NOVEL TARGETS FOR ENHANCING ANTI-TUMOR IMMUNITY

20240261333 ยท 2024-08-08

    Inventors

    Cpc classification

    International classification

    Abstract

    The present disclosure relates to identifying novel tumor immune evasion targets. A CRISPR activation screen was employed to identify novel checkpoint inhibitor targets, where upon upregulation, conferred tumor resistance to cytotoxic T cells in model cancer cell lines. Using MAGeCK and FDR analyses to identify candidate genes that were enriched in cancer cells, B3GNT2, MCL1, BCL2A1 and JUNB were identified as the most enriched after a pathway analysis of the top 576 genes prioritized by MAGeCK. Currently, these four genes have not been identified or suggested as possible checkpoint inhibitor targets. Provided herein are methods of targeting the expression or activity of B3GNT2, MCL1, BCL2A1 and JUNB using small molecule agents and/or gene editing methods with the aim of enhancing anti-tumor immunity in subjects in need thereof.

    Claims

    1. A method of enhancing anti-tumor immunity in a subject in need thereof comprising administering to the subject one or more agents that reduce the expression or activity of B3GNT2.

    2. The method of claim 1, wherein the one or more agents are small molecules that bind the active site of B3GNT2 or comprise an allosteric inhibitor of B3GNT2.

    3. The method of claim 1, wherein the one or more agents is a gene editing system capable of reducing expression or activity of B3GNT2.

    4. The method of claim 1, wherein the one more agents is a polynucleotide capable of inducing RNAi knock down of B3GNT2 expression.

    5. A method of enhancing anti-tumor immunity in a subject in need thereof comprising administering to the subject one or more agents that inhibit poly-N-acetyllactosamine (poly-LacNAc) synthesis in tumor cells or reduces poly-LacNAc on surface N- and O-glycans.

    6. The method of claim 5, wherein the one or more agents is a small molecule inhibitor of poly-LacNAc synthesis selected from the group consisting of benzyl-ON-acetylgalactosamide (BAG), kifunensine (KIF), tunicamycin, 3-Azidothymidine (AZT), 2-acetamido-1,3,6-tri-O-acetyl-4-deoxy-4-fluoro-D-glucopyranose [4-F-GlcNAc], and deoxymannojirimycin (DMN), whereby poly-LacNAc synthesis is inhibited.

    7. The method of claim 5, wherein the one or more agents comprise an antibody that binds to a tumor specific surface marker and is linked to an enzyme capable of cleaving poly-LacNAc.

    8. The method of claim 7, wherein the enzyme is selected from the group consisting of endo H, endo F2, endo F3, peptide:N-glycosidase F (PNGase F), endo D, O-glycosidase, endo-?-galactosidase, sialidase and O-sialoglycoprotease.

    9. A method of enhancing anti-tumor immunity in a subject in need thereof comprising administering to the subject one or more agents capable of inhibiting the expression or activity of MCL1.

    10. The method of claim 9, wherein the one or more agents increase the expression of one or more genes selected from the group consisting of BID, PMAIP1 (NOXA), BAX, BAK, BIM, BAD and BBC3 (PUMA).

    11. The method of claim 9, wherein the one or more agents is a small molecule selected from the group consisting of Venetoclax, S63845, MIK665/S64315, AT101 (R-(?)-gossypol), TW-37, Gambogic acid, Sabutoclax (BI-97C1), Marinopyrrole A (maritoclax), UMI-77, A-1210477, Fesik's compounds, AMG176, AZD5991, Flavopiridol, Roscovitine, CR8, Voruciclib (P1446A-05), Cardiac glycoside, UNBS1450, Benzyl isothiocyanate, BAY43-9006, BAY1251152, BEZ235, AZD4573, AZD8055, SNS-032, dinaciclib, BEZ235, AZD8055, arsenic trioxide Bufalin, and analogues thereof.

    12. The method of claim 9, wherein the one or more agents is a gene editing system capable of reducing MCL1 expression or activity.

    13. The method of claim 9, wherein the one or more agents is a polynucleotide capable of inducing RNAi knock down of MCL1 expression.

    14. A method of enhancing anti-tumor immunity in a subject in need thereof comprising administering to the subject one or more agents capable of inhibiting the expression or activity of BCL2A1.

    15. The method of claim 14, wherein the one or more agents increase the expression of one or more genes selected from the group consisting of BID, PMAIP1 (NOXA), BAX, BAK, BIM, BAD and BBC3 (PUMA).

    16. The method of claim 14, wherein the one or more agents is a small molecule selected from the group consisting of Venetoclax, AT101 (R-(?)-gossypol), TW-37, Gambogic acid, Sabutoclax (BI-97C1) and Marinopyrrole A (maritoclax).

    17. The method of claim 14, wherein the one or more agents is a gene editing system capable of reducing BCL2A1 expression or activity.

    18. The method of claim 14, wherein the one or more agents is a polynucleotide capable of inducing RNAi knock down of BCL2A1 expression.

    19. A method of enhancing anti-tumor immunity in a subject in need thereof comprising administering to the subject one or more agents capable of inhibiting the expression or activity of JUNB.

    20. The method of claim 19, wherein the one or more agents is a dominant-negative JUNB protein or vector encoding the same.

    21. The method of claim 19, wherein the one or more agents is a small molecule selected from the group consisting of curcumin, SP100030, SPC-839, T-5224, K1115A, momordin I, isosteviol and analogues thereof.

    22. The method of claim 19, wherein the one or more agents is gene editing system capable of reducing JUNB expression or activity.

    23. The method of claim 19, wherein the one or more agents is a polynucleotide capable of inducing RNAi knock down of JUNB expression.

    24. The method of claim 19, wherein the one or more agents is capable of inhibiting the expression or activity of one or more downstream targets of JUNB selected from Table 5 or Table 6.

    25. A method of enhancing anti-tumor immunity in a subject in need thereof comprising administering to the subject one or more agents capable of inhibiting the expression or activity of one or more targets selected from Table 1 or Table 3.

    26. An engineered T cell that expresses an enzyme capable of cleaving poly-LacNAc on the T cell surface.

    27. The engineered T cell of claim 26, wherein the enzyme is selected from the group consisting of endo H, endo F2, endo F3, peptide:N-glycosidase F (PNGase F), endo D, O-glycosidase, endo-?-galactosidase, sialidase and O-sialoglycoprotease.

    28. A method of enhancing anti-tumor immunity in a subject in need thereof comprising administering to the subject the engineered T cell of claim 26 or 27.

    29. The method of any of claims 1 to 28, further comprising administering an immunotherapy in combination with the one or more agents or engineered T cell.

    30. The method of claim 29, wherein the immunotherapy comprises adoptive cell transfer.

    31. The method of claim 30, wherein adoptive cell transfer comprises the administration of CAR (chimeric antigen receptor) T cells or natural killer cells, T cells expressing a T cell receptor (TCR) specific for a tumor antigen, or tumor infiltrating lymphocytes (TILs).

    32. The method of claim 29, wherein immunotherapy comprises checkpoint blockade (CPB) therapy.

    33. The method of claim 32, wherein the checkpoint blockade therapy comprises anti-CTLA4, anti-PD-L1, anti-PD1, anti-TIM3, anti-TIGIT, anti-LAG3, or combinations thereof.

    34. The method of any of claims 29 to 33, wherein the subject is treated with an immunotherapy followed by the one or more agents or engineered T cell.

    35. The method of claim 34, wherein the subject is treated with an immunotherapy followed by the one or more agents or engineered T cell and an immunotherapy.

    36. The method of any of claim 3, 11, 17, 22, or 25 wherein the gene editing system comprises a programmable nuclease.

    37. The method of claim 36, wherein the programmable nuclease is selected from the group consisting of a CRISPR system, a zinc finger nuclease, a TALE, or a meganuclease.

    38. The method of claim 36, wherein the gene editing system is a base editing system that introduces one or more base or base pair edits that reduce expression or activity of B3GNT2, MCL1, BCL2A1, or JUNB.

    39. The method of claim 36, wherein the gene editing system is a prime editing system that introduces one or more base or base pair edits that reduce the expression or activity of B3GNT, MCL1, BCL2A1, or JUNB, or replaces all or a portion of the genomic sequence of B3GNT, MC1, BCL2A1, or JUNB with a non-functional variant.

    40. The method of claim 36, wherein the gene editing system is a CAST system that replaces all or a portion of the genomic sequence of B3GNT, MC1, BCL2A1, or JUNB with a non-functional variant.

    41. A method of monitoring the efficacy of an immunotherapy comprising detecting the expression of one or more genes selected from the group consisting of MCL1, BCL2A1, JUNB and B3GNT2 in a subject treated with an immunotherapy, wherein the subject is a non-responder to the immunotherapy if the one or more genes are upregulated after being treated.

    42. The method of claim 41, wherein the expression is detected at two or more time points during treatment, wherein a trend of increasing expression of the one or more genes indicates a poor outcome and/or a non-responder.

    43. The method of claim 41 or 42, further comprising administering a treatment according to any of claims 1 to 36, if a poor outcome and/or non-responder is indicated.

    44. A method of treating a cancer in a subject in need thereof comprising determining if the patient is an immunotherapy responder or non-responder by detecting in a tumor obtained from the subject the expression or activity of one or more genes selected from candidate genes in Table 2, wherein if the expression of the one or more genes is higher than a reference value the subject is an immunotherapy non-responder and if the one or more genes is lower than a reference value then the subject is an immunotherapy responder; and if the subject is an immunotherapy non-responder, treating the subject using the method of any one of claims 1 to 40; and if the subject is an immunotherapy responder, treating the subject with an immunotherapy.

    45. The method of claim 44, wherein the one or more genes comprise B3GNT2, MCL1, BCL2A, JUNB, or a combination thereof.

    46. A method of screening for agents capable of decreasing poly-LacNAc on tumor cells comprising: a. contacting a population of tumor cells having upregulated B3GNT2 with an agent; and b. detecting binding of one or more proteins to the tumor cells selected from the group consisting of CD2, 4-1BB, TREML2 (TLT2), NKG2D, and an antibody specific for an HLA class I bound tumor antigen, wherein increased binding indicates reduced poly-LacNAc.

    47. The method of claim 46, wherein the one or more proteins are labeled with a detectable marker.

    Description

    BRIEF DESCRIPTION OF THE DRAWINGS

    [0028] An understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention may be utilized, and the accompanying drawings of which:

    [0029] FIG. 1 (A-K) Establishing a genome-scale CRISPR activation screen for resistance to T cell cytotoxicity. (FIG. 1A) Percent indels generated by different CRISPR knockout (KO) sgRNAs targeting CTAG1A/B genes that encode for the NY-ESO-1 antigen. N=3. (FIG. 1B-C) Cell survival of NY-ESO-1+ and HLA-A2 A375 melanoma cells with different (TAG1A/B KO sgRNAs that were co-cultured with T cells expressing the NY-ESO-1 T cell receptor (ESO T cells) relative to cells that have not been exposed to T cells (B) or cells co-cultured with unmodified T cells (C). N=8. NT, non-targeting. Percent survival at different effector to target (E:T) ratios were measured. (FIG. 1D-K) Results of the acute and chronic exposure screens showing normalized sgRNA counts as counts per million (CPM; D-E), sgRNA enrichment in the ESO T cell condition relative to control (F-G), gene enrichment determined by the average sgRNA enrichment (H-I), and MAGeCK analysis P-values (J-K). The two most enriched genes from each screening strategy are highlighted in red. All values are mean?s.e.m. ****P<0.0001; ***P<0.001; *P<0.05; ns, not significant.

