 1.9 Hz, 2H), 3.45-3.42 (m, 1H), 3.01 (s, 3H), 2.94-2.84 (m, 1H), 2.68 (s, 3H), 2.65-2.64 (m, 1H), 2.46- 2.39 (m, 1H), 1.30 (s, 3H), 0.62 (dd, J = 5.8, 4.5 Hz, 2H), 0.42 (dd, J = 6.1, 4.4 Hz, 2H) 664.3 225 (E)-N-(2,6-difluoro-4-(7- methoxy-9,10-dimethyl- 13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]thiocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((1-methyl- cyclopropyl)amino)but- 2-enamide [00513] V 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.01 (dd, J = 7.0, 1.0 Hz, 1H), 7.42-7.39 (m, 2H), 7.17-7.09 (m, 3H), 7.04 (t, J = 7.0 Hz, 1H), 6.95 (s, 2H), 6.21 (dt, J = 15.3, 1.8 Hz, 1H), 3.80 (s, 3H), 3.77 (s, 3H), 3.56-3.54 (m, 2H), 3.28-3.24 (m, 1H), 2.80 (dd, J = 14.4, 2.6 Hz, 1H), 2.67 (s, 3H), 2.55-2.51 (m, 1H), 2.36- 2.32 (m, 1H), 1.29 (s, 3H), 0.60 (dd, J = 6.0, 4.5 Hz, 2H), 0.41 (dd, J = 6.2, 4.6 Hz, 2H) 641.9 226 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- (pyrrolidin-1-yl)but-2- enamide [00514] S 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.47-7.44 (m, 1H), 7.12- 6.98 (m, 5H), 6.26 (d, J = 15.3 Hz, 1H), 3.96 (s, 3H), 3.68-3.62 (m, 1H), 3.44 (dd, J = 10.3, 2.8 Hz, 1H), 3.36 (dd, J = 5.8, 1.5 Hz, 2H), 3.11 (s, 3H), 2.93-2.86 (m, 1H), 2.63-2.54 (m, 5H), 2.28 (td, J = 14.0, 4.4 Hz, 1H), 1.88- 1.83 (m, 4H) 663.4 227 (S,E)-N-(4-(9,12-dimeth- yl-7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-(2- (hydroxymethyl)pyrrol- idin-1-yl)but-2-enamide [00515] S 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.47-7.43 (m, 2H), 7.13- 6.98 (m, 4H), 6.25 (d, J = 15.5 Hz, 1H), 3.96 (s, 3H), 3.69-3.62 (m, 3H), 3.47-3.42 (m, 2H), 3.24-3.16 (m, 2H), 3.11 (s, 3H), 2.93-2.87 (m, 1H), 2.78-2.73 (m, 1H), 2.62-2.54 (m, 1H), 2.40- 2.24 (m, 2H), 1.98-1.90 (m, 1H), 1.82-1.76 (m, 2H) 693.5 228 (E)-4-(6-oxa-3-azabicyclo- [3.2.1]octan-3-yl)-N- (2,6-difluoro-4-(9-methyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)but-2-enamide [00516] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (d, J = 7.0 Hz, 1H), 8.05 (s, 1H), 7.78 (s, 1H), 7.44 (s, 1H), 7.42 (s, 1H), 7.34 (s, 1H), 7.19-7.16 (m, 2H), 7.08- 7.00 (m, 2H), 6.32 (d, J = 15.3 Hz, 1H), 4.76 (dd, J = 10.4, 4.6 Hz, 1H), 4.30 (t, J = 4.8 Hz, 1H), 4.25-4.20 (m, 1H), 4.11 (d, J = 7.0 Hz, 1H), 3.97 (s, 3H), 3.82- 3.79 (m, 1H), 3.34-3.21 (m, 2H), 3.01 (dd, J = 10.8, 3,5 Hz, 1H), 2.92-2.80 (m, 2H), 2.63-2.57 (m, 1H), 2.45 (d, J = 4.0 Hz, 1H), 2.35 (d, J = 10.5 Hz, 1H), 2.14 (d, J = 11.0 Hz, 1H), 1.93-1.90 (m, 1H), 1.61 (d, J = 11.0 Hz, 1H) 691.9 229 (E)-4-(2-oxa-6-azabicyclo- [3.2.1]octan-6-yl)-N-(2,6- difluoro-4-(9-methyl-7- (trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)but-2-enamide [00517] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (d, J = 7.0 Hz, 1H), 8.05 (s, 1H), 7.77 (s, 1H), 7.43 (s, 1H), 7.41 (s, 1H), 7.36 (s, 1H), 7.18-7.08 (m, 3H), 7.05- 7.00 (m, 1H), 6.34 (d, J = 15.5 Hz, 1H), 4.76 (dd, J = 10.3, 4.5 Hz, 1H), 4.22 (t, J = 10.5 Hz, 1H), 3.97 (s, 3H), 3.91 (d, J = 11.5 Hz, 1H), 3.69-3.57 (m, 4H), 3.50 (d, J = 11.3 Hz, 1H), 3.20 (dd, J = 9.3, 5.8 Hz, 1H), 3.10-3.04 (m, 1H), 2.87-2.80 (m, 2H), 2.59 (d, J = 13.5 Hz, 1H), 2.31-2.24 (m, 1H), 2.05-2.03 (m, 1H), 1.80-1.77 (m, 1H) 691.9 230 (E)-4-(3-oxa-6-azabicyclo- [3.2.1]octan-6-yl)-N-(2,6- difluoro-4-(9-methyl-7- (trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)but-2-enamide [00518] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (d, J = 7.0 Hz, 1H), 8.05 (s, 1H), 7.78 (s, 1H), 7.44 (s, 1H), 7.42 (s, 1H), 7.18-7.17 (m, 2H), 7.12-7.00 (m, 2H), 6.33 (d, J = 15.3 Hz, 1H), 4.76 (dd, J = 10.4, 4.6 Hz, 1H), 4.47-4.41 (m, 1H), 4.26- 4.20 (m, 1H), 3.97 (s, 3H), 3.88- 3.82 (m, 2H), 3.59-3.48 (m, 2H), 3.41-3.35 (m, 1H), 3.18 (d, J = 12.0 Hz, 1H), 2.94 (dd, J = 12.1, 3.9 Hz, 1H), 2.89-2.80 (m, 1H), 2.59 (d, J = 15.0 Hz, 1H), 1.81- 1.62 (m, 4H) 691.8 231 (S,E)-N-(2,6-difluoro-4- (7-methoxy-10-(methoxy- methyl)-1,9,12-trimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00519] I CHIRALPAK IG(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.88 (dd, J = 7.0, 1.0 Hz, 1H), 7.23-7.07 (m, 4H), 6.93 (t, J = 7.1 Hz, 1H), 6.81 (s, 1H), 6.34 (d, J = 15.5 Hz, 1H), 4.75 (dd, J = 17.8, 12.5 Hz, 2H), 3.95 (q, J = 7.6 Hz, 1H), 3.86- 3.76 (m, 8H), 3.64 (dd, J = 9.0, 3.8 Hz, 1H), 3.50-3.41 (m, 7H), 3.09 (s, 3H), 2.79-2.73 (m, 1H), 2.58-2.52 (m, 1H), 2.35-2.26 (m, 1H), 2.18-2.09 (m, 1H), 1.86 (s, 3H), 1.80-1.73 (m, 1H) 699.0 232 (E)-N-(2,6-difluoro-4-(7- (2-oxooxazolidin-3-yl)-9- (trifluoromethyl)-3.4- dihydrobenzo[2,3]oxo- cino-[4,5,6-hi]indolizine- 1-carbonyl)phenyl)-4-((1- methylcyclopropyl)amino)- but-2-enamide [00520] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.98 (dd, J = 7.0, 1.0 Hz, 1H), 7.84 (d, J = 2.5 Hz, 1H), 7.69 (d, J = 2.5 Hz, 1H), 7.43-7.39 (m, 2H), 7.18-7.10 (m, 3H), 7.04-7.00 (m, 2H), 6.23 (dt, J = 15.3, 1.8 Hz, 1H), 4.60-4.56 (m, 2H), 4.26 (dd, J = 10.6, 4.4 Hz, 1H), 4.18-4.13 (m, 3H), 3.56-3.49 (m, 2H), 2.99-2.90 (m, 1H), 2.60 (dd, J = 14.9, 2.4 Hz, 1H), 1.30 (s, 3H), 0.61 (dd, J = 5.9, 4.6 Hz, 2H), 0.41 (dd, J = 6.3, 4.3 Hz, 2H) 680.8 233 (E)-N-(2,6-difluoro-4-(7- (2-oxoimidazolidin-1-yl)- 9-(trifluoromethyl)-3,4- dihydrobenzo[2,3]oxo- cino[4,5,6-hi]indolizine- 1-carbonyl)phenyl)-4-((1- methylcyclopropyl)- amino)but-2-enamide [00521] E 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.96 (dd, J = 7.0, 1.0 Hz, 1H), 7.82 (d, J = 2.3 