    [0030] FIG. 2 (A-F)Genome-scale CRISPR activation screen identifies four candidate genes that confer resistance to T cell cytotoxicity. (FIG. 2A) Schematic of the CRISPRa screen. NY-ESO-1.sup.+ and HLA-A2.sup.+ A375 melanoma cells were transduced with the pooled sgRNA library targeting more than 23,000 coding isoforms. A375 cells were exposed to primary CD4.sup.+ and CD8.sup.+ T cells expressing the T cell receptor (TCR) specific for the NY-ESO-1 antigen. Deep sequencing identified candidate genes. (FIG. 2B) Average MAGeCK analysis P-values for the acute and chronic exposure screens. Top candidate genes are annotated and the two most enriched genes from each screening strategy are highlighted in red. (FIG. 2C) Most significant pathways enriched among the 576 candidate genes. (FIG. 2D) Heatmap showing Pearson's correlation between expression of the top four candidate genes and cytolytic activity across patient tumors from TCGA. Only significant (FDR<0.05) correlations are shown. (FIG. 2E) Box plots showing single-sample Gene Set Enrichment Analysis (ssGSEA) (Barbie et al., 2009) of 576 candidate genes in 310 patient tumor samples (Auslander et al., 2018; Braun et al., 2020; Gide et al., 2019; Hugo et al., 2016; Pender et al., 2021; Riaz et al., 2017). (FIG. 2F) Cell survival of A375 cells transduced with ORFs encoding candidate genes against ESO T cell cytotoxicity at different effector to target (E:T) ratios. Cell survival was measured using a luminescent cell viability assay and normalized to paired control cells that were not cultured with T cells. T cells were derived from donors used in the CRISPRa screen. All values are mean?s.e.m. with n=12. ****P<0.0001.

    [0031] FIG. 3 (A-H)Validation of four candidate genes for resistance to T cell cytotoxicity. (FIG. 3A) Heatmap showing Pearson's correlation between cytolytic activity and expression of the top 576 candidate genes across patient tumors from TCGA. Only significant (FDR<0.05) correlations are shown. (FIG. 3B) Number of candidate genes with significant (FDR<0.05) positive or negative Pearson's correlation across patient tumors from TCGA. (FIG. 3C-D) Heatmaps showing significant Pearson's correlations between cytolytic activity and expression of 291 negative control housekeeping genes (FIG. 3C), or four positive control genes known to promote resistance upon overexpression (FIG. 3D) across patient tumors from TCGA. (FIG. 3E-F) Average MAGeCK analysis P-values of genes that promote A375 cell growth (FIG. 3E) or death (FIG. 3F) determined by comparing the distribution of sgRNAs in the CRISPRa screen control conditions to the initial sgRNA library. (FIG. 3G) Enrichment of CRISPR activation sgRNAs targeting each candidate gene for different screening biological replicates (bioreps). (FIG. 3H) T cell cytotoxicity resistance (n=12) and transcriptional upregulation (n=4) in A375 cells upon CRISPR activation of candidate genes. NT, non-targeting. All values are mean?s.e.m. ****P<0.0001; ***P<0.001; **P<0.01; ns, not significant.

    [0032] FIG. 4 (A-E)Relevance of top four candidate genes in patient tumors. (FIG. 4A) Box plots showing expression of candidate genes in TCGA datasets for 31 types of human cancers. Genes that were significantly differentially expressed between tumor and matched with normal tissues are indicated. (FIG. 4B) Copy number variation of candidate genes represented as percent of cases for each type of cancer in TCGA. (FIG. 4C) Comparison of candidate gene expression and clinical response to anti-PD-1 treatment using patient data from the Hugo et al. dataset (Hugo et al., 2016). Mean?s.e.m. is shown. (FIG. 4D) Comparison of candidate gene expression before (pre) and after (post) anti-PD-1 treatment and clinical response using patient data from the Riaz et al. dataset (Riaz et al., 2017). *P<0.05. (FIG. 4E) Pearson's correlation between candidate gene expression and cytolytic score (Rooney et al., 2015) prior to treatment using patient data from Riaz et al. (Riaz et al., 2017).

    [0033] FIG. 5 (A-E) Candidate gene overexpression mediates resistance in other cell types and in vivo. (FIG. 5A) Cell survival against ESO T cell cytotoxicity of H1793 (NY-ESO-1.sup.+, HLA-A2.sup.?) non-small cell lung adenocarcinoma transduced with HLA-A2 and ORFs encoding candidate genes. N=12. (FIG. 5B) Heatmap summarizing results from ESO T cell cytotoxicity assays for 8 cell lines derived from different tissues. Each value represents significance of the difference between survival of each ORF and GFP control. (FIG. 5C) Schematic of the in vivo experiments to test the response of A375 xenografts overexpressing candidate genes to adoptive cell transfer (ACT) in NSG mice. (FIG. 5D-E) Tumor growth in mice receiving ACT of ESO T cells. Tumor volume (FIG. 5D) and overall host survival (FIG. 5E) are shown. Data is representative of two independent experiments. N=12. All values are mean?s.e.m. ****P<0.0001; ***P<0.001; **P<0.01

    [0034] FIG. 6 (A-H)Candidate genes mediate resistance to T cell cytotoxicity across different co-culture conditions. (FIG. 6A) Cell survival against ESO T cell-mediated cytotoxicity in A375 cells overexpressing candidate gene ORFs. T cells were derived from donors that were not used in the CRISPRa screen. n=8. (FIG. 6B) Cell survival against ESO T cell-mediated cytotoxicity in A375 cells overexpressing candidate gene ORFs over time. Viability was measured using an alternative assay based on secreted Gaussia luciferase. n=8. (FIG. 6C) Growth of A375 cells overexpressing candidate gene ORFs in the absence of ESO T cell co-culture over time measured using secreted Gaussia luciferase. Data was fitted using the Malthusian exponential growth Y(t)=Yoekt, with 1=time, Y=luminescence, k=growth rate. The growth rates were compared using the extra sum-of-squares F test. n=8. (FIG. 6D) Growth of A375 cells overexpressing candidate gene ORFs in the absence of ESO T cell co-culture measured using a luminescent cell viability assay from 5 independent experiments with n=44. (FIG. 6E) Dox-induction of candidate genes in A375 cells. Cell survival against ESO T cell cytotoxicity (n=8) and candidate gene expression relative to ACTB control (n=4) were measured at different Dox concentrations. (FIG. 6F) Expression of candidate genes in 1,019 cell lines from the Cancer Cell Line Encyclopedia (Barretina et al., 2012). Expression in A375 cells and the expression threshold above which the candidate gene conferred resistance to T cell cytotoxicity in A375 cells are indicated. The percentage of cell lines with gene expression above the resistance threshold is shown. (FIG. 6G) Cell survival of A375 cells overexpressing candidate genes against CD4.sup.+, CD8.sup.+, or CD4.sup.+ and CD8.sup.+ T cell cytotoxicity. n=8. (FIG. 6H) Cell survival of A375 cells overexpressing candidate genes against T cells expressing the AXL chimeric antigen receptor (CAR). n=8. All values are mean?s.e.m. ****P<0.0001; ***P<0.001; **P<0.01; *P<0.05; ns, not significant.

    [0035] FIG. 7 (A-J)Candidate genes mediate resistance to T cell cytotoxicity in other cell types and in vivo. (FIG. 7A) Expression level of the NY-ESO-1 antigen represented as the average expression of CTAG1A and CTAG1B genes. RNA-seq expression data for each cell line was obtained from the Cancer Cell Line Encyclopedia (Barretina et al., 2012). (FIG. 7B-G) Resistance to ESO T cell-mediated cytotoxicity in SW1417 (NY-ESO-1.sup.?, HLA-A2.sup.?) colorectal adenocarcinoma (FIG. 7B), OAW28 (NY-ESO-1.sup.+, HLA-A2.sup.?) ovarian cystadenocarcinoma (C), H1299 (NY-ESO-1.sup.+, HLA-A2.sup.?) non-small cell lung carcinoma (FIG. 7D), A2058 (NY-ESO-1.sup.?, HLA-A2.sup.?) melanoma (FIG. 7E), LN-18 (NY-ESO-1.sup.+, HLA-A2.sup.+) glioblastoma (FIG. 7F), or SK-N-AS (NY-ESO-1.sup.+, HLA-A2.sup.?) neuroblastoma (FIG. 7G) cell lines. Cell lines that did not endogenously express HLA-A2 or NY-ESO-1 were transduced with the respective constructs. n=8 (B, C, E) or 12 (D, F, G). (FIG. 7H) Heatmap showing average expression (n=4) relative to ACTB of candidate genes in various cell lines overexpressing the ORF or GFP. (FIG. 7I-J) Tumor growth in control mice that did not receive adoptive cell transfer (ACT). Tumor volume (FIG. 7I) and overall survival (FIG. 7J) are shown. n=6. All values are mean?s.e.m. ****P<0.0001; ***P<0.001; **P<0.01; *P<0.05; ns, not significant.

    [0036] FIG. 8 (A-D)Effect of candidate gene overexpression on the transcriptome and IFN? pathways. (FIG. 8A) Volcano plots showing transcriptome changes measured by RNA-seq in A375 cells overexpressing candidate genes. The number of genes that were significantly differentially expressed with P-value?0.01 FDR correction are indicated. Out of these genes, those with |log.sub.2(fold change)|?1 are shown as red dots and the number of genes is indicated in parentheses. n=3. (FIG. 8B) T cell cytotoxicity resistance (n=8) and transcriptional upregulation (n=4) in A375 cells overexpressing N- or C-terminal FLAG tagged (N-FLAG or C-FLAG respectively) JUNB or B3GNT2. (FIG. 8C) IFN? measured by ELISA in cell culture media of ESO T cells co-cultured with A375 cells overexpressing candidate genes. n=16. (FIG. 8D) Western blots of phosphorylated or total STAT1 in A375 cells overexpressing candidate genes that have been exposed to different concentrations of IFN?. All values are mean?s.e.m. ****P<0.0001; ***P<0.001; **P<0.01; *P<0.05; ns, not significant.

    [0037] FIG. 9 (A-G)MCL1 and JUNB mediate resistance to FasL- and TRAIL-induced cell death through the mitochondrial apoptosis pathway. (FIG. 9A) Caspase 8 activity measured using a colorimetric cleavage assay in A375 cells overexpressing candidate genes after treating with 500 ng/?L of FasL or TRAIL for 3 hours. N=3. (FIG. 9B) Dox-induction of genes in the mitochondrial apoptosis pathway in A375 cells overexpressing MCL1 or GFP. Cell survival against ESO T cell cytotoxicity (n=8) and expression of MCL1 interaction partners (n=4) were measured at different Dox concentrations. (FIG. 9C) Histograms showing expression of cell surface Fas or TRAIL receptor, FAS or TNFRSF10B, measured by antibody staining and flow cytometry in A375 cells overexpressing candidate genes. N=3. (FIG. 9D) Cell survival against 500 ng/?L of FasL- or TRAIL-induced cell death in A375 cells overexpressing JUNB or GFP with BCL2A1 knocked down. N=4. KD, knockdown. NT, non-targeting. (FIG. 9E) RNA-seq expression of NF-?B pathway genes overlapping JUNB ChIP-seq measured as fold change in A375 cells overexpressing JUNB relative to GFP control. N=3. (FIG. 9F) Western blots of phosphorylated or total p65 (RELA) protein in A375 cells overexpressing candidate genes. (FIG. 9G) Schematic describing the pathways MCL1 and JUNB are involved in to mediate resistance to T cell cytotoxicity. All values are mean?s.e.m. ****P<0.0001; ***P<0.001; **P<0.01; *P<0.05; ns, not significant.

    [0038] FIG. 10 (A-F)MCL1 and JUNB mediate survival by resisting FasL- and TRAIL-induced cytotoxicity. (FIG. 10A) Cell survival of A375 cells overexpressing candidate genes against different concentrations of FasL, TRAIL, or TNF?. N=4. (FIG. 10B) Western blots showing Caspase 8 cleavage products in A375 cells overexpressing candidate genes after treating with 500 ng/?L of FasL or TRAIL for 3 hours. (FIG. 10C) Dox-induction of different RefSeq isoforms of genes in the mitochondrial apoptosis pathway in A375 cells overexpressing MCL1. Cell survival against ESO T cell-induced cytotoxicity (n=8) and expression (n=4) of MCL1 interaction partners were measured at different Dox concentrations. (FIG. 10D) Expression of BCL2A1 in A375 cells overexpressing JUNB or B3GNT2 with BCL2A1 knocked down. N=4. KD, knockdown. NT, non-targeting. (FIG. 10E) Cell survival against 125 ng/?L of FasL- or TRAIL-induced cell death in A375 cells overexpressing JUNB or GFP with BCL2A1 knocked down. N=4. (FIG. 10F) Cell survival against ESO T cells in A375 cells overexpressing JUNB or GFP with BCL2A1 knocked down. N=8. All values are mean?s.e.m. ****P<0.0001; ***P<0.001; **P<0.01; *P<0.05; ns, not significant.