Hz, 1H), 7.71 (d, J = 2.3 Hz, 1H), 7.43-7.38 (m, 2H), 7.17-7.10 (m, 4H), 7.03-6.99 (m, 1H), 6.24 (dt, J = 15.3, 1.8 Hz, 1H), 4.93 (s, 1H), 4.25 (dd, J = 10.6, 4.4 Hz, 1H), 4.15-4.01 (m, 3H), 3.67 (t, J = 8.0 Hz, 2H), 3,56- 3.49 (m, 2H), 2.99-2.91 (m, 1H), 2.56 (dd, J = 15.3, 2.0 Hz, 1H), 1.30 (s, 3H), 0.61 (dd, J = 5.9, 4.6 Hz, 2H), 0.42 (dd, J = 6.3, 4.5 Hz, 2H) 679.8 234 (E)-4-(2-azabicyclo- [2.2.1]heptan-2-yl)-N- (2,6-difluoro-4-(9-meth- yl-7-(trifluoromethyl)- 13,14-dihydro-9H- imidazo-[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)but-2- enamide [00522] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.39 (m, 2H), 7.19-7.14 (m, 2H), 7.10-7.01 (m, 3H), 6.24 (dt, J = 15.3, 1.8 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.38-3.23 (m, 3H), 2.90-2.75 (m, 2H), 2.58 (dd, J = 15.4, 2.4 Hz, 1H), 2.37 (brs, 1H), 2.31 (d, J = 9.0 Hz, 1H), 1.78-1.71 (m, 1H), 1.69-1.42 (m, 3H), 1.35-1.27 (m, 2H) 676.2 235 (E)-4-((1R,5S)-8- azabicyclo[3.2.1]octan- 8-yl)-N-(2,6-difluoro-4- (9-methyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)phenyl)but-2- enamide [00523] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 0.8 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.40 (m, 2H), 7.20- 7.14 (m, 2H), 7.11-7.01 (m, 3H), 6.29 (dt, J = 15.3, 1.8 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.26-4.19 (m, 1H), 3.97 (s, 3H), 3.24-3.16 (m, 4H), 2.89-2.80 (m, 1H), 2.59 (dd, J = 15.3, 2.3 Hz, 1H), 1.99-1.87 (m, 2H), 1.82- 1.70 (m, 2H), 1.65-1.44 (m, 4H), 1.43-1.35 (m, 2H) 690.2 236 (E)-4-(7-azabicyclo[2.2.1]- heptan-7-yl)-N-(2,6- difluoro-4-(9-methyl-7- (trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)but-2-enamide [00524] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.1, 0.6 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.39 (m, 2H), 7.20- 7.15 (m, 2H), 7.14-7.06 (m, 2H), 7.03 (dd, J = 7.0, 7.0 Hz, 1H), 6.29 (dt, J = 15.3, 1.6 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.35-3.31 (m, 2H), 3.22 (dd, J = 5,4, 1.6 Hz, 2H), 2.88-2.80 (m, 1H), 2.58 (dd, J = 15.3, 2.5 Hz, 1H), 1.84-1.70 (m, 4H), 1.37- 1.30 (m, 4H) 676.2 237 (S,E)-N-(2,6-difluoro-4- (5-fluoro-7-methoxy- 9,10,12-trimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00525] L CHIRALPAK IE(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.02 (q, J = 2.5 Hz, 1H), 7.41 (d, J = 8.0 Hz, 2H), 7.20-7.08 (m, 3H), 6.77 (s, 1H), 6.28 (d, J = 15.3 Hz, 1H), 3.96 (dd, J = 14.9, 7.9 Hz, 1H), 3.84-3.79 (m, 5H), 3.74 (s, 3H), 3.68-3.62 (m, 1H), 3.54-3.44 (m, 4H), 3.06 (s, 3H), 2.88-2.81 (m, 1H), 2.62-2.54 (m, 4H), 2.43 (td, J = 13.8, 4.4 Hz, 1H), 2.18- 2.10 (m, 1H), 1.80-1.72 (m, 1H) 673.7 238 (E)-N-(2,6-difluoro-4-(5- fluoro-7-methoxy-9,10,12- trimethyl-9,12,13,14- tetrahydroimidazo[4,5: 5,6]benzo[1,2:2,3]- azocino[4,5,6-hi]indol- izine-2-carbonyl)phenyl)- 4-11-methylcyclopropyl)- amino)but-2-enamide [00526] L CHIRALPAK IE(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.01 (dd, J = 5.5, 2.3 Hz, 1H), 7.40 (d, J = 8.0 Hz, 2H), 7.21-7.08 (m, 3H), 6.77 (s, 1H), 6.21 (d, J = 15.5 Hz, 1H), 3.82 (s, 3H), 3.75 (s, 3H), 3.56- 3.51 (m, 3H), 3.06 (s, 3H), 2.88- 2.81 (m, 1H), 2.62 (s, 3H), 2.58- 2.54 (m, 1H), 2.43 (td, J = 13.8, 4.5 Hz, 1H), 1.29 (s, 3H), 0.61 (t, J = 5.0 Hz, 2H), 0.41 (dd, J = 6.3, 4.3 Hz, 2H) 657.1 239 (E)-N-(2,6-difluoro-4-(12- methyl-7-(trifluorometh- yl)-9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((1-methyl- cyclopropyl)amino)but-2- enamide [00527] L CHIRALPAK IE(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.92, 0.96 Hz, 1H), 9.70-9.62 (brs, 0.7H), 9.62-9.55 (brs, 0.3H), 8.30-8.25 (brs, 0.3H), 8.21 (s, 1H), 7.95-7.90 (brs, 0.7H), 7.44 (d, J = 7.92 Hz, 2H), 7.17-6.99 (m, 4H), 6.93 (s, 1H), 6.22 (dt, J = 15.32, 1.80 Hz, 1H), 4.30 (t, J = 6.70 Hz, 0.3H), 3.75-3.70 (m, 0.7H), 3.56-3.55 (m, 2H), 3.50- 3.12 (m, 3H), 2.92-2.87 (m, 2H), 2.58-2.55 (m, 1H), 2.46-2.25 (m, 1H), 1.29 (s, 3H), 0.62-0.59 (m, 2H), 0.42-0.40 (m, 2H) 649.1 241 (E)-N-(2,6-difluoro-4-(7- methoxy-9-(2-methoxy- ethyl)-10-methyl-12- oxido-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]thiocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((1-methylcyclo- propylamino)but-2-en- amide [00528] V 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.01 (dd, J = 7.0, 1.0 Hz, 1H), 7.38-7.34 (m, 3H), 7.19 (d, J = 7.0 Hz, 1H), 7.15- 7.06 (m, 3H), 6.24 (dt, J = 15.3, 1.9 Hz, 1H), 4.37-4.31 (m, 2H), 3.81 (t, J = 8.4 Hz, 3H), 3.74- 3.68 (m, 3H), 3.62-3.53 (m, 3H), 3.33 (s, 3H), 2.89-2.84 (m, 1H), 2.70 (d, J = 10.3 Hz, 3H), 2.40- 2.32 (m, 1H), 1.29 (s, 3H), 0.60 (dd, J = 5.9, 4.6 Hz, 2H), 0.40 (dd, J = 6.4. 4.4 Hz, 2H) 701.9 242 (S,E)-N-(4-(10,13-dimeth- yl-7-(trifluoromethyl)- 14,15-dihydro-13H- imidazo[1,2:1,2]pyrido- [3,4:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((tetrahydrofuran-3-yl)- amino)but-2-enamide [00529] L CHIRALPAK IA(hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 8.35 (s, 1H), 7.57 (d, J = 1.0 Hz, 1H), 7.46-7.42 (m, 2H), 7.15-7.09 (m, 4H), 7.01 (t, J = 7.0 Hz, 1H), 6.29 (dt, J = 15.3, 1.8 Hz, 1H), 3.96 (dd, J = 14.9, 7.9 Hz, 1H), 3.85-3.73 (m, 2H), 3.67-3.62 (m, 1H), 3.56- 3.44 (m, 4H), 3.04 (s, 3H), 2.90- 2.83 (m, 1H), 2.65-2.61 (m, 1H), 2.59 (s, 3H), 2.50-2.42 (m, 1H), 2.19-2.09 (m, 1H), 1.80-1.73 (m, 1H) 679.1 243 (E)-2-(3,5-difluoro-4-(4- ((1-methylcyclopropyl)- amino)but-2-enamido)- benzoyl)-7-methoxy-9- (2-methoxyethyl)-10- (methoxymethyl)-12- methyl-9,12,13,14-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:2,3]azocino- [4,5,6-hi]indolizine 11- oxide [00530] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 7.0, 1.0 Hz, 1H), 7.43-7.39 (m, 2H), 7.26-7.24 (m, 1H), 7.17-7.10 (m, 2H), 7.03 (t, J = 7.1 Hz, 1H), 6.95 (s, 1H), 6.81 (s, 1H), 6.22 (dt, J = 15.3, 1.9 Hz, 1H), 5.54 (d, J = 10.0 Hz, 1H), 5.38 (d, J = 9.8 Hz, 1H), 4.13-4.08 (m, 2H), 3.75-3.72 (m, 5H), 3.58-3.55 (m, 3H), 3.39 (s, 3H), 3.38 (s, 3H), 2.79-2.72 (m, 2H), 2.50- 2.47 (m, 1H), 2.46 (s, 3H), 1.30 (s, 3H), 0.61 (dd, J = 5.6, 4.6 Hz, 2H), 0.41 (dd, J = 6.3, 4.5 Hz, 2H) 729.1 244 (E)-N-(2,6-difluoro-4-(7- methoxy-9-(2-methoxy- ethyl)-10-(methoxymeth- yl)-12-methyl-9,12,13,14- tetrahydroimidazo[4,5: 5,6]benzo[1,2:2,3]- azocino[4,5,6-hi]indol- izine-2-carbonyl)phenyl)- 4-((1-methylcyclopropyl- amino)but-2-enamide [00531] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (d, J = 6.8 Hz, 1H), 7.38 (s, 1H), 7.36 (s, 1H), 7.26-7.24 (m, 1H), 7.16- 7.08 (m, 2H), 7.03 (t, J = 7.0 Hz, 1H), 6.90 (s, 1H), 6.25 (d, J = 15.5 Hz, 1H), 4.77 (s, 2H), 4.49- 4.36 (m, 2H), 3.79-3.75 (m, 5H), 3.56-3.52 (m, 3H), 3.44 (s, 3H), 3.36 (s, 3H), 3.07 (s, 3H), 2.90- 2.84 (m, 1H), 2.57-2.43 (m, 2H), 1.30 (s, 3H), 0.63-0.61 (m, 2H), 0.43-0.40 (m, 2H) 713.0 245 (E)-N-(2,6-difluoro-4-(7- methoxy-9,10,12-trimeth- yl-9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((1-methyl- cyclopentyl)amino)but-2- enamide [00532] L 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.99 (dd, J = 6.9, 0.9 Hz, 1H), 7.43-7.39 (m, 2H), 7.24 (dd, J = 7.1. 1.1 Hz, 1H), 7.15 (dt, J = 15.3, 5.1 Hz, 1H), 7.09 (s, 1H), 7.04-7.00 (m, 1H), 6.92 (s, 1H), 6.77 (s, 1H), 6.28 (d, J = 15.3 Hz, 1H), 3.79 (s, 3H), 3.73 (s, 3H), 3.54-3.50 (m, 1H), 3.45 (d, J = 3.8 Hz, 2H), 3.07 (s, 3H), 2.90-2.83 (m, 1H), 2.62 (s, 3H), 2.58-2.42 (m, 2H), 1.73-1.63 (m, 8H), 1.21 (s, 3H) 667.0 247 (S,E)-N-(2,6-difluoro-4- (7-methoxy-9-(2-meth- oxyethyl)-10-(methoxy- methyl)-12-methyl- 9,12,13,14-tetrahydro- imidazo[4,5,5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((tetrahydro- furan-3-yl)amino)but-2- enamide [00533] L CHIRALPAK IE (hexane- ethanol (0.1% triethyl- amine)), 2nd-eluting isomer 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (d, J = 6.8 Hz, 1H), 7.39 (s, 1H), 7.37 (s, 1H), 7.25 (s, 1H), 7.14-7.09 (m, 2H), 7.03 (t, J = 7.0 Hz, 1H), 6.90 (s, 1H), 6.30 (d, J = 15.3 Hz, 1H), 4.77 (s, 2H), 4.49-4.36 (m, 2H), 3.96 (q, J = 7.6 Hz, 1H), 3.86- 3.81 (m, 2H), 3.79-3.75 (m, 5H), 3.63 (dd, J = 9.0, 3.8 Hz, 1H), 3.55-3.46 (m, 4H), 3.44 (s, 3H), 3.36 (s, 3H), 3.07 (s, 3H), 2.90- 2.84 (m, 1H), 2.57-2.43 (m, 2H), 2.18-2.10 (m, 1H), 1.80-1.72 (m, 1H) 729.0 248 (E)-N-(2,6-difluoro-4-(9- methyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)-4-((3aR,6aR)- tetrahydro-1H-furo[3,4-c]- pyrrol-5(3H)-yl)but-2- enamide and (E)-N-(2,6- difluoro-4-(9-methyl-7- (trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]-oxocino[4,5,6-hi]- indolizine-2-carbonyl)- phenyl)-4-((3aS,6aS)- tetrahydro-1H-furo[3,4- c]pyrrol-5(3H)-yl)but-2- enamide [00534] N 1H-NMR (400 MHz, CHLORO- FORM-D) ? 10.00 (dd, J = 7.0, 1.0 Hz, 1H), 8.04 (s, 1H), 7.77 (s, 1H), 7.46-7.39 (m, 2H), 7.19- 7.15 (m, 2H), 7.14-7.01 (m, 3H), 6.26 (dt, J = 15.3, 1.6 Hz, 1H), 4.76 (dd, J = 10.5, 4.5 Hz, 1H), 4.25-4.19 (m, 1H), 3.97 (s, 3H), 3.92 (dd, J = 6.8, 6.8 Hz, 2H), 3.63-3.50 (m, 2H), 3.43 (dd, J = 10.5, 7.5 Hz, 2H), 2.94 (dd, J = 8.8, 6.3 Hz, 2H), 2.89-2.80 (m, 1H), 2.70 (dd, J = 10.6, 8.9 Hz, 2H), 2.58 (dd, J = 15.4, 2.4 Hz, 1H), 2.54-2.43 (m, 2H) 692.1 249 (E)-N-(4-(9,12-dimethyl- 7-(trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)-4-((3- methylthietan-3-ylamino)- but-2-enamide [00535] S 1H-NMR (400 MHz, CHLORO- FORM-D) ? 9.97 (dd, J = 6.9, 1.1 Hz, 1H), 8.03 (s, 1H), 7.80 (s, 1H), 7.46-7.42 (m, 2H), 7.18- 6.98 (m, 5H), 6.31 (d, J = 15.5 Hz, 1H), 3.95 (s, 3H), 3.51 (dd, J = 5.1, 1,9 Hz, 2H), 3.45-3.42 (m, 1H), 3.37 (d, J = 9.5 Hz, 2H), 3.11 (s, 3H), 2.96-2.92 (m, 2H), 2.90-2.86 (m, 1H), 2.56 (dd, J = 15,0, 2.0 Hz, 1H), 2.28 (td, J = 14.0, 4.3 Hz, 1H), 1.57 (s, 3H) 695.0 250 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- dolizine-2-carbonyl)-2,6- difluorophenyl)-3-(pyrrol- idin-2-yl)acrylamide [00536] X Column IZ, 21 ? 250 mm, 5 um Modifier: 45% MeOH w/0.1% NH4OH; Second eluting isomer 650 251 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-3- (pyrrolidin-2-yl)acryl- amide [00537] X Column IZ, 21 ? 250 mm, 5 um Modifier: 45% MeOH w/0.1% NH4OH; First eluting isomer 650 253 mono((E)-2-(4-(4-(6-oxa- 2-azaspiro[3.5]nonan-2- ium-2-yl)but-2-enamido)- 3,5-difluorobenzoyl)-9,10- dimethyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizin-11-ium) mono- (2,2,2-trifluoroacetate) [00538] E Derived from single atropisomer Int AA 720 254 mono(2-(4-((E)-4-((2S)- 2-(2-(dimethylamino)-2- oxoethyl)azetidin-1-ium- 1-yl)but-2-enamido)-3,5- difluorobenzoyl)-9,10- dimethyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizin-11-ium) mono(2,2,2-trifluoro- acetate) [00539] N Derived from single atropisomer Int AA 735 255 mono(2-(3,5-difluoro-4- ((E)-4-((28)-2-(1-hydroxy- cyclopropyl)pyrrolidin-1- ium-1-yl)but-2-enamido)- benzoyl)-9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizin-11-ium) mono- (2,2,2-trifluoroacetate) [00540] N Derived from single atropisomer Int AA 720 256 mono(2-(3,5~difluoro-4- ((E)-4-((2S)-2-(hydroxy- methyl)pyrrolidin-1-ium- 1-yl)but-2-enamido)ben- zoyl)-9,10-dimethyl-7- (trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizin-11-ium) mono- (2,2,2-trifluoroacetate) [00541] N Derived from single atropisomer Int AA 694 257 mono(2-(4-((E)-4- ((1S,4S)-2-oxa-5-aza- bicyclo-[2.2.1]heptan-5- ium-5-yl)but-2-enamido)- 3,5-difluorobenzoyl)-9,10- dimethyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizin-11-ium) mono(2,2,2-trifluoro- acetate) [00542] N Derived from single atropisomer Int AA 692 258 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((2S)-2-(1-hydroxyethyl)- 2-methylpyrrolidin-1-yl)- but-2-enamide [00543] N Column & Dimensions: IA, 21 ? 250 mm, 5 um; Modifier: 45% MeOH w/0.1% NH4OH; Peak 1 (Derived from single atropisomer Int AA) 722 259 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((2S)-2-(1-hydroxyethyl)- 2-methylpyrrolidin-1-yl)- but-2-enamide [00544] N Column & Dimensions: IA, 21 ? 250 mm, 5 um; Modifier: 45% MeOH w/0.1% NH4OH; Peak 2 (Derived from single atropisomer Int AA) 722 260 (2S,4R)-2-((E)-3-((4- (9,10-dimethyl-7-(tri- fluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)- amino)-3-oxoprop-1-en- 1-yl)-4-fluoropyrrolidin- 1-ium 2,2,2-trifluoro- acetate [00545] X 668 261 (Z)-N-(4-((4-(9,10-dimeth- yl-7-(trifluoromethyl)- 13,14-dihydro-9H-imid- azo[4,5:56]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)amino)- 3-fluoro-4-oxobut-2-en-1- yl)-1-methylcyclopropan- 1-aminium2,2,2-trifluoro- acetate [00546] X 668 262 (2S)-1-((Z)-4-((4-(9,10- dimethyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3loxocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)amino)- 3-fluoro-4-oxobut-2-en-1- yl)-2-(hydroxymethyl)- azetidin-1-ium2,2,2- trifluoroacetate [00547] Y 699 263 mono(2-(4-((E)-4-(((1r, 4r)-4-methoxycyclohexyl)- ammonio)but-2-enamido)- benzoyl)-8,9-dimethyl-6- (trifluoromethyl)-12,13- dihydro-8H-imidazo- [4,5:3,4]benzo[1,2: 7,8][1,4]oxazocino[6,5,4- hi]indol-10-ium) mono-(2,2,2-trifluoroacetate) [00548] B 686 264 (1R,2S)-N-((E)-4-((4- (9,10-dimethyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3loxocino- [4,5,6-hi]indolizine-2- carbonyl)-2,6-difluoro- phenyl)amino)-4-oxobut- 2-en-1-yl)-2-hydroxy- cyclohexan-1-aminium 2,2,2-trifluoroacetate [00549] N Derived from single atropisomer Int AA 708 265 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- (((1S,2R)-2-hydroxy- cyclohexylamino)but-2- enamide [00550] N Derived from single atropisomer Int AA 708 266 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- (((1S,2R)-2-methoxy- cyclohexyl)amino)but-2- enamide [00551] N Derived from single atropisomer Int AA 722 267 mono((E)-2-(3,5-difluoro- 4-(4-((4-methyltetrahydro- 2H-pyran-4-yl)ammonio)- but-2-enamido)benzoyl)- 9,10-dimethyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizin-11- ium)mono(2,2,2-trifluoro- acetate) [00552] N Derived from single atropisomer Int AA 708 268 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- (((1R,2S)-2-methoxy- cyclohexyl)amino)but-2- enamide [00553] N Derived from single atropisomer Int AA 722 269 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((tetrahydrofuran-3-yl)- amino)but-2-enamide [00554] N Column: DAICEL CHIRALCEL OD- H(250 mm * 30 mm, 5 um), Condition: 0.1% NH.sub.3H.sub.2O MeOH, Peak 1 (Derived from single atropisomer Int AA) 680 270 (E)-N-(4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- ((tetrahydrofuran-3-yl)- amino)but-2-enamide [00555] N Column: DAICEL CHIRALCEL OD- H(250 mm * 30 mm, 5 um), Condition: 0.1% NH.sub.3H.sub.2O MeOH, Peak 2 (Derived from single atropisomer Int AA) 680 271 (E)-N-(4-(9,13-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-4- (((S)-tetrahydrofuran-3- yl)amino)but-2-enamide [00556] F Column DAICEL CHIRALCEL OD- H(250 mm * 30 mm, 5 um) Condition 0.1% NH.sub.3H.sub.2O IPA, Peak 1 680 272 mono((E)-2-(3,5-difluoro- 4-(4-((3-methyloxetan-3- yl)ammonio)but-2-en- amido)benzoyl)-9,10,13- trimethyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizin-11- ium) mono(2,2,2- trifluoroacetate) [00557] F Derived from P1 after cyclization (silica column); Derived from P2 of aniline intermediate: SFC Column Phenomenex-Cellulose-2 (250 mm * 30 mm, 10 um), Condition 0.1% NH.sub.3H.sub.2O MeOH 694 273 mono((E)-2-(3,5-difluoro- 4-(4-((3-methyloxetan-3- yl)ammonio)but-2-en- amido)benzoyl)-9,10,13- trimethyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizin-11-ium) mono(2,2,2-trifluoro- acetate) [00558] F Derived from P2 after cyclization (silica column); Derived from P2 of aniline intermediate: SFC Column Phenomenex-Cellulose-2 (250 mm * 30 mm, 10 um), Condition 0.1% NH.sub.3H.sub.2O MeOH 694 274 mono(2-(4-((E)-4-(((1R, 2R)-3,3-difluoro-2- hydroxycyclohexyl)- ammonio)but-2-enamido)- 3,5-difluorobenzoyl)-9,10- dimethyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hilindolizin-11-ium) mono- (2,2,2-trifluoroacetate) [00559] E Derived from single atropisomer Int AA 744 275 (3S,4S)-1-((E)-4-((4-(9,10- dimethyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)amino)- 4-oxobut-2-en-1-yl)-3- fluoro-4-hydroxypyrrol- idin-1-ium 2,2,2-trifluoro- acetate [00560] E Derived from single atropisomer Int AA 698 276 (E)-4-((4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)- amino)-N-((1-fluorocyclo- propyl)methyl)-4-oxobut- 2-en-1-aminium 2,2,2- trifluoroacetate [00561] E Derived from single atropisomer Int AA 682 277 (E)-N-(4-((4-(9,10- dimethyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)-2,6-difluoro- phenyl)amino)-4-oxobut- 2-en-1-yl)-3,3-difluoro- cyclobutan-1-aminium 2,2,2-trifluoroacetate [00562] E Derived from single atropisomer Int AA 700 278 (E)-3-(4-((4-(9,10-dimeth- yl-7-(trifluoromethyl)- 13,14-dihydro-9H- imidazo-[4,5:5,6]- benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizine-2- carbonyl)-2,6-difluoro- phenyl)amino)-4-oxobut- 2-en-1-yl)-6-(hydroxy- methyl)-3-azabicyclo- [3.1.0]hexan-3-ium 2,2,2- trifluoroacetate [00563] E Derived from single atropisomer Int AA 706 279 (E)-4-((4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)amino)- N-((3-(hydroxymethyl) oxetan-3-yl)methyl)-4- oxobut-2-en-1-aminium 2,2,2-trifluoroacetate [00564] E Derived from single atropisomer Int AA 710 280 (E)-2-(4-((4-(9,10-dimeth- yl-7-(trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)amino)- 4-oxobut-2-en-1-yl)-7- oxa-2-azaspiro[3.5]nonan- 2-ium 2,2,2-trifluoroacetate [00565] E Derived from single atropisomer Int AA 720 281 (E)-4-((4-(9,10-dimethyl- 7-(trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)- amino)-N-((1-(hydroxy- methyl)cyclopropyl)meth- yl)-4-oxobut-2-en-1- aminium 2,2,2-trifluoro- acetate [00566] E Derived from single atropisomer Int AA 694 282 (E)-N-(4-((4-(10,12- dimethyl-7-(trifluorometh- yl)-10,12,13,14-tetrahydro- indolizino[8,1:4,5,6]- azocino[2,3-e]indazole-2- carbonyl)-2,6-difluoro- phenyl)amino)-4-oxobut- 2-en-1-yl)-3-methyloxetan- 3-aminium 2,2,2-trifluoro- acetate [00567] DD Column: REGIS (s,s) WHELK-01 (250 mm * 30 mm, 5 um), Condition: 0.1% NH.sub.3H.sub.2O MeOH, Peak 2 679 284 (E)-2-(4-(4-(9,10-dimeth- yl-7-(trifluoromethyl)- 13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizine-2-carbonyl)- 2,6-difluorophenyl)amino)- 4-oxobut-2-en-1-yl)-6-oxa- 2-azaspiro[3.4]octan-2- ium 2,2,2-trifluoroacetate [00568] E Derived from single atropisomer Int AA 706 288 mono((E)-2-(4-(4-(tert- butylammonio)but-2- enamido)-3,5-difluoro- benzoyl)-7-methoxy-10- (methoxymethyl)-9,12- dimethyl-9,12,13,14-tetra- hydroimidazo[4,5:5,6]- benzo[1,2:2,3]azocino- [4,5,6-hi]indolizin-11- ium) mono-(2,2,2- trifluoroacetate) [00569] BB Derived from single atropisomer Int CC 671 289 mono(2-(3,5-difluoro-4- ((E)-4-((3S)-3-hydroxy- pyrrolidin-1-ium-1-yl)but- 2-enamido)benzoyl)-7- methoxy-10-(methoxy- methyl)-9,12-dimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizin-11-ium) mono(2,2,2-trifluoro- acetate) [00570] BB Derived from single atropisomer Int CC 685 290 mono((E)-2-(4-(4-((2- cyclopropylpropan-2-yl)- ammonio)but-2-enamido)- 3,5-difluorobenzoyl)-7- methoxy-10-(methoxy- methyl)-9,12-dimethyl- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizin-11-ium) mono(2,2,2-trifluoro- acetate) [00571] BB Derived from single atropisomer Int CC 697 291 (E)-4-((2-oxaspiro[3.3]- heptan-6-yl)amino)-N- (2,6-difluoro-4-(7-meth- oxy-10-(methoxymethyl)- 9,12-dimethyl-9,12,13,14- tetrahydroimidazo[4,5: 5,6]benzo[1,2:2,3]- azocino[4,5,6-hi]indol- izine-2-carbonyl)phenyl) but-2-enamide [00572] BB Derived from single atropisomer Int CC 711 292 mono((E)-2-(4-((2,6- difluoro-4-(7-methoxy-10- (methoxymethyl)-9,12- dimethyl-9,12,13,14-tetra- hydroimidazo[4,5: 5,6]benzo[1,2:2,3]azo- cino[4,5,6-hi]indolizin-11- ium-2-carbonyl)phenyl)- amino)-4-oxobut-2-en-1- yl)-6-oxa-2-azaspiro[3.5]- nonan-2-ium) mono(2,2,2- trifluoroacetate) [00573] BB Derived from single atropisomer Int CC 725 294 mono(2-(3,5-difluoro-4- ((Z)-2-fluoro-4-(2S)-2- (hydroxymethyl)pyrrol- idin-1-ium-1-yl)but-2- enamido)benzoyl)-9,10- dimethyl-7-(trifluorometh- yl)-13,14-dihydro-9H- imidazo[4,5:5,6]benzo- [1,2:2,3]oxocino[4,5,6- hi]indolizin-11-ium) mono(2,2,2-trifluoro- acetate) [00574] Y Derived from single atropisomer Int AA 712 295 mono((Z)-2-(3,5-difluoro- 4-(2-fluoro-4-(((1- (hydroxymethyl)cyclo- propyl)methyl)ammonio)- but-2-enamido)benzoyl)- 9,10-dimethyl-7-(trifluoro- methyl)-13,14-dihydro- 9H-imidazo[4,5:5,6]-benzo[1,2:2,3]oxocino- [4,5,6-hi]indolizin-11-ium) mono(2,2,2-trifluoro- acetate) [00575] Y Derived from single atropisomer Int AA 712 297 (Z)-4-((2-oxaspiro[3.3]- heptan-6-yl)amino)-N- (4-(9,10-dimethyl-7- (trifluoromethyl)-13,14- dihydro-9H-imidazo- [4,5:5,6]benzo[1,2: 2,3]oxocino[4,5,6-hi]- indolizine-2-carbonyl)- 2,6-difluorophenyl)-2- fluorobut-2-enamide [00576] Y Derived from single atropisomer Int AA 724 298 (E)-1-(4-((2,6-difluoro-4- (9,10,12-trimethyl-7- (trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)amino)-4-oxobut- 2-en-1-yl)-2-(2-hydroxy- 2-methylpropyl)azetidin- 1-ium 2,2,2-trifluoro- acetate [00577] Z Column: DAICEL CHIRALPAK IG (250 mm * 30 mm, 10 um), Condition: 0.1% NH.sub.3H.sub.2O EtOH; first eluting peak (Derived from single atropisomer Int BB) 735 299 (E)-1-(4-((2,6-difluoro- 4-(9,10,12-trimethyl-7- (trifluoromethyl)- 9,12,13,14-tetrahydro- imidazo[4,5:5,6]benzo- [1,2:2,3]azocino[4,5,6- hi]indolizine-2-carbonyl)- phenyl)amino)-4-oxobut- 2-en-1-yl)-2-(2-hydroxy- 2-methylpropyl)azetidin- 1-ium 2,2,2-trifluoroacetate [00578] Z Column: DAICEL CHIRALPAK IG (250 mm * 30 mm, 10 um), Condition: 0.1% NH.sub.3H.sub.2O EtOH; second eluting peak (Derived from single atropisomer Int BB) 735

Test Example 1: KRASG12C Binding Assay

[0849] As test compounds for the KRASG12C binding assay, the compounds obtained in the Preparation of Compounds section were used. Sample solutions each containing a test compound were prepared in the form of a 10 mM DMSO solution.

[0850] Gppcp-bound recombinant K-Ras4B G12C mutant protein (amino acids 1-169, C51S/C80L/C118S, SEQ ID NO:1) was diluted with a buffer (1?TBS, 0.1 mM TCEP, 0.25 mM MgCl.sub.2, 50 ?M Gppcp) to prepare a 50 nM protein solution. K-Ras4B is the major splicing variant of K-Ras. Amino acid sequence of residues 1 to 150 including the compounds' binding region of K-Ras4B is exactly same as that of K-Ras4A, the other splicing variant (Oncotarget, 2016 Jul. 19; 7(29): 46717-46733). A sample solution containing 10 mM test compound was diluted ten-fold with DMSO to make a 1 mM sample solution, and then diluted twenty-fold with DMSO to make a 50 ?M sample solution, 1 ?L of a 50 ?M sample solution was added to 100 ?L of a 50 nM protein solution to adjust the final concentration of a test compound to be 0.5 ?M in the mixture. The mixtures were stored in an incubator at 25? C. for 1 hour, and 10 ?L of a 1?TBS solution containing 2% formic acid was added to stop the reaction, followed by LC-MS measurement. LC-MS measurement was performed using Xevo G2-S Q-Tof manufactured by Waters, and reverse-phase chromatography was performed with a desalting column. A mass spectrum of positive ions was obtained by electrospray. For a mass spectrum, a spectrum of polyvalent ions was collectively converted to a molecular weight by using OpenLynx software by the MaxEnt technique, and a compound binding rate was calculated from the ratio of the signal intensity of a peak that corresponds to the molecular weight of the protein to the signal intensity of a peak that corresponds to the molecular weight of the protein conjugated with the compound.

[0851] The binding assay of the test compounds was conducted at a final concentration of 0.5 ?M. A binding rate of 80% or more is rated A, a binding rate of 60% or more and less than 80% is rated B, a binding rate of 40% or more and less than 60% is rated C, a binding rate of 20% or more and less than 40% is rated D, and a binding rate of less than 20% is rated E. N.D.=not determined. Binding rate % is the ratio of KRAS signal intensity at the molecular weight of one molecule adduct to the sum of all the KRAS signal intensity (unbound form and adducts) in mass spectrum. Thus, binding rate 100% means that only the one molecule adduct was observed without any unbound KRAS. The following table shows the results.

TABLE-US-00003 TABLE 1 Example 1-1 D 1-2 A 2-1 D 2-2 A 3 A 4-1 D 4-2 A 5-1 A 5-2 C 6 A 7 A 8 A 9 A 10 A 11-1 E 11-2 A 12-1 A 12-2 E 13 A 14-1 A 14-2 D 15-1 C 15-2 A 16 A 17 C 18 A 19 D 20 A 21-1 N.D. 21-2 N.D. 22 A 23 A 24 B 25 A 26 A 27 A 28 A 29 A 30-1 A 30-2 D 31-1 A 31-2 E 32 A 33 A 34 A 35 A 36 A 37 A 38-1 E 38-2 A 39 A 40 B 41 A 42 A 42-1 A 42-2 B 43 N.D. 44 A 45 A 46 A 47 A 48 A 49 A 50 N.D.

TABLE-US-00004 TABLE 1-1 IC50 Example (?M) 51 A 52 A 53 A 54 A 55 A 56 A 57 A 58 A 59 A 60 A 61 A 62 A 63 A 64 A 65 A 66 A 67 A 68 A 69 A 70 A 71 A 72 A 73 A 74 A 75 A 76 A 77 A 78 A 79 A 80 A 81 A 82 A 83 B 84 A 85 A 86 A 87 A 88 A 89 A 90 A 91 A 92 A 93 A 94 A 95 A 96 A 97 A 98 A 99 N.D. 100 A 101 A 102 A 103 A 104 A 105 A 106 A 107 A 108 A 109 A 110 A 111 A 112 A 113 A 114 A 115 A 116 A 117 A 118 A 119 A 120 A 121 A 122 A 123 A 124 A 125 A 126 A 127 A 128 A 129 A 130 A 130-1 A 130-2 C 131 A 132 A 133 A 134 A 135 A 136 A 137 A 138 A 139 A 140 A 141 A 142 A 143 A 144 A 145 A 146 A 147 A 148 A 149 A 150 A 151 A 152 A 153 A 154 A 155 A 156 A 157 A 158 B 159 A 160 A 161 A 162 A 163 A 164 A 165 A 166 A 167 A 168 A 169 A 170 A 171 A 172 A 173 A 174 A 175 A 176 A 177 A 178 A 179 A 180 A 181 A 182 A 183 A 184 A 185 A 186 A 187 A 188 B 189 A 190 A 191 B 192 A 193 A 194 A 195 B 196 B 197 A 198 A 199 A 200 A 201 A 202 A 203 A 204 A 205 A 206 A 207 A 208 A 209 A 210 A 211 A 212 A 213 A 214 A 215 A 216 A 217 A 218 A 219 A 220 A 221 A 222 A 223 A 224 A 225 A 226 A 227 A 228 A 229 A 230 A 231 N.D. 232 A 233 A 234 A 235 A 236 A 237 A 238 A 239 A 240 A 241 A 242 A 243 A 244 A 245 A 246 A 247 A 248 A 249 A

Test Example 2: Evaluation of Inhibitory Activity of Compounds on Interaction Between KRAS G12C and cRAF (In Vitro)

[0852] Interaction between recombinant K-Ras4B G12C mutant protein (amino acids 1-169, SEQ ID NO:2) and cRAF RAS-binding domain (cRAF-RBD, amino acids 50-132, Jena Biosciences GmbH) was measured using Alpha technology (PerkinElmer Inc.).

[0853] Recombinant KRAS G12C protein with an N-terminal His-tag was expressed in E. coli and purified by affinity chromatography. To prepare GTP-bound form and GDP-bound form of KRAS G12C protein, 50 ?M KRAS G12C protein was incubated with 1 mM GMPPNP (Guanosine-5-[(?,?)-imido]triphosphate, Tetralithium salt) (Jena Bioscience GmbH) and 1 mM GDP, respectively, in a loading buffer (20 mM Tris-HCl (pH 7.5), 50 mM NaCl, 1 mM DTT and 2.5 mM EDTA) for 1 hour on ice. After the incubation, MgCl.sub.2 was added to a final concentration of 10 mM, followed by incubation at room temperature for 30 minutes. The mixture was allowed to pass through a NAP-5 column to remove free nucleotides and purified, and the resultant nucleotide-bound KRAS G12C protein was used for compound evaluation.

[0854] For the measurement of the inhibitory activity of compounds on interaction between KRAS G12C and cRAF-RBD, GMPPNP-bound KRAS G12C protein was incubated with various concentrations of compound in a reaction buffer (20 mM Tris-HCl (pH 7.5), 100 mM NaCl, 1 mM MgCl.sub.2, 1 mM TCEP, 0.1% Tween 20) at 25? C. for 1 hour. After the incubation, recombinant cRAF-RBD and Alpha detection reagents were added and incubated at room temperature for 1.5 hours for binding. Interaction of KRAS G12C and cRAF-RBD was monitored by measuring Alpha signal. Inhibition % was calculated using the signal from the reaction without test compound (DMSO control) as 0% inhibition and the signal from the reaction using GDP-bound KRAS G12C in place of GMPPNP-bound KRAS G12C as 100% inhibition. IC50 values were calculated from dose titration curve using curve fitting by XLfit software (IDBS).

TABLE-US-00005 TABLE 2 IC50 Example (?M) 1-1 >6.7 1-2 0.18 2-1 >6.7 2-2 0.50 3 2.7 4-1 >6.7 4-2 0.29 5-1 0.053 5-2 >6.7 6 0.16 7 0.84 8 0.15 9 1.5 10 0.15 11-1 >6.7 11-2 0.077 12-1 0.005 12-2 >6.7 13 0.017 14-1 0.009 14-2 >6.7 15-1 3.9 15-2 0.035 16 0.10 17 1.3 18 0.019 19 >6.7 20 0.024 21-1 0.044 21-2 2.8 22 0.10 23 0.019 24 1.8 25 0,039 26 0.10 27 0.064 28 0.053 29 0.22 30-1 0.007 30-2 6.0 31-1 0.011 31-2 >6.7 32 0.027 33 0.014 34 0.012 35 0.013 36 0.013 37 0.040 38-1 >6,7 38-2 0.027 39 0.008 40 4.7 41 0.010 42 0.018 42-1 0.011 42-2 1.1 43 0.017 44 0.030 45 0.021 46 0.14 47 0.023 48 0.093 49 0.26 50 0.78

TABLE-US-00006 TABLE 2-1 IC50 Example (?M) 51 0.04537 52 0.00455 53 0.02216 54 0.02209 55 0.01173 56 0.01239 57 0.07828 58 0.07789 59 0.02763 60 0.07317 61 0.07627 62 0.0174 63 0.01422 64 0.01416 65 0.06955 66 0.05343 67 0.02201 68 0.09116 69 0.01983 70 0.00985 71 0.02022 72 0.09775 73 0.04693 74 0.03333 75 0.01594 76 0.02218 77 0.08039 78 0.03369 79 0.03282 80 0.02834 81 0.02078 82 0.02495 83 0.03387 84 0.03988 85 0.06095 86 0.02233 87 0.01823 88 0.03951 89 0.01596 90 0.01722 91 0.02722 92 0.01994 93 0.03363 94 0.07156 95 0.03117 96 0.03065 97 0.03043 98 0.01115 99 0.01223 100 0.03451 101 0.02735 102 0.01124 103 0.09924 104 0.04122 105 0.01915 106 0.01802 107 0.02367 108 0.05418 109 0.02475 110 0.03566 111 0.03135 112 0.02925 113 0.02956 114 0.06106 115 0.03894 116 0.02656 117 0.02048 118 0.01257 119 0.01686 120 0.00559 121 0.02301 122 0.05409 123 0.04179 124 0.01301 125 0.00375 126 0.01798 127 0.0168 128 0.01877 129 0.0088 130 0.04144 130-1 0.02627 130-2 3.76266 131 0.02788 132 0.01082 133 0.01144 134 0.03099 135 0.01098 136 0.02635 137 0.03352 138 0.04717 139 0.05895 140 0.00413 141 0.00971 142 0.02813 143 0.01785 144 0.02243 145 0.07228 146 0.02035 147 0.00749 148 0.02323 149 0.02372 150 0.01714 151 0.01551 152 0.08932 153 0.03154 154 0.01024 155 0.00895 156 0.00806 157 0.06762 158 0.07762 159 0.00722 160 0.00571 161 0.06324 162 0.02243 163 0.03354 164 0.0215 165 0.00375 166 0.03366 167 0.02786 168 0.0438 169 0.05964 170 0.01414 171 0.00634 172 0.01041 173 0.00702 174 0.00741 175 0.09043 176 0.06744 177 0.03954 178 0.03242 179 0.04159 180 0.04933 181 0.04805 182 0.03518 183 0.03515 184 0.04828 185 0.04082 186 0.01672 187 0.03643 188 0.07248 189 0.01522 190 0.01026 191 0.09711 192 0.09149 193 0.03956 194 0.01028 195 0.03944 196 0.03508 197 0.01169 198 0.05709 199 0.01011 200 0.01372 201 0.01756 202 0.01301 203 0.0204 204 0.03636 205 0.02949 206 0.01536 207 0.02693 208 0.03543 209 0.04688 210 0.03813 211 0.05185 212 0.01626 213 0.06209 214 0.01154 215 0.01835 216 0.05762 217 0.01971 218 0.027 219 0.03853 220 0.02438 221 0.03925 222 0.07581 223 0.02006 224 0.02821 225 0.01008 226 0.06331 227 0.03405 228 0.03247 229 0.01271 230 0.02007 231 0.10113 232 0.04972 233 0.05263 234 0.02053 235 0.02187 236 0.01649 237 0.01138 238 0.00876 239 0.01817 240 0.00893 241 0.03097 242 0.01783 243 0.08315 244 0.0155 245 0.03309 246 0.01363 247 0.02343 248 0.018 249 0.02747

Test Example 3: Assay of Growth Inhibition Activity on KRAS-G12C Mutant Cell Line (MIA PaCa-2) (In Vitro)

[0855] MIA PaCa-2 cells (given by Sumitomo Dainippon Pharma Co., Ltd.), which are a KRAS-G12C mutant human pancreas cancer cell line, were suspended in a 10% fetal bovine serum-containing RPMI1640 medium (manufactured by Fujifilm Wako Pure Chemical Corporation). The cell suspension was seeded into each well of a 384-well U bottom microplate and cultured in an incubator containing 5% CO.sub.2 gas at 37? C. for 1 day. The compounds obtained in the Preparation of Compounds section were used as test compounds and were dissolved in DMSO, respectively, and each test compound was diluted with DMSO to give a concentration 500 times the final concentration. The resultant solution of the test compound in DMSO was diluted with the medium used for suspending cells and added to each well of the cell-culture plate to give a DMSO final concentration of 0.2%, followed by culture in an incubator containing 5% CO.sub.2 gas at 37? C. for another 3 days. The cell count after 3-day culture in the presence of the test compound was measured using CellTiter-Glo 3D Reagent (manufactured by Promega Corporation). All wells were added with CellTiter-Glo 3D Reagent and mixed for 10 minutes. 30 minutes after mixing, luminescence was measured by a plate reader. The growth inhibition rate was calculated from the following equation, and the concentration of the test compound at which 50% inhibition was achieved (IC50 (nM)) was determined.

[00001]$\mathrm{Growth}\mathrm{Inhibition}\mathrm{Rate}\left(\%\right)=\left(C-T\right)/\left(C\right)?100$ [0856] T: the emission intensity in a well into which a test compound was added. [0857] C: the emission intensity in a well into which a test compound was not added.

TABLE-US-00007 TABLE 3 IC50 Example (?M) 1-1 7.7 1-2 0.16 2-1 3.1 2-2 0.39 3 4.4 4-1 3.6 4-2 0.26 5-1 0.014 5-2 1.8 6 0.67 7 1.1 8 0.16 9 0.76 10 0.23 11-1 7.8 11-2 0.091 12-1 0.001 12-2 1.6 13 0.059 14-1 0.017 14-2 3.7 15-1 2.7 15-2 0.027 16 0.056 17 0.82 18 0.021 19 3.3 20 0.049 21-1 0.022 21-2 1.5 22 0.10 23 0.013 24 1.1 25 0.024 26 0.13 27 0.088 28 0.017 29 0.053 30-1 0.003 30-2 1.6 31-1 0.007 31-2 9.2 32 0.086 33 0.005 34 0.007 35 0.014 36 0.15 37 0.028 38-1 8.3 38-2 0.019 39 0.012 40 1.6 41 0.004 42 0.009 42-1 0.006 42-2 0.45 43 0.014 44 0.010 45 0.005 46 0.057 47 0.059 48 N.D. 49 0.15 50 N.D.