    [0039] FIGS. 11 (A-F)B3GNT2 adds poly-LacNAc to tumor ligands and receptors to promote tumor immune evasion. (FIG. 11A) Intra- and extra-cellular poly-LacNAc measured by tomato lectin staining in A375 cells overexpressing B3GNT2 or GFP that were treated with different concentrations of kifunensine or benzyl-2-acetamido-2-deoxy-?-D-galactopyranoside (BAG) glycosylation inhibitors. N=3. (FIG. 11B) Cell survival against T cell cytotoxicity (top) and T cell IFN? secretion (bottom) in A375 cells overexpressing B3GNT2 or GFP that have been treated with different concentrations of BAG at E:T ratio of 3. N=6. (FIG. 11C-D) Western blots of different tumor ligands and receptors that interact with T cells in A375 cells overexpressing candidate genes. For a subset of the ligands and receptors that were potentially glycosylated (D), enzymatic deglycosylation was performed to confirm presence of N- or O-glycosylation. (FIG. 11E) Western blots of tumor cell surface ligands and receptors that interact with T cells in SW1417 colorectal adenocarcinoma cells. Cells were treated with kifunensine (KIF) or BAG to remove N- or O-glycosylation respectively. (FIG. 11F) Co-IP of N- or C-terminal FLAG tagged (N-FLAG or C-FLAG) B3GNT2 followed by Western blot for different B3GNT2 target proteins. 2% of the input and IgY IP controls are shown. All values are mean?s.e.m. ****P<0.0001; **P<0.01; *P<0.05; ns, not significant.

    [0040] FIGS. 12 (A-D)B3GNT2 disrupts ligand-receptor interactions between tumor and T cells. (FIG. 12A) Cell survival against T cell cytotoxicity (top) and T cell IFN? secretion (bottom) in A375 cells overexpressing B3GNT2 or GFP that have been treated with different concentrations of kifunensine at E:T ratio of 3. N=6. (FIG. 12B) Western blots of tumor cell surface ligands and receptors that interact with T cells in A375 cells overexpressing B3GNT2 or GFP. Cells were treated with kifunensine (KIF) or benzyl 2-acetamido-2-deoxy-?-D-galactopyranoside (BAG) to remove N- or O-glycosylation respectively. (FIG. 12C) Histograms showing binding of recombinant T cell proteins to A375 cells measured by flow cytometry. A375 cells were overexpressing GFP or B3GNT2 and treated with KIF or BAG. N=3. (FIG. 12D) Schematic showing the tumor cell surface ligands and receptors modified by B3GNT2 to disrupt interactions with T cells that mediate cytotoxicity. All values are mean?s.e.m. ****P<0.0001; ***P<0.001; **P<0.01; *P<0.05; ns, not significant.

    [0041] FIG. 13 (A-J)Inhibition of candidate genes increases susceptibility of tumors to T cell killing upon knockdown. (FIG. 13A) Heatmap showing expression of candidate genes in different cell lines transduced with CRISPR knockdown (KD) sgRNAs relative to non-targeting (NT) sgRNAs. N=4. (FIG. 13B) Percent indels generated by different CRISPR knockout (KO) sgRNAs targeting candidate genes in A375 melanoma and SW1417 colorectal adenocarcinoma cells. N=3. (FIG. 13C-H) Cell survival against T cell-mediated cytotoxicity with different candidate genes knocked down (C-E) or knocked out (F-H). Cell lines that did not endogenously express HLA-A2 or NY-ESO-1 were transduced with the respective constructs. N=8. c, SW1417 (NY-ESO-1.sup.?, HLA-A2.sup.?) colorectal adenocarcinoma against ESO T cells. (FIG. 13D) A375 (NY-ESO-1.sup.+, HLA-A2.sup.+) melanoma against ESO T cells. (FIG. 13E) OAW28 (NY-ESO-1.sup.+, HLA-A2.sup.?) ovarian cystadenocarcinoma against ESO T cells. (FIG. 13F) SW1417 (HER2.sup.+) colorectal adenocarcinoma against HER2 CAR T cells. (FIG. 13G) SW1417 (NY-ESO-1.sup.?, HLA-A2.sup.?) colorectal adenocarcinoma against ESO T cells. (FIG. 13H) A375 (NY-ESO-1.sup.+, HLA-A2.sup.+) melanoma against ESO T cells. (FIG. 13I-J) Cell survival against T cell cytotoxicity in tumor cells treated with small molecule inhibitors targeting MCL1 (S63845 and AZD5991) or B3GNT2 (kifunensine). N=8. (FIG. 13I) A375 (NY-ESO-1.sup.+, HLA-A2.sup.+) melanoma against ESO T cells. (FIG. 13J) CCLF_MELM_0011 T (HER2.sup.+) primary patient-derived melanoma model against HER2 CAR T cells. All values are mean?s.e.m. ****P<0.0001; ***P<0.001; **P<0.01; *P<0.05; ns, not significant.

    [0042] FIGS. 14 (A-H)B3GNT2 overexpression disrupts binding of T cell ligands and receptors to tumor cells. (FIG. 14A) Histograms showing binding of various T cell ligands or receptor proteins to A375 cells overexpressing candidate genes measured by flow cytometry. (FIG. 14B) Histogram showing binding of an antibody specific for HLA-A2:NY-ESO-1 to A375 cells overexpressing B3GNT2 or GFP that have been treated with kifunensine (KIF). (FIG. 14C) Percent indels generated by different CRISPR knockout (KO) sgRNAs targeting 4-1BBL (TNFSF9) in A375 cells. (FIG. 14D) Protein expression of 4-1BBL after CRISPR KO. (FIG. 14E) Histogram showing binding of 4-1BB to A375 cells with different KO sgRNAs targeting 4-1BBL. (FIG. 14F) CD276 expression in A375 cells with different CRISPR knockdown (KD) sgRNAs. (G) Protein expression of CD276 after CRISPR KD. (FIG. 14H) Histogram showing binding of TREML2 to A375 cells with different KD sgRNAs targeting CD276. All values are mean?s.e.m. with n=3. NT, non-targeting; ****P<0.0001; ***P<0.001; **P<0.01; *P<0.05; ns, not significant.

    [0043] FIG. 15 (A-E)Inhibition of candidate genes sensitizes tumors to T cell cytotoxicity. (FIG. 15A) Cell survival against HER2 CAR T cell cytotoxicity in SW1417 (HER2.sup.+) colorectal adenocarcinoma with different candidate genes knocked down using CRISPRi and 2 sgRNAs per gene. KD, knockdown. NT, non-targeting. (FIG. 15B-E) Cell survival against T cell cytotoxicity in tumor cells treated with MCL1 or B3GNT2 small molecule inhibitors, S63845 and kifunensine respectively. (FIG. 15B) A375 (NY-ESO-1.sup.+, HLA-A2*) melanoma against ESO T cells. (FIG. 15C) SW1417 (HER2.sup.+) colorectal adenocarcinoma against HER2 CAR T cells. (FIG. 15D) CCLF_MELM_0011_T (AXL.sup.+) primary patient-derived melanoma model against AXL CAR T cells. (FIG. 15E) CCLF_PANC_0014_T (HER2.sup.+) primary patient-derived pancreatic adenocarcinoma against HER2 CAR T cells. All values are mean?s.e.m with n=8. ****P<0.0001; ***P<0.001; **P<0.01; *P<0.05; ns, not significant.

    [0044] The figures herein are for illustrative purposes only and are not necessarily drawn to scale.

    DETAILED DESCRIPTION OF THE EXAMPLE EMBODIMENTS

    General Definitions

    [0045] Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains. Definitions of common terms and techniques in molecular biology may be found in Molecular Cloning: A Laboratory Manual, 2.sup.nd edition (1989) (Sambrook, Fritsch, and Maniatis); Molecular Cloning: A Laboratory Manual, 4.sup.th edition (2012) (Green and Sambrook); Current Protocols in Molecular Biology (1987) (F. M. Ausubel et al. eds.); the series Methods in Enzymology (Academic Press, Inc.): PCR 2: A Practical Approach (1995) (M. J. MacPherson, B. D. Hames, and G. R. Taylor eds.): Antibodies, A Laboratory Manual (1988) (Harlow and Lane, eds.): Antibodies A Laboratory Manual, 2.sup.nd edition 2013 (E. A. Greenfield ed.); Animal Cell Culture (1987) (R.I. Freshney, ed.); Benjamin Lewin, Genes IX, published by Jones and Bartlet, 2008 (ISBN 0763752223); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0632021829); Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 9780471185710); Singleton et al., Dictionary of Microbiology and Molecular Biology 2nd ed., J. Wiley & Sons (New York, N.Y. 1994), March, Advanced Organic Chemistry Reactions, Mechanisms and Structure 4.sup.th ed., John Wiley & Sons (New York, N. Y. 1992); and Marten H. Hofker and Jan van Deursen, Transgenic Mouse Methods and Protocols, 2nd edition (2011).

    [0046] As used herein, the singular forms a, an, and the include both singular and plural referents unless the context clearly dictates otherwise.

    [0047] The term optional or optionally means that the subsequent described event, circumstance or substituent may or may not occur, and that the description includes instances where the event or circumstance occurs and instances where it does not.

    [0048] The recitation of numerical ranges by endpoints includes all numbers and fractions subsumed within the respective ranges, as well as the recited endpoints.

    [0049] The terms about or approximately as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, are meant to encompass variations of and from the specified value, such as variations of +/?10% or less, +/?5% or less, +/?1% or less, and +/?0.1% or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier about or approximately refers is itself also specifically, and preferably, disclosed.

    [0050] As used herein, a biological sample may contain whole cells and/or live cells and/or cell debris. The biological sample may contain (or be derived from) a bodily fluid. The present invention encompasses embodiments wherein the bodily fluid is selected from amniotic fluid, aqueous humour, vitreous humour, bile, blood serum, breast milk, cerebrospinal fluid, cerumen (earwax), chyle, chyme, endolymph, perilymph, exudates, feces, female ejaculate, gastric acid, gastric juice, lymph, mucus (including nasal drainage and phlegm), pericardial fluid, peritoneal fluid, pleural fluid, pus, rheum, saliva, sebum (skin oil), semen, sputum, synovial fluid, sweat, tears, urine, vaginal secretion, vomit and mixtures of one or more thereof. Biological samples include cell cultures, bodily fluids, cell cultures from bodily fluids. Bodily fluids may be obtained from a mammal organism, for example by puncture, or other collecting or sampling procedures.

    [0051] The terms subject, individual, and patient are used interchangeably herein to refer to a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed.

    [0052] Various embodiments are described hereinafter. It should be noted that the specific embodiments are not intended as an exhaustive description or as a limitation to the broader aspects discussed herein. One aspect described in conjunction with a particular embodiment is not necessarily limited to that embodiment and can be practiced with any other embodiment(s). Reference throughout this specification to one embodiment, an embodiment, an example embodiment, means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment of the present invention. Thus, appearances of the phrases in one embodiment, in an embodiment, or an example embodiment in various places throughout this specification are not necessarily all referring to the same embodiment, but may. Furthermore, the particular features, structures or characteristics may be combined in any suitable manner, as would be apparent to a person skilled in the art from this disclosure, in one or more embodiments. Furthermore, while some embodiments described herein include some but not other features included in other embodiments, combinations of features of different embodiments are meant to be within the scope of the invention. For example, in the appended claims, any of the claimed embodiments can be used in any combination.

    [0053] All publications, published patent documents, and patent applications cited herein are hereby incorporated by reference to the same extent as though each individual publication, published patent document, or patent application was specifically and individually indicated as being incorporated by reference.

    Overview

    [0054] Embodiments disclosed herein provide novel gene targets, B3GNT2, MCL1, BCL2A1 and JUNB, which when overexpressed, enabled tumor cells to evade killing by cytotoxic T cells. These four gene targets have not heretofore been associated with immune evasion or to confer resistance to diverse cancer cell types and mouse xenografts. The importance of immune evasion by tumors is exemplified by the introduction and success of T cell targeted immunomodulators blocking the immune checkpoints CTLA-4 and PD1 or PDL1 (immune checkpoint inhibitors (ICI)). Anti-PD1/PDL1 antibodies have become some of the most widely prescribed anti-cancer therapies. T-cell-targeted immunomodulators are now used as single agents or in combination with chemotherapies as first or second lines of treatment for about 50 cancer types. Thus, immunotherapy leads the field in cancer research owing to the clinical success of ICI and the need to identify additional immune evasion targets is greater than ever.

    [0055] In one aspect, embodiments disclosed herein are directed to methods of enhancing anti-tumor immunity by administering one or more agents that reduce the expression or activity of B3GNT2. In another aspect, embodiments disclosed herein are directed to methods of enhancing anti-tumor immunity by administering one or more agents that inhibit poly-N-acetyl-lactosamine (poly-LacNAc) synthesis in tumor cells, or by reducing poly-LacNac on surface N-glycans. In another aspect, embodiments disclosed herein are directed to methods of enhancing anti-tumor immunity by administering one or more agents capable of inhibiting the expression or activity of MCL1. In another aspect, embodiments disclosed herein are directed to methods of enhancing anti-tumor immunity by administering one or more agents that reduce the expression or activity of BCL2A1. In another aspect, embodiments disclosed herein are directed to methods of enhancing anti-tumor immunity by administering one or more agents that reduce the expression or activity of JUNB.

    [0056] In another aspect, the therapeutic methods disclosed above may be administered in combination with an immunotherapy. In one example embodiment, the immunotherapy may comprise adoptive cell transfer of immune cells specific for a tumor. In one example embodiment, the cell transfer comprises the administration of CAR (chimeric antigen receptor) T cells or natural killer cells, T cells expressing a T cell receptor (TCR) specific for a tumor antigen, or tumor infiltrating lymphocytes (TILs). In one example embodiment, the immunotherapy comprises checkpoint blockade (CPB) therapy. In one example embodiment, the checkpoint blockade therapy comprises anti-CTLA4, anti-PD-L1, anti-PD1, anti-TIM3, anti-TIGIT, anti-LAG3, or combinations thereof.

    [0057] In another aspect, embodiments disclosed herein are directed to methods of monitoring the efficacy of an immunotherapy comprising detecting the expression of one or more genes selected from the group consisting of B3GNT2, MCL1, BCL2A1, and JUNB in a subject treated with an immunotherapy, wherein the subject is a non-responder to the immunotherapy if the one or more genes are upregulated after being treated.

    [0058] In another aspect, embodiments disclosed herein are directed to methods of screening for agents capable of decreasing poly-LacNac on tumor cells comprising a) contacting a population of tumor cells having upregulated B3GNT2 with an agent; and b) detecting binding of one or more proteins to the tumor cells selected from the group consisting of CD2, 4-1BB, TREML2 (TLT2), NKG2D, and an antibody specific for an HLA class I bound tumor antigen, wherein increased binding indicates reduced poly-LacNac.

    [0059] In another aspect, embodiments disclosed herein are directed to methods of enhancing anti-tumor immunity in a subject in need thereof comprising administering to the subject one or more agents capable of inhibiting the expression or activity of one or more targets selected from Table 1, Table 2 (candidate genes) or Table 3.

    Method of Enhancing Anti-Tumor Immunity Through Inhibition of B3GNT2 Protein Activity

    [0060] The ?1,3-N-acetylglucosaminyltransferase 2 (B3GNT2) enzyme is encoded by the B3GNT2 gene and is involved in poly-N-acetyl-lactosamine (poly-LacNac) synthesis). As with other ?1,3-N-acetylglucosaminyltransferases, the enzyme is a Golgi-resident glycosyltransferase. Poly-N-acetyl-lactosamine (poly-LacNAc) structures are composed of repeating [-Gal?(1,4)-GlcNAc?(1,3)-]n glycan extensions. Further, they are found on both N- and O-glycoproteins and glycolipids and play an important role in development, immune function, and human disease. The majority of mammalian poly-LacNAc is synthesized by the alternating iterative action of B3GNT2 and ?1,4-galactosyltransferases. B3GNT2 is in the largest mammalian glycosyltransferase family, GT31. As discussed further herein, the Applicant has identified B3GNT2 expression as up-regulated in tumors that have become non-responsive to immunotherapy, including use of checkpoint inhibitors and adoptive cell transfer. Additionally, reducing B3GNT2 activity shifts tumors from an immunotherapy non-responsive to a responsive phenotype.

    [0061] In one example embodiment, a method of enhancing anti-tumor immunity comprises administering one or more agents capable of inhibiting the expression or activity of B3GNT2. In one example embodiment, the method comprises administering one or more small molecules that inhibit B3GNT2 activity. In another example embodiment, the method comprises administering a RNAi polynucleotide to knockdown expression of B3GNT2. In another example embodiment, the method comprises delivering a programmable nuclease to reduce expression of B3GNT2.

    Small Molecule Inhibitors of B3GNT2

    [0062] In one example embodiment, a method of enhancing anti-tumor immunity in a subject comprises administering one or more small molecules that inhibit B3GNT2 activity. The small molecule inhibits may bind to B3GNT2's active site or function as an allosteric inhibitor of B3GNT2 activity.

    [0063] In one example embodiment, B3GNT2 protein activity is inhibited by administering one or more small molecule agents selected from the group consisting of benzyl-ON-acetylgalactosamide (BAG), kifunensine (KIF), tunicamycin, 3-Azidothymidine (AZT), 2-acetamido-1,3,6-tri-O-acetyl-4-deoxy-4-fluoro-D-glucopyranose [4-F-GlcNAc], and deoxymannojirimycin (DMN).

    Method of Enhancing Anti-Tumor Immunity Through Inhibition of MCL1 Protein Function

    [0064] A tumor may block an apoptosis pathway in order to evade killing by an anti-tumor immune response. In certain embodiments, a tumor overexpresses MCL1. Apoptosis is a crucial process by which multicellular organisms control tissue growth, removal and inflammation. Disruption of the normal apoptotic function is often observed in cancer, where cell death is avoided by the overexpression of anti-apoptotic proteins of the Bcl-2 (B-cell lymphoma) family, including MCL1 (myeloid cell leukemia). This makes MCL1 a potential target for drug therapy, through which normal apoptosis may be restored by inhibiting the protective function of MCL1.

    [0065] Myeloid cell leukemia-1 (MCL1) is an anti-apoptotic member of the B-cell lymphoma-2 (BCL-2) family of proteins that regulates apoptosis. Alternative splicing occurs for MCL1 and two transcript variants encoding distinct isoforms have been identified. The longer gene product (isoform 1, MCL-1L) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene product (isoform 2 MCL-1S) promotes apoptosis and is death-inducing. In certain embodiments, isoform 1 is targeted. The members of the Bel-2 family are designated as such due to their BCL-2 homology (BH) domains and involvement in apoptosis regulation. The BH domains facilitate the family members' interactions with each other, and can indicate pro- or anti-apoptotic function. Traditionally, these proteins are categorized into one of three subfamilies; anti-apoptotic, BH3-only (pro-apoptotic), and pore-forming or executioner (pro-apoptotic) proteins (BAX and BAK) (see, e.g., Warren C F A, Wong-Brown M W, Bowden N A. BCL-2 family isoforms in apoptosis and cancer Cell Death Dis. 2019; 10(3): 177; and Vogler, M. BCL2A1: the underdog in the BCL2 family. Cell Death Differ 19, 67-74 (2012)). MCL-1 exerts its antiapoptotic function by sequestering proapoptotic proteins BAK/BAX through the BH3 domain containing hydrophobic groove. In the prosurvival mode, BAK/BAX interacts with antiapoptotic BCL-2 proteins and is unable to execute the apoptotic program, thereby allowing cells to maintain homeostasis (see, e.g., Xiang W, Yang C Y, Bai L. MCL-1 inhibition in cancer treatment. Onco Targets Ther. 2018; 11:7301-7314). BH3-only proteins, BIM, PUMA, BAD, NOXA and BID, restore BAX/BAK activities through interruption of the MCL-1:BAK/BAX complexes. Id.

    [0066] Elevated levels of MCL1 contribute to tumorigenesis and resistance to conventional chemotherapies and targeted therapies, including the BCL-2 selective inhibitor venetoclax. Applicants discovered that MCL1 overexpression is used to evade an anti-tumor immune response and MCL1 inhibitors can be used to enhance an immunotherapy. Accordingly, in some embodiments disclosed herein, are methods designed to downregulate MCL1 expression or inhibit MCL1 for treating cancer, preferably in combination with an immunotherapy. In certain embodiments, subjects being treated with an immunotherapy have increased expression of MCL1 and become non-responsive. In certain embodiments, administering an agent targeting MCL1 expression or activity shifts a subject non-responsive to an immunotherapy to a responder. In certain embodiments, the one or more therapeutics described herein are administered to a subject that has a tumor overexpressing MCL1. The present invention also provides for determining subjects that may respond to an MCL1 inhibitor. For example, the tumor overexpresses MCL1 and does not overexpress another protein that allows evasion of an immune response.

    [0067] Human cancers are genetically and epigenetically heterogeneous and have the capacity to commandeer a variety of cellular processes to aid in their survival, growth and resistance to therapy. One such strategy is to overexpress proteins that suppress apoptosis, such as the BCL-2 family protein MCL1. The MCL1 protein plays a pivotal role in protecting cells from apoptosis and is overexpressed in a variety of human cancers. In an embodiment, a method of enhancing anti-tumor immunity in a subject in need thereof comprises administering to the subject one or more agents capable of inhibiting the expression or activity of MCL1.

    Small Molecule Inhibitors of MCL1

    [0068] Dysregulation of the mitochondrial apoptotic pathway controlled by members of the BCL-2 protein family plays a central role in cancer development and resistance to conventional cytotoxic as well as targeted therapies. The selective inhibition of the pro-survival BCL-2 family of proteins to activate apoptosis in malignant cells represents an anti-cancer strategy. The remarkable clinical performance of the selective BCL-2 antagonist Venetoclax has highlighted the potential for selective inhibitors of the other pro-survival members of the BCL-2 family, particularly MCL1. Venetoclax is a BH3-mimetic and can block the anti-apoptotic B-cell lymphoma-2 (Bcl-2) family proteins. The present invention also provides for use of the small molecules in combination with an immunotherapy treatment regimen. In certain embodiments, small molecules are administered in doses that do not induce apoptosis in the absence of an effective anti-tumor immune response. Thus, doses required to shift a subject from a nonresponder to a responder are lower than doses required to induce apoptosis and the doses of the present invention are lower than certain standard doses. In particular, doses are lower in a combination immunotherapy treatment regimen.

    [0069] In certain embodiments disclosed herein, the methods provide several drugs or small molecules that cause downregulation of MCL1 expression or a decrease in activity as part of their mechanism of action. Pan-cyclin-dependent kinase inhibitors, such as flavopiridol, SNS-032, CYC202 (Roscovitine) and dinaciclib, or the selective CDK9 inhibitors BAY1251152 and AZD4573 have been reported to kill cells in part by blocking MCL1 transcription (Chen et al., 2009; Cidado et al., 2018; Fu et al., 2011; Gojo, Zhang et al. 2002; Luecking et al., 2017). Chemotherapeutic drugs such as anthracyclines were found to preferentially repress MCL1 transcription to induce apoptosis in tumor cells (Wei et al., 2012). These small molecules that target MCL1 expression or activity are hereby specifically incorporated by reference.

    [0070] In certain example embodiments disclosed herein, the methods provide other drugs or small molecules capable of inhibiting the expression or activity of MCL1 and include S63845, MIK665/S64315, AT101 (R-(?)-gossypol), TW-37, Gambogic acid, Sabutoclax (BI-97C1), Marinopyrrole A (maritoclax), UMI-77, A-1210477, Fesik's compounds, AMG176, AZD5991, Flavopiridol, Roscovitine, CR8, Voruciclib (P1446A-05), Cardiac glycoside, UNBS1450, Benzyl isothiocyanate, BAY43-9006, BEZ235, AZD8055, BEZ235, AZD8055, and arsenic trioxide Bufalin (see, e.g., Xiang W, Yang C Y, Bai L. MCL-1 inhibition in cancer treatment. Onco Targets Ther. 2018; 11:7301-7314).