TABLE-US-00008 TABLE 3-1 IC50 Example (?M) 51 0.0159 52 0.00144 53 0.0319 54 0.00539 55 0.00336 56 0.01264 57 0.06851 58 0.0702 59 0.01979 60 0.03215 61 0.01631 62 0.00691 63 0.00248 64 0.01097 65 0.0951 66 0.03011 67 0.00822 68 0.01639 69 0.01546 70 0.00249 71 0.0096 72 1.17161 73 0.02163 74 0.00822 75 0.00948 76 0.00714 77 0.05402 78 0.00692 79 0.0106 80 0.02225 81 0.03342 82 0.02989 83 0.01538 84 0.04956 85 0.0309 86 0.00611 87 0.00327 88 0.00692 89 0.00437 90 0.02161 91 0.00868 92 0.01208 93 0.05165 94 0.07301 95 0.01139 96 0.01446 97 0.00791 98 0.00394 99 0.00979 100 0.0234 101 0.02651 102 0.01051 103 0.30287 104 0.01553 105 0.01545 106 0.02195 107 0.02966 108 0.33229 109 0.01947 110 0.05583 111 0.00895 112 0.01005 113 0.01058 114 0.06452 115 0.06131 116 0.02987 117 0.05529 118 0.0042 119 0.00939 120 0.00652 121 0.02637 122 0.08817 123 0.03504 124 0.01371 125 0.00906 126 0.01429 127 0.02253 128 0.01178 129 0.00711 130 0.08282 130-1 0.01741 130-2 3.40762 131 0.04085 132 0.01665 133 0.00645 134 0.24428 135 0.02893 136 0.03614 137 0.01493 138 0.03084 139 0.05789 140 0.00759 141 0.03432 142 0.08552 143 0.0477 144 0.03025 145 0.1622 146 0.01963 147 0.01527 148 0.01906 149 0.02341 150 0.03121 151 0.03394 152 0.92746 153 0.11759 154 0.00793 155 0.01346 156 0.01035 157 0.06213 158 0.09544 159 0.00816 160 0.00925 161 0.02164 162 0.01524 163 0.04267 164 0.01373 165 0.00544 166 0.05124 167 0.01637 168 0.01559 169 0.01496 170 0.04773 171 0.01349 172 0.01621 173 0.01058 174 0.00745 175 0.02335 176 0.02506 177 0.03846 178 0.04135 179 0.13915 180 0.01268 181 0.02097 182 0.02782 183 0.11208 184 0.02811 185 0.07572 186 0.0103 187 0.03902 188 0.03967 189 0.0061 190 0.00908 191 0.16689 192 0.02426 193 0.06949 194 0.00638 195 0.01931 196 0.03148 197 0.0109 198 0.02139 199 0.00367 200 0.00462 201 0.00583 202 0.01023 203 0.01104 204 0.11821 205 0.00855 206 0.01032 207 0.01124 208 0.01136 209 0.01866 210 0.06028 211 0.01085 212 0.00416 213 0.02534 214 0.0011 215 0.0034 216 0.02327 217 0.00622 218 0.01421 219 0.01258 220 0.00652 221 0.02088 222 1.93832 223 0.02366 224 0.01783 225 0.00718 226 0.01352 227 0.01019 228 0.03581 229 0.01128 230 0.01445 231 0.07343 232 0.018 233 0.01402 234 0.00708 235 0.017 236 0.00403 237 0.00277 238 0.0027 239 0.00969 240 0.01447 241 0.87722 242 0.01671 243 0.09178 244 0.01004 245 0.02535 246 0.01723 247 0.02854 248 0.02175 249 0.02861

Test Example 4: Procedure for RAS:RAF-RBD Binding Assay

[0858] The RAF-Ras binding domain (RBD) protein interaction assay utilizes recombinant biotinylated KRAS protein containing a G12C mutation (SEQ ID NO:3) and the GST-tagged Ras binding domain of c-RAF (residues 50-132) from Jena Biosciences (catalog #PR-366). It should be noted that KRAS-G12C protein is pre-loaded with a GTP analog, GMP-PNP to mimic KRAS in the activated state. Compounds are added to KRAS and then after a 30-minute incubation time the RAF-RBD and detection antibodies are added. Small molecule inhibitors that block the interaction of c-RAF-RBD prevent generation of a TR-FRET signal.

[0859] Biotinylated KRAS G12C protein is diluted to 20 nM in assay buffer (20 mM HEPES pH 7.5, 150 mM sodium chloride, 10 mM magnesium chloride, and 0.01% Tween20).

[0860] Each test compound (10 mM stock in DMSO) is diluted in DMSO to make a 10-point, 3-fold dilution series in a 384-well low dead volume microplate (Labcyte, catalog #LP-0200). Once titrations are made, 50 nL of the diluted compounds is acoustically dispensed into 384-well plates (Corning, catalog #3820) using an Echo 655 (Labcyte).

[0861] Each well of the assay plate receives 5 ?L of Biotinylated KRAS G12C assay solution and is incubated at room temperature for 30 minutes. Each well then receives 5 ?L of 100 nM GST-c-RAF RBD protein and a 1:100 dilution of both anti-GST-d2 (Cisbio catalog #61GSTDLA) and Strepavidin-Tb cryptate (Cisbio catalog #610SATLA) in assay buffer and the plate is mixed and briefly centrifuged followed by a 60 minute incubation at room temperature.

[0862] The time-resolved fluorescence resonance energy transfer signal of both plates is measured on an Envision (PerkinElmer) plate reader: dichroic mirror=LANCE/DELFIA DUAL/Bias; Emission1=615 nm; Emission2=665 nm; delay time=60 ms. The signal of each well is determined as the ratio of the emission at 665 nm to that at 615 nm. Percent effect of each well is determined after normalization to control wells containing DMSO (no effect) or a saturating concentration of inhibitor (max effect). The apparent effect as a function of compound concentration is fit to a four-parameter logistic equation. Table 4 shows the results.

TABLE-US-00009 TABLE 4 IC50 Example (?M) 250 0.05487 251 0.01674 252 0.0257 253 0.02475 254 0.02095 255 0.01172 256 0.0047 257 0.009693 258 0.006686 259 0.01425 260 0.01171 261 0.02225 262 0.01514 263 0.009252 264 0.007344 265 0.01233 266 0.01609 267 0.003686 268 0.01277 269 0.009825 270 0.01205 271 0.0136 272 0.01487 273 0.03005 274 0.02036 275 0.05751 276 0.008047 277 0.02636 278 0.04432 279 0.005733 280 0.03768 281 0.003805 282 0.05759 283 0.0647 284 0.04041 285 0.08501 286 0.0928 287 0.01662 288 0.008149 289 0.0688 290 0.01111 291 0.005545 292 0.08488 293 0.01604 294 0.05957 295 0.02528 296 0.01484 297 0.02668 298 0.04158 299 0.05247 300 0.001219

TABLE-US-00010 Sequences Gppcp-boundrecombinantK-Ras4BG12Cmutantprotein(aminoacids1-169, C51S/C80L/C118S)(SEQIDNO:1): GMTEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGE TSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNTKSFEDIHHYREQI KRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQ GVDDAFYTLVREIRKHKEK RecombinantK-Ras4BG12Cmutantprotein(SEQIDNO:2): MASSHHHHHHSSENLYFQGMTEYKLVVVGACGVGKSALTIQLIQNHFVD EYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLC VFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQA QDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK Gppnp-boundrecombinantK-Ras4BG12Cmutantprotein(SEQIDNO:3): GLNDIFEAQKIEWHETEYKLVVVGACGVGKSALTIQLIQNHFVDEYDPTIE DSYRKQVVIDGETSLLDILDTAGQEEYSAMRDQYMRTGEGFLLVFAINNT KSFEDIHHYREQIKRVKDSEDVPMVLVGNKSDLPSRTVDTKQAQDLARSY GIPFIETSAKTRQGVDDAFYTLVREIRKHKEK