    [0071] In a certain example embodiment, disclosed herein is provided a method for inhibiting MCL1 expression or activity by administering one or more small molecule agents to a subject in need thereof. In embodiments, the present disclosure provides one or more small molecule agents selected from the group consisting of S63845, MIK665/S64315, AT101 (R-(?)-gossypol), TW-37, Gambogic acid, Sabutoclax (BI-97C1), Marinopyrrole A (maritoclax), UMI-77, A-1210477, Fesik's compounds, AMG176, AZD5991, Flavopiridol, Roscovitine, CR8, Voruciclib (P1446A-05), Cardiac glycoside, UNBS1450, Benzyl isothiocyanate, BAY43-9006, BAY1251152, BEZ235, AZD4573, AZD8055, SNS-032, dinaciclib, BEZ235, AZD8055, arsenic trioxide Bufalin, and analogues thereof.

    [0072] MCL1 protein is unique compared to its pro-survival BCL-2 relatives. MCL1 expression is regulated at the transcriptional level by trophic factors such as granulocyte-macrophage stimulating factor, epidermal growth factor and cytokines (Chao et al., 1998; Huang, et al., 2000; Jourdan et al, 2000). At the intracellular level, transcription of MCL1 is controlled by several signaling pathways, including the PI3K/AKT, p38/MAPK and STAT3 pathways (Akgul, 2009; Becker et al., 2014; Huelsemann et al., 2014). In addition, N10 miRNA has been identified to modulate MCL1 translation, including miR-29 and miR-125b, and are reviewed elsewhere (Cui et al, 2018).

    [0073] In some embodiments, the methods of inhibiting or downregulating MCL1 expression or activity may further comprise administering the above trophic factors (e.g., EGF) and modulating the above signaling pathways. These trophic factors and signaling pathways that target MCL1 expression or activity are hereby specifically incorporated by reference.

    [0074] Embodiments of the present disclosure take into consideration the pro-survival role MCL1 has in many normal tissues. MCL1 is ubiquitously expressed and essential for embryonic development as demonstrated by studies performed in mice with homozygous loss of MCL1 (Kozopas, et al, 1993; Rinkenberger et al., 2000). Conditional MCL1 knockout mice showed that MCL1 also plays a critical role in the survival of hematopoietic stem cells, lymphocytes and cardiomyocytes, among other normal cells (Opferman et al., 2003; Opferman et al., 2005; Thomas et al., 2013). However, it is possible that some of the observed effects in normal tissues are caused by chronic depletion of MCL1 or other activities besides their anti-apoptotic function and could potentially be mitigated by careful dosing and schedule of MCL1 inhibitors in disease treatment. Accordingly, embodiments of the present disclosure take into consideration the clinical applications of administering MCL1 inhibitors and the pro-survival role of MCL1.

    Method of Enhancing Anti-Tumor Immunity Through Inhibition of BCL2A1 Protein Activity

    [0075] BCL2A1 encodes a member of the bcl2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators and has been shown to be up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. BCL2A1 is overexpressed in a variety of cancer cells, including hematological malignancies and solid tumors, and may contribute to tumor progression (see, e.g., Vogler, M. BCL2A1: the underdog in the BCL2 family. Cell Death Differ 19, 67-74 (2012)). BCL2A1 exerts its anti-apoptotic function by sequestering pro-apoptotic B-cell lymphoma 2 (BCL2) proteins. Id. Enhanced expression of BCL2A1 can result in resistance to chemotherapeutic drugs. Id. The main function of the anti-apoptotic BCL2 proteins is to counteract the activation of BAX and BAK. Thus, they can either inhibit BAX and BAK directly, or sequester and inactivate BH3-only proteins. Id. Multiple anti-apoptotic BCL2 proteins have been described, namely BCL2, BCL-XL, BCL-w, MCL1, BCL-B and BCL2A1. Id. BCL2A1 does not display a well-defined C-terminal transmembrane domain. The C-terminus of BCL2A1 is of importance for the anti-apoptotic function and the subcellular localization of BCL2A1. Id. BCL2A1 has a similar binding profile as displayed by MCL1. Id. Applicants identified BCL2A1 as a gene overexpressed in tumors resistant to T cell killing. Thus, inhibition of BCL2A1 can be used to enhance anti-tumor immunity and immunotherapy.

    [0076] Accordingly, in some embodiments disclosed herein, are methods designed to downregulate BCL2A1 expression or inhibit BCL2A1 for treating cancer, preferably in combination with an immunotherapy. In certain embodiments, subjects being treated with an immunotherapy have increased expression of BCL2A1 and become non-responsive. In certain embodiments, administering an agent targeting BCL2A1 expression or activity shifts a subject non-responsive to an immunotherapy to a responder. In certain embodiments, the one or more therapeutics described herein are administered to a subject that has a tumor overexpressing BCL2A1. The present invention also provides for determining subjects that may respond to an BCL2A1 inhibitor. For example, the tumor overexpresses BCL2A1 and does not overexpress another protein that allows evasion of an immune response.

    Small Molecule and Peptide Inhibitors of BCL2A1

    [0077] Dysregulation of the mitochondrial apoptotic pathway controlled by members of the BCL-2 protein family plays a central role in cancer development and resistance to conventional cytotoxic as well as targeted therapies. The selective inhibition of the pro-survival BCL-2 family of proteins to activate apoptosis in malignant cells represents an anti-cancer strategy. The remarkable clinical performance of the selective BCL-2 antagonist Venetoclax has highlighted the potential for selective inhibitors of the other pro-survival members of the BCL-2 family, particularly BCL2A1. Venetoclax is a BH3-mimetic and can block the anti-apoptotic B-cell lymphoma-2 (Bcl-2) family proteins. The present invention also provides for use of the small molecules/peptide inhibitors in combination with an immunotherapy treatment regimen. In certain embodiments, inhibitors are administered in doses that do not induce apoptosis in the absence of an effective anti-tumor immune response. Thus, doses required to shift a subject from a nonresponder to a responder are lower than doses required to induce apoptosis and the doses of the present invention are lower than certain standard doses. In particular, doses are lower in a combination immunotherapy treatment regimen.

    [0078] In certain embodiments disclosed herein, the methods provide several drugs or small molecules that are capable of inhibiting the expression or activity of BCL2A1. Non-limiting examples include Venetoclax, AT101 (R-(?)-gossypol), TW-37, Gambogic acid, Sabutoclax (BI-97C1) and Marinopyrrole A (maritoclax). Other small molecules may be used (see, e.g., Vogler, M. BCL2A1: the underdog in the BCL2 family. Cell Death Differ 19, 67-74 (2012)). For example, N-aryl maleimides have been identified as potential BCL2A1 inhibitors by high-throughput screening of 66 000 compounds (Cashman J R, MacDonald M, Ghirmai S, Okolotowicz K J, Sergienko E, Brown B et al. Inhibition of Bfl-1 with N-aryl maleimides. Bioorg Med Chem Lett 2010; 20: 6560-6564). Several apogossypol derivatives may target BCL2A1 (Wei J, Kitada S, Rega M F, Emdadi A, Yuan H, Cellitti J et al. Apogossypol derivatives as antagonists of antiapoptotic Bcl-2 family proteins. Mol Cancer Ther 2009; 8: 904-913). Additionally, peptide aptamers that specifically target BCL2A1 have been presented, which sensitized malignant B-cells to chemotherapeutic drugs (Brien G, Debaud A L, Bickle M, Trescol-Biemont M C, Moncorge O, Colas P et al. Characterization of peptide aptamers targeting Bfl-1 anti-apoptotic protein. Biochemistry 2011; 50: 5120-5129).

    Alternative Methods to Counter-Acting MCL1 and BCL2A1 Anti-Apoptotic Activity in Tumor Cells

    [0079] The members of the Bcl-2 family are designated as such due to their BCL-2 homology (BH) domains and involvement in apoptosis regulation. The BH domains facilitate the family members' interactions with each other, and can indicate pro- or anti-apoptotic function. Traditionally, these proteins are categorized into one of three subfamilies; anti-apoptotic, BH3-only (pro-apoptotic), and pore-forming or executioner (pro-apoptotic) proteins (BAX and BAK) (see, e.g., Warren C F A, Wong-Brown M W, Bowden N A. BCL-2 family isoforms in apoptosis and cancer. Cell Death Dis. 2019; 10(3):177; and Vogler, M. BCL2A1: the underdog in the BCL2 family. Cell Death Differ 19, 67-74 (2012)). MCL-1 exerts its antiapoptotic function by sequestering proapoptotic proteins BAK/BAX through the BH3 domain containing hydrophobic groove. In the prosurvival mode, BAK/BAX interacts with antiapoptotic BCL-2 proteins and is unable to execute the apoptotic program, thereby allowing cells to maintain homeostasis (see, e.g., Xiang W, Yang C Y, Bai L. MCL-1 inhibition in cancer treatment. Onco Targets Ther. 2018; 11:7301-7314). BH3-only proteins, BIM, PUMA, BAD, NOXA and BID, restore BAX/BAK activities through interruption of the MCL-1:BAK/BAX complexes. Id. BAK/BAX allows release of cytochrome c and activates caspase cascade.

    Gene Therapy Embodiments For Increasing BID, PMAIP1, BAX, BAK, BIM, BAD and PUMA

    [0080] In one example embodiment, gene therapy may be used to increase one or more genes selected from the group consisting of BID, PMAIP1 (NOXA), BAX, BAK, BIM, BAD and PUMA in tumor cells. In certain embodiments, expression is increased in proportion to overexpression of MCL1. In certain embodiments, gene therapy is used for subjects having tumors that overexpress MCL1. As used herein, the terms gene therapy, gene delivery, gene transfer and genetic modification are used interchangeably and refer to modifying or manipulating the expression of a gene to alter the biological properties of living cells for therapeutic use.

    [0081] In one example embodiment, a vector for use in gene therapy comprises a sequence encoding a gene selected from the group consisting of BID, PMAIP1 (NOXA), BAX, BAK, BIM, BAD and PUMA and is used to deliver said sequence to tumor cells. The vector may further comprise one or more regulatory elements to control expression of the gene. The vector may further comprise regulatory/control elements, e.g., promoters, enhancers, introns, polyadenylation signals, Kozak consensus sequences, or internal ribosome entry sites (IRES). The vector may further comprise a targeting moiety that directs the vector specifically to tumor cells. In another example embodiment, the vector may comprise a viral vector with a tropism specific for tumors.

    [0082] In general, and throughout this specification, the term vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g., circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art. There are no limitations regarding the type of vector that can be used. The vector can be a cloning vector, suitable for propagation and for obtaining polynucleotides, gene constructs or expression vectors incorporated to several heterologous organisms. Suitable vectors include eukaryotic expression vectors based on viral vectors (e.g. adenoviruses, adeno-associated viruses as well as retroviruses and lentiviruses), as well as non-viral vectors such as plasmids.

    [0083] In one example embodiment, the vector is a viral vector, wherein virally-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g., retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses). Viral vectors also include polynucleotides carried by a virus for transfection into a host cell. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operably linked. Such vectors are referred to herein as expression vectors. Vectors for and that result in expression in a eukaryotic cell can be referred to herein as eukaryotic expression vectors. In another example embodiment, the vector integrates the gene into the cell genome or is maintained episomally.

    [0084] In one example embodiment, the vector is a plasmid, which refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques.

    [0085] In one example embodiment, the vector is an mRNA vector (see, e.g., Sahin, U, Kariko, K and Tureci, O (2014). mRNA-based therapeuticsdeveloping a new class of drugs. Nat Rev Drug Discov 13: 759-780; Weissman D, Kariko K. mRNA: Fulfilling the Promise of Gene Therapy. Mol Ther. 2015; 23(9): 1416-1417. doi: 10.1038/mt.2015.138; Kowalski P S, Rudra A, Miao L, Anderson D G. Delivering the Messenger: Advances in Technologies for Therapeutic mRNA Delivery. Mol Ther. 2019; 27(4):710-728. doi:10.1016/j.ymthe.2019.02.012; Magadum A, Kaur K, Zangi L. mRNA-Based Protein Replacement Therapy for the Heart. Mol Ther. 2019; 27(4): 785-793. doi:10.1016/j.ymthe.2018.11.018; Reichmuth A M, Oberli M A, Jaklenec A, Langer R, Blankschtein D. mRNA vaccine delivery using lipid nanoparticles Ther Deliv. 2016; 7(5):319-334. doi:10.4155/tde-2016-0006; and Khalil A S, Yu X, Umhoefer J M, et al. Single-dose mRNA therapy via biomaterial-mediated sequestration of overexpressed proteins. Sci Adv. 2020; 6(27):eaba2422). In an exemplary embodiment, mRNA encoding for dominant negative JUNB is delivered using lipid nanoparticles (see, e.g., Reichmuth, et al., 2016) and administered directly to a tumor. In an exemplary embodiment, mRNA encoding for dominant negative JUNB is delivered using biomaterial-mediated sequestration (see, e.g., Khalil, et al., 2020) and administered directly to tumor tissue. Sequences present in mRNA molecules, as described further herein, are applicable to mRNA vectors (e.g., Kozak consensus sequence, miRNA target sites and WPRE).

    Regulatory Elements

    [0086] Recombinant expression vectors can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory elements, which may be selected on the basis of the host cells to be used for expression, that is operably-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, operably linked is intended to mean that the nucleotide sequence of interest is linked to the regulatory element(s) in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell). The term operably linked as used herein also refers to the functional relationship and position of a promoter sequence relative to a polynucleotide of interest (e.g., a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of that sequence). Typically, an operably linked promoter is contiguous with the sequence of interest. However, enhancers need not be contiguous with the sequence of interest to control its expression. The term promoter, as used herein, refers to a nucleic acid fragment that functions to control the transcription of one or more polynucleotides, located upstream of the polynucleotide sequence(s), and which is structurally identified by the presence of a binding site for DNA-dependent RNA polymerase, transcription initiation sites, and any other DNA sequences including, but not limited to, transcription factor binding sites, repressor, and activator protein binding sites, and any other sequences of nucleotides known in the art to act directly or indirectly to regulate the amount of transcription from the promoter. A tissue-specific promoter is only active in specific types of differentiated cells or tissues.

    [0087] In another embodiment, the vector of the invention further comprises expression control sequences including, but not limited to, appropriate transcription sequences (i.e. initiation, termination, promoter, and enhancer), efficient RNA processing signals (e.g. splicing and polyadenylation (polyA) signals), sequences that stabilize cytoplasmic mRNA, sequences that enhance translation efficiency (i.e. Kozak consensus sequence), and sequences that enhance protein stability. A great number of expression control sequences, including promoters which are native, constitutive, inducible, or tissue-specific are known in the art and may be utilized according to the present invention.

    [0088] In another embodiment, the vector of the invention further comprises a post-transcriptional regulatory region. In a preferred embodiment, the post-transcriptional regulatory region is the Woodchuck Hepatitis Virus post-transcriptional region (WPRE) or functional variants and fragments thereof and the PPT-CTS or functional variants and fragments thereof (see, e.g., Zufferey R, et al., J. Virol. 1999; 73:2886-2892; and Kappes J, et al., WO 2001/044481). In a particular embodiment, the post-transcriptional regulatory region is WPRE. The term Woodchuck hepatitis virus posttranscriptional regulatory element or WPRE, as used herein, refers to a DNA sequence that, when transcribed, creates a tertiary structure capable of enhancing the expression of a gene (see, e.g., Lee Y, et ah, Exp. Physiol. 2005; 90(1):33-37 and Donello J, et al, J. Virol. 1998; 72(6):5085-5092).

    [0089] The term regulatory element is intended to include promoters, enhancers, internal ribosomal entry sites (IRES), and other expression control elements (e.g., transcription termination signals, such as polyadenylation signals and poly-U sequences). Such regulatory elements are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990).

    [0090] Regulatory elements include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). A tissue-specific promoter may direct expression primarily in a desired tissue of interest, such as adipose tissue or particular cell types (e.g., adipocytes or adipocyte progenitors). Regulatory elements may also direct expression in a temporal-dependent manner, such as in a cell-cycle dependent or developmental stage-dependent manner, which may or may not also be tissue or cell-type specific. In some embodiments, a vector comprises one or more pol III promoter (e.g., 1, 2, 3, 4, 5, or more pol III promoters), one or more pol II promoters (e.g., 1, 2, 3, 4, 5, or more pol II promoters), one or more pol I promoters (e.g., 1, 2, 3, 4, 5, or more pol I promoters), or combinations thereof. Also encompassed by the term regulatory element are enhancer elements (e.g., adipose specific enhancers or Woodchuck Hepatitis Virus Posttranscriptional Regulatory Element (WPRE)). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression desired, etc. A vector can be introduced into host cells to thereby produce transcripts, proteins, or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., JUNB).

    [0091] In one embodiment, the vector contains at least one target sequence of at least one miRNA expressed in non-tumor tissue. The term microRNAs or miRNAs, as used herein, are small (?22-nt), evolutionarily conserved, regulatory RNAs involved in RNA-mediated gene silencing at the post-transcriptional level (see, e.g., Barrel D P. Cell 2004; 116: 281-297). Through base pairing with complementary regions (most often in the 3 untranslated region (3UTR) of cellular messenger RNA (mRNA)), miRNAs can act to suppress mRNA translation or, upon high-sequence homology, cause the catalytic degradation of mRNA. Because of the highly differential tissue expression of many miRNAs, cellular miRNAs can be exploited to mediate tissue-specific targeting of gene therapy vectors. By engineering tandem copies of target elements perfectly complementary to tissue-specific miRNAs (miRT)

    Method of Enhancing Anti-Tumor Immunity Through Targeting of JunB Protein Activity

    [0092] In one example embodiment, a method of enhancing anti-tumor immunity comprising inhibiting JunB activity. Inhibition of JunB expression or activity may increase the sensitivity of a tumor to T cell killing and further enhances the effectiveness of an immunotherapy (e.g., adoptive cell transfer). JunB inhibitors may be administered to subjects having a cancer with increased expression of JunB, especially where JunB expression is higher as compared to other Jun or AP-1 proteins. Administering a JunB inhibitor may help make a subject who is initially non-responsive to immunotherapy responsive to immunotherapy. The inhibitor used may directly JunB directly or indirection via a downstream target of JunB (Table 5 or Table 6).

    [0093] JunB is a member of the AP-1 (activator protein-1) family of dimeric transcription factors. The AP-1 family of transcription factors is composed of homodimers and heterodimers of Jun (v-Jun, c-Jun, JunB, and JunD), Fos (v-Fos, c-Fos, FosB, Fra1, and Fra2), ATF (ATF2, ATF3/LRF1, B-ATF, JDP1, and JDP2), and MAF (c-Maf, MafB, MafA, MafG/F/K, and Nrl) protein families, which are characterized by highly conserved dimeric basic leucine zipper (bZIP) DNA-binding domains (see, e.g., Ye N, Ding Y, Wild C, Shen Q, Zhou J. Small molecule inhibitors targeting activator protein 1 (AP-1). J Med Chem. 2014; 57(16):6930-6948). Specific Jun (JunB and JunD) and Fos (FosB, Fra1 and Fra2) proteins have been identified as oncoproteins, all of which are components of AP-1. Id. Certain AP-1 proteins have either a weak transforming activity (Fra1 and Fra2) or no transforming activity (JunB and JunD) due to the lack of potent transactivation domains. Id. AP-1 activity in cancer seems to depend upon AP-1 dimer composition and tumor type as well as its differentiation state, tumor stage, and the genetic background of tumor. Id. Generally, c-Jun mainly has oncogenic functions, while JunB and JunD have antioncogenic effects. Id. As such, it would be quite challenging for medicinal chemists to design potent and specific AP-1 inhibitors as potential therapy for cancer. Id. Individualized treatment may provide a solution to this problem by selecting appropriate patient populations (e.g., overexpressing JunB). In certain embodiments, subjects are treated that overexpress JunB.

    Small Molecule Inhibitors of JunB

    [0094] In one example embodiment, anti-tumor immunity is enhanced by administering one or more AP-1 inhibitors. Non-limiting examples of AP-1 inhibitors include curcumin, SP100030, SPC-839, T-5224, K1115A, momordin I, isosteviol and analogues thereof.

    Dominant Negative JunB

    [0095] In certain embodiments, a recombinant JunB dominant negative protein is used to inhibit endogenous JunB activity. JUNB has 347 amino acids with a predicted molecular weight 35.9 kD (see, e.g., HGNC: 6205, NCBI Entrez Gene: 3726, Ensembl: ENSG00000171223, UniProtKB/Swiss-Prot: P17275). Structurally, JUNB is similar to c-JUN, which contains a JNK (MAPK8) docking site (JUNB a.a. 35-61), nuclear localization signal (276-289), basic domain for DNA binding (250-276) and a leucine zipper domain for dimerization (296-317). However, JUNB does not contain a JNK phosphorylation site. Thus, the transactivation activity of JUNB is not regulated by JNK.

    [0096] JUNB is a member of JUN family (c-JUN, JUNB and JUND) that can dimerize with one another, or with members of Fos and ATF families, to form an AP-1 transcription factor. Comparing with c-JUN, the transactivation activity of JUNB is much weaker (see, e.g., Deng T, Karin M. JunB differs from c-Jun in its DNA-binding and dimerization domains and represses c-Jun by formation of inactive heterodimers. Genes Dev. 1993; 7(3):479-490). Due to the small differences on the amino acid sequences in the basic DNA binding domain, and leucine zipper domain, JUNB requires multiple AP-1 DNA binding sites for sufficient DNA binding. A number of studies demonstrated that JUNB antagonizes the functions of c-JUN in cell cycle regulation, proliferation and transformation by competing with c-JUN to form less efficient transactivating dimers. Thus, JUNB was considered as a tumor suppressor.

    [0097] In gene knockout studies, mice lacking c-Jun gene die during embryonic day 12.5 and 13.5, whereas embryos lacking JunB die earlier, around day 9.5, owing to vascular defects in the placenta and extraembryonic tissue. Interestingly, gene knock-in experiment indicated that JUNB could partially substitute the activities of c-JUN in mouse development and cell proliferation. As a possible explanation for this is that in presence of c-JUN, JUNB is a negative regulator for c-JUN. In contrast, in the absence of c-JUN, JUNB may substitute c-JUN and activate AP-1 target genes required for development and cell proliferation.

    [0098] Dominant negative mutants of c-Jun have been described (see, e.g., Brown P H, Kim S H, Wise S C, Sabichi A L, Birrer M J. Dominant-negative mutants of c-Jun inhibit AP-1 activity through multiple mechanisms and with different potencies. Cell Growth Differ. 1996; 7(8): 1013-1021). A dominant-negative mutant of c-Jun that lacks the transactivation domain (TAD) prevents AP-1-mediated transcriptional activation by quenching endogenous Jun or Fos proteins (del. 3-102; and del. 3-122). Id. c-Jun mutations in the TAD, DNA-binding domain (DBD), or leucine zipper domain are all unable to activate transcription, but only TAD and DBD mutants function in a dominant-negative fashion by inhibiting both c-Jun-induced transcriptional activation and transformation. Id. TAM-67 is a c-JUN dominant negative mutant with a deletion of amino acids 3-122 (see, e.g., Matthews C P, Birkholz A M, Baker A R, et al. Dominant-negative activator protein 1 (TAM67) targets cyclooxygenase-2 and osteopontin under conditions in which it specifically inhibits tumorigenesis. Cancer Res. 2007; 67(6):2430-2438).

    [0099] In certain embodiments, a dominant negative JUNB is administered to a subject. In certain embodiments, the TAD of JUNB is removed or mutated to abolish activity. In certain embodiments, the DBD of JUNB is removed or mutated to abolish activity. In certain embodiments, the dominant negative JUNB is administered directly to a tumor. In certain embodiments, a vector having tropism for tumor cells is administered.

    [0100] In one example embodiment, a subject in need thereof is treated by expression of a dominant negative JUNB using a gene therapy approach as described herein (see, MCL1). In one example embodiment, a vector for use in gene therapy comprises a sequence encoding dominant negative JUNB and is used to deliver said sequence to tumor cells. Vector based embodiments to deliver polynucleotides to delivery dominant negative JUNB may be used as described above at [0078]-[0084].

    Recombinant Dominant Negative JUNB

    [0101] In certain embodiments, recombinant dominant negative JUNB protein is delivered intracellularly to a subject in need thereof and is used as a protein therapeutic. Protein therapeutics offer high specificity, and the ability to treat undruggable targets, in diseases associated with protein deficiencies or mutations.

    [0102] In certain embodiments, virus like particles (VLPs) are used to facilitate intracellular recombinant protein therapy (see, e.g., WO2020252455A1, U.S. Ser. No. 10/577,397B2). In certain embodiments, VLPs include a Gag-dominant negative JUNB fusion protein. The Gag-dominant negative JUNB fusion protein may include a matrix protein, a capsid protein, and/or a nucleocapsid protein covalently linked to JUNB. In certain embodiments, the VLPs include a membrane comprising a phospholipid bilayer with one or more human endogenous retrovirus (HERV) derived ENV/glycoprotein(s) on the external side; a HERV-derived GAG protein in the VLP core, and a JUNB fusion protein on the inside of the membrane, wherein JUNB is fused to a human-endogenous GAG or other plasma membrane recruitment domain (see, e.g., WO2020252455A1). Fusion proteins can be obtained using standard recombinant protein technology.

    [0103] In certain embodiments, cell-penetrating peptides (CPPs) are used to facilitate intracellular recombinant protein therapy (see, e.g., Dinca A, Chien W-M, Chin M T. Intracellular Delivery of Proteins with Cell-Penetrating Peptides for Therapeutic Uses in Human Disease. International Journal of Molecular Sciences. 2016; 17(2):263). In certain embodiments, cell-penetrating peptides can be conjugated to JUNB, for example, using standard recombinant protein technology. In certain embodiments, cell-penetrating peptides can be concurrently delivered with recombinant JUNB.

    [0104] In certain embodiments, nanocarriers are used to facilitate intracellular recombinant protein therapy (see, e.g., Lee Y W, Luther D C, Kretzmann J A, Burden A, Jeon T, Zhai S, Rotello V M. Protein Delivery into the Cell Cytosol using Non-Viral Nanocarriers. Theranostics 2019; 9(11):3280-3292). Non-limiting nanocarriers include, but are not limited to nanoparticles (e.g., silica, gold), polymers, lipid based (e.g., cationic lipid within a polymer shell, lipid-like nanoparticles).

    Method of Inhibiting B3GNT2, MCL1, BCLA21, and JunB Expression By RNAi

    [0105] In one example embodiment, a method of enhancing anti-tumor activity comprises administering a RNAi therapeutic to reduce expression of one or more of B3GNT2, MCL1, BCLA21, and JUNB (collectively target sequences). A RNAi therapeutic comprises a polynucleotide that is complementary to a portion of the target sequence mRNA, generally ranging in size from 15 to 50 base pairs. RNAi modalities may include miRNA and siRNA. The RNAi modality may also be in the form a pre-miRNA which is processed by Dicer to form a miRNA. Likewise, the RNAi modality may be in the form of a dsRNA or shRNA which is processed by Dicer to form a siRNA. RNAi modalities may also be derived from endogenous microRNA. The RNAi polynucleotide may comprise one or more modifications to suppress innate immune activation, enhance activity and specificity, and reduce off-target induced toxicity. The RNAi therapeutic may further comprise a delivery platform for delivery of the RNAi polynucleotide.

    [0106] The RNAi modalities used herein may be used to achieve gene silencing of B3GNT2 expression. As used herein, gene silencing or gene silenced in reference to an activity of an RNAi molecule, for example a siRNA or miRNA refers to a decrease in the mRNA level in a cell for a target gene by at least about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 99%, about 100% of the mRNA level found in the cell without the presence of the miRNA or RNA interference molecule. In one preferred embodiment, the mRNA levels are decreased by at least about 70%, about 80%, about 90%, about 95%, about 99%, about 100%.

    Example Polynucleotide Sequences

    [0107] The following sections provide example target sequences to which RNAi polynucleotides may be designed to hybridize to and induce RNAi mediated knockdown of target gene expression.

    B3GNT2 Sequences

    [0108] B3GNT2, also known as 3-Gn-T1, 3-Gn-T2, B3Gn-T2, B3GNT, B2GNT-2, B3GNT1 BETA3GNT, BGNT2, BGnT-2, beta-1 beta-3Gn-T1, and beta3Gn-T2 is located on human chromosome 2, locus 2P15, accession No. NC_000002.12 from position 62196115 to 62/224,731. In one example embodiment, the polynucleotide sequence included in the vector is a DNA sequence with the primary accession numbers AC018462, AC093401 and CH471053. In another example embodiment, the DNA sequence is selected from the group consisting of AC018462, AC093401 and CH471053.

    [0109] In another example embodiment, the polynucleotide sequence included in the vector is a RNA sequence derived from NM_006577.6 and NM_001319075.2. In another example embodiment, the polynucleotide sequence included in the vector is a RNA sequence selected from the group consisting of NM_006577.6 and NM_001319075.2. In another example embodiment, the sequence included in the vector is derived from mRNA selected from the group consisting of AB049584.1, AF09205.12, AF288208.1, AF288209.1, AJ006077.1, AK002009.1, BC030579.2 and BC047933.1. In another example embodiment, the sequence included in the vector is a mRNA sequence selected from the group consisting of AB049584.1, AF09205.12, AF288208.1, AF288209.1, AJ006077.1, AK002009.1, BC030579.2 and BC047933.1. In another example embodiment, the amino acid sequence is derived from the primary accession number Q9NY97, NP_006568.2, and NP_001306004.1. In another example embodiment, the amino acid sequence is selected from the group consisting of Q9NY97, NP_006568.2 and NP_001306004.1. In another example embodiment, the amino acid sequence is derived from the secondary accession numbers Q54AC1, Q9NQQ9, Q9NQR0 and Q9NUT9. In another example embodiment, the amino acid sequence is selected from the group consisting of Q54AC1, Q9NQQ9, Q9NQR0 and Q9NUT9.

    MCL1 Sequences

    [0110] MCL1, also known as TM; EAT; MCL1L; MCL1S; Mcl-1; BCL2L3; MCL1-ES; bcl2-L-3; mcl1/EAT is located on human chromosome 1, locus 1Q21.2, accession no. NC_000001.11 from position, complement 150547034 to 150552086. In one example embodiment, the polynucleotide sequence included in the vector is a DNA sequence with the primary accession numbers AF147742.1, AF198614.1, AH009713.2, AL356356.17, CH471121.2 and NG_029146. In another example embodiment, the DNA sequence is selected from the group consisting of AF147742.1, AF198614.1, AH009713.2, AL356356.17, CH471121.2 and NG_029146.

    [0111] In another example embodiment, the polynucleotide sequence included in the vector is a RNA sequence derived from NM_021960.5, NM_182763.3 and NM_001197320.2. In another example embodiment, the polynucleotide sequence included in the vector is a RNA sequence selected from the group consisting of NM_021960.5, NM_182763.3 and NM 001197320.2. In another example embodiment, the sequence included in the vector is derived from mRNA selected from the group consisting of AA453505.1, AF118124.1, AF118276.1, AF118277.1, AF118278.1, AK294462.1, AK297217.2, AK300499.1, AK304775.1, AK312508.1, AK316267.1, BC017197.2, BC071897.1, BC107735.1, BT006640.1, CA421486.1, FJ917536.1 and L08246.1. In another example embodiment, the sequence included in the vector is a mRNA sequence selected from the group consisting of AA453505.1, AF118124.1, AF118276.1, AF118277.1, AF118278.1, AK294462.1, AK297217.2, AK300499.1, AK304775.1, AK312508.1, AK316267.1, BC017197.2, BC071897.1, BC107735.1, BT006640.1, CA421486.1, FJ917536.1 and L08246.1. In another example embodiment, the amino acid sequence is derived from the primary accession number Q07820, NP_068779.1, NP_877495.1 and NP_001184249.1. In another example embodiment, the amino acid sequence is selected from the group consisting of Q07820, NP_068779.1, NP_877495.1 and NP_001184249.1. In another example embodiment, the amino acid sequence is derived from the secondary accession numbers B2R6B2, D3DV03, D3DV04, Q9HD91, Q9NRQ3, Q9NRQ4, Q9UHR7, Q9UHR8, Q9UHR9 and Q9UNJ1. In another example embodiment, the amino acid sequence is selected from the group consisting of B2R6B2, D3DV03, D3DV04, Q9HD91, Q9NRQ3, Q9NRQ4, Q9UHR7, Q9UHR8, Q9UHR9 and Q9UNJ1.

    BCLA21 Sequences

    [0112] BCL2A1, also known as ACC-1, ACC-2, ACC1, ACC2, BCL2L5, BFL1, GRS, HBPA1 is located on human chromosome 15, locus 15Q25.1, accession no. NC_000015.10 from position, complement 79960892 to 79971196. In one example embodiment, the polynucleotide sequence included in the vector is a DNA sequence with the primary accession numbers AC015871.7, AF479683.1, CH471136.2, DQ081729.1, HI574046.1 and NG_029487. In another example embodiment, the DNA sequence is selected from the group consisting of AC015871.7, AF479683.1, CH471136.2, DQ081729.1, HI574046.1 and NG_029487.

    [0113] In another example embodiment, the polynucleotide sequence included in the vector is a RNA sequence derived from NM_004049.4, and NM_001114735.2. In another example embodiment, the polynucleotide sequence included in the vector is a RNA sequence selected from the group consisting of NM_004049.4, and NM_001114735.2. In another example embodiment, the sequence included in the vector is derived from mRNA selected from the group consisting of AL110097.1, AY234180.1, BC016281.1, BG198875.1, BG204033.1, BG216703.1, BT007103.1, CD640106.1, CR541937.1, CR541962.1, U27467.1, U29680.1 and Y09397.1. In another example embodiment, the sequence included in the vector is a mRNA sequence selected from the group consisting of AL110097.1, AY234180.1, BC016281.1, BG198875.1, BG204033.1, BG216703.1, BT007103.1, CD640106.1, CR541937.1, CR541962.1, U27467.1, U29680.1 and Y09397.1. In another example embodiment, the amino acid sequence is derived from the primary accession number Q16548, NP_068779.1, NP_877495.1 and NP_001184249.1. In another example embodiment, the amino acid sequence is selected from the group consisting of Q16548, NP_068779.1, NP 877495.1 and NP_001184249.1. In another example embodiment, the amino acid sequence is derived from the secondary accession numbers Q6FGZ4, Q6FH19, Q86W13 and Q99524. In another example embodiment, the amino acid sequence is selected from the group consisting of Q6FGZ4, Q6FH19, Q86W13 and Q99524.

    JUNB Sequences

    [0114] JUNB, also known as AP-1 is located on human chromosome 19, locus 19P13.13, accession no. NC_000019.10 from position 12791486 to 12793315. In one example embodiment, the polynucleotide sequence included in the vector is a DNA sequence with the primary accession numbers AC01861.6, AY751746.1, CH471106.1, KT584920.1, M29039.1 and U20734. In another example embodiment, the DNA sequence is selected from the group consisting of AC01861.6, AY751746.1, CH471106.1, KT584920.1, M29039.1 and U20734.

    [0115] In another example embodiment, the polynucleotide sequence included in the vector is a RNA sequence derived from NM_002229.3. In another example embodiment, the polynucleotide sequence included in the vector is a RNA sequence selected from the group consisting of NM_002229.3. In another example embodiment, the sequence included in the vector is derived from mRNA selected from the group consisting of AK222532.1, AK313737.1, BC004250.1, BC009465.1, BC009466.1, BC1130372.1, BT019760.1, DQ650707.1 and X51345.1. In another example embodiment, the sequence included in the vector is a mRNA sequence selected from the group consisting of AK222532.1, AK313737.1, BC004250.1, BC009465.1, BC009466.1, BC1130372.1, BT019760.1, DQ650707.1 and X51345.1. In another example embodiment, the amino acid sequence is derived from the primary accession number P17275 and NP_002220.1. In another example embodiment, the amino acid sequence is selected from the group consisting of P17275 and NP_002220.1. In another example embodiment, the amino acid sequence is derived from the secondary accession numbers Q96GH3. In another example embodiment, the amino acid sequence is selected from the group consisting of Q96GH3.

    [0116] All gene name symbols as used throughout the specification refer to the gene as commonly known in the art. The examples described herein that refer to gene names are to be understood to encompass human genes, as well as genes in any other organism (e.g., homologous, orthologous genes). The term, homolog, may apply to the relationship between genes separated by the event of speciation (e.g., ortholog). Orthologs are genes in different species that evolved from a common ancestral gene by speciation. Normally, orthologs retain the same function in the course of evolution. Gene symbols may be those referred to by the HUGO Gene Nomenclature Committee (HGNC) or National Center for Biotechnology Information (NCBI). Any reference to the gene symbol is a reference made to the entire gene or variants of the gene. Reference to a gene encompasses the gene product (e.g., protein encoded for by the gene).

    Example siRNA Embodiments

    [0117] In one example embodiment, the RNAi modality is a siRNA. As used herein, a siRNA refers to a nucleic acid that forms a double stranded RNA, which double stranded RNA has the ability to reduce or inhibit expression of a gene or target gene when the siRNA is present or expressed in the same cell as the target gene. The double stranded RNA siRNA can be formed by the complementary strands. In one embodiment, a siRNA refers to a nucleic acid that can form a double stranded siRNA. The sequence of the siRNA can correspond to the full-length target gene, or a subsequence thereof. Typically, the siRNA is at least about 15-50 nucleotides in length (e.g., each complementary sequence of the double stranded siRNA is about 15-50 nucleotides in length, and the double stranded siRNA is about 15-50 base pairs in length, preferably about 19-30 base nucleotides, preferably about 20-25 nucleotides in length, e.g., 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length).

    Example shRNA Embodiments

    [0118] In one example embodiment, the RNAi modality is a shRNA. As used herein shRNA or small hairpin RNA (also called stem loop) is a type of siRNA. In one embodiment, these shRNAs are composed of a short, e.g. about 19 to about 25 nucleotide, antisense strand, followed by a nucleotide loop of about 5 to about 9 nucleotides, and the analogous sense strand. Alternatively, the sense strand can precede the nucleotide loop structure and the antisense strand can follow.

    Example microRNA Embodiments

    [0119] In one example embodiment, the RNAi modality is engineered microRNA derived from an endogenous. The terms microRNA or miRNA, used interchangeably herein, are endogenous RNAs, some of which are known to regulate the expression of protein-coding genes at the posttranscriptional level. Endogenous microRNAs are small RNAs naturally present in the genome that are capable of modulating the productive utilization of mRNA. The term artificial microRNA includes any type of RNA sequence, other than endogenous microRNA, which is capable of modulating the productive utilization of mRNA. MicroRNA sequences have been described in publications such as Lim, et al., Genes & Development, 17, p. 991-1008 (2003), Lim et al Science 299, 1540 (2003), Lee and Ambros Science, 294, 862 (2001), Lau et al., Science 294, 858-861 (2001), Lagos-Quintana et al, Current Biology, 12, 735-739 (2002), Lagos Quintana et al, Science 294, 853-857 (2001), and Lagos-Quintana et al, RNA, 9, 175-179 (2003), which are incorporated by reference. Multiple microRNAs can also be incorporated into a precursor molecule. Furthermore, miRNA-like stem-loops can be expressed in cells as a vehicle to deliver artificial miRNAs and short interfering RNAs (siRNAs) for the purpose of modulating the expression of endogenous genes through the miRNA and or RNAi pathways.

    Example dsRNA Embodiments

    [0120] In one example embodiment, the RNAi modality is a dsRNA. As used herein, double stranded RNA or dsRNA refers to RNA molecules that are comprised of two strands. Double-stranded molecules include those comprised of a single RNA molecule that doubles back on itself to form a two-stranded structure. For example, the stem loop structure of the progenitor molecules from which the single-stranded miRNA is derived, called the pre-miRNA (Bartel et al. 2004. Cell 1 16:281-297), comprises a dsRNA molecule.

    Example RNAi configurations

    [0121] In an embodiment, a single-stranded RNAi molecule disclosed herein has a single-stranded oligonucleotide structure and mediates RNA interference against a target RNA (e.g., B3GNT2). A single-stranded B3GNT2 RNAi agent comprises: (a) a nucleic acid portion comprising a first nucleotide portion (N1) and a second nucleotide portion (N2), wherein said nucleic acid portion comprises at least 8 nucleotides that can base pair with a target RNA, and wherein the total number of nucleotides within the nucleic acid portion is from 8 to 26 nucleotides; and, (b) an internal spacer portion comprising at least a first non-nucleotide spacer portion (S1) that covalently links the first and second nucleotide portions. The first and second nucleotide portions are not self-complementary. The total number of nucleotides of a single-stranded B3GNT2 RNAi agent disclosed herein (e.g., 8 to 26) is distributed between the nucleotide portions of the RNAi molecule, wherein each nucleotide portion contains at least one nucleotide.

    [0122] In one embodiment, the nucleic acid portion of a single-stranded B3GNT2 RNAi agent disclosed herein contains two nucleotide portions, referred to as the first nucleotide portion (N1) and the second nucleotide portion (N2). The first and second nucleotide portions of a B3GNT2 RNAi agent disclosed herein are covalently attached to a non-nucleotide spacer portion of the molecule. In another embodiment, the nucleic acid portion of the B3GNT2 single-stranded RNAi agent disclosed herein contains more than one nucleotide portion (e.g., 3, 4, or 5, referred to as third (N3), fourth (N4) or fifth (N5) nucleotide portions, respectively).

    [0123] In one embodiment, the internal spacer portion of a single-stranded B3GNT2 RNAi agent disclosed herein contains only one non-nucleotide spacer portion, referred to as the first non-nucleotide spacer portion (S1). The first non-nucleotide spacer portion (S1) of a B3GNT2 RNAi agent disclosed herein is covalently attached to two nucleotides and/or non-nucleotide substitutes, each located within a distinct nucleotide portion of the single-stranded molecule. In another embodiment, the internal spacer portion of a single-stranded B3GNT2 RNAi agent disclosed herein contains more than one non-nucleotide spacer portion (e.g., 2, 3, or 4, referred to as second (S2), third (S3) or fourth (S4) non-nucleotide spacer portions, respectively).

    [0124] A single-stranded B3GNT2 RNAi agent disclosed herein can comprise substitutions, chemically modified nucleotides, and non-nucleotides, including substitutions or modifications in the backbone, sugars, bases, or nucleosides. In certain embodiments, the use of substituted or modified single-stranded B3GNT2 RNAi agents can enable achievement of a given therapeutic effect at a lower dose since these molecules may be designed to have an increased half-life in a subject or biological samples (e.g., blood). Furthermore, certain substitutions or modifications can be used to improve the bioavailability of single-stranded B3GNT2 RNAi agents by targeting particular cells or tissues or improving cellular uptake of the single-stranded B3GNT2 RNAi agents.

    [0125] In an embodiment, the internal spacer portion of a single-stranded B3GNT2 RNAi agent can comprise one or more non-nucleotide spacer portions. A non-nucleotide spacer portion can include any aliphatic or aromatic chemical group that can be further substituted, wherein said spacer portion does not contain a nucleotide. The spacer portion can be substituted with a chemical moiety that provides additional functionality to a single-stranded B3GNT2 RNAi agent. For example, a non-nucleotide spacer portion can be substituted with a moiety that binds specifically to a target molecule of interest or facilitates/enhances cellular delivery of the molecule. In one embodiment, a non-nucleotide spacer portion includes an alkyl, alkenyl or alkynyl chain of preferably 1 to 20 carbons that can be optionally substituted.

    [0126] The single-stranded B3GNT2 RNAi molecules disclosed herein are useful agents, which can be used in methods for a variety of therapeutic, diagnostic, genetic engineering, and pharmacological applications. Thus, embodiments of the present disclosure further include methods comprising using a single-stranded B3GNT2 RNAi agent and methods for inhibiting B3GNT2 expression of one or more corresponding target mRNAs to enhance anti-tumor immunity in a cell or organism. Further, this disclosure provides methods and B3GNT2 RNAi agents for treating a subject, by enhancing anti-tumor immunity in a subject in need thereof, including a human cell, tissue, individual or subject.

    Modifications

    [0127] The RNAi modalities described above may comprise one or more modifications including, but not limited to, base modification, ribose modifications, and phosphate modifications. Example base modifications may include 2-O-methyl, 20-methoxyethyl, 2-arabinoo-fluoro, 2-O-benzyl, 2-O-methyl-4-pyridine, locked nucleic acid (LNA), (S)-cEt-BNA, tricyclo-DNA, PMO, unlocked nucleic acid, and glycol nucleic acid. Phosphate modifications include phophoorothioate (PS, Rp isomer, and PS, Sp isomer), phosphorodithioate, methylphosphonate, methoxypropyl-phosphonate, 5-(E)-vinylphophonate, 5-Methyl Phosphonate, (S)-5-C-methyl with phosphate, 5-phosphorothioate, and peptide nucleic acid. Base modifications may include pseudouridine, 2-thiouridine, N6-methyladenosine, 5-methylcytidine, 5-fluoro-2-deoxyuridine, N-ethylpiperidine 7-EAA triazole modified adenine, N-ethylpiperidine 6-triazole modified adenine, 6-phenylpyrrolo-cytosinie, 2,4-difluorotoluly ribonucleoside, and 5-nitroindole. A summary of modifications and example locations within a RNAi polynucleotide for each modification are describe in Hu et al. Therapeutic siRNA: state of the art Signal Transduction and Targeted Therapy 5, Article number 100 (2020), particularly FIGS. 2 and 3, which are incorporated herein by reference.

    Delivery Platforms

    [0128] While the RNAi polynucleotides described above may be delivered as naked RNA (with or without modification) in certain example embodiments, the RNAi therapeutic may further comprise a delivery platform. Example delivery planforms include, but are not limited to liposomes, conjugates, peptides, exosomes, polymers, dendrimers, and inorganic nanoparticles. Example liposomes include Dlin-DMA, Dlin-MC3-DMA, and EnCore.

    [0129] Example conjugates include GalNAc, cholesterol, and RGD. Example polymers include cyclodextrin, PBAVE, PEI, and PLGA. Example peptides include DPC2.0 (MLP), and PNP. Example delivery platforms are described in Hu et al. Therapeutic siRNA: state of the art Signal Transduction and Targeted Therapy 5, Article number 100 (2020), particularly pages 11-20 and FIG. 6, which are incorporated herein by reference.

    [0130] In general, and throughout this specification, the term vector refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. Vectors include, but are not limited to, nucleic acid molecules that are single-stranded, double-stranded, or partially double-stranded; nucleic acid molecules that comprise one or more free ends, no free ends (e.g., circular); nucleic acid molecules that comprise DNA, RNA, or both; and other varieties of polynucleotides known in the art. There are no limitations regarding the type of vector that can be used. The vector can be a cloning vector, suitable for propagation and for obtaining polynucleotides, gene constructs or expression vectors incorporated to several heterologous organisms. Suitable vectors include eukaryotic expression vectors based on viral vectors (e.g. adenoviruses, adeno-associated viruses as well as retroviruses and lentiviruses), as well as non-viral vectors such as plasmids. Exemplary therapeutic delivery vectors of RNAi including viruses are described in Nguyen et al. RNAi therapeutics: An update on delivery (2008). Current Opinion in Molecular Therapeutics 10(2): 158-167. Exemplary RNAi delivery vectors from a variety of viruses including, but not limited to, adenovirus (Ad), adeno-associated virus (AAV), retroviruses, et al. are described in Lundstrom, K. Viral Vectors Applied for RNAi-Based Antiviral Therapy Viruses (2020) 12, 924 doi: 10:3390/v12092924 (14 pages), particularly on pages 3 and 4, which are herein incorporated by reference. Exemplary viral vectors using alphaviruses, flaviviruses, measles viruses and rhabdoviruses are described in Lundstrom, K. Self-Amplifying RNA Viruses as RNA Vaccines 21, 5130 (2020); doi:10.3390/ijms21145130 (29 pages), particularly the viral vectors listed on page 6, which are herein incorporated by reference.

    [0131] In one example embodiment, the vector is a viral vector, wherein virally-derived DNA or RNA sequences are present in the vector for packaging into a virus (e.g., retroviruses, replication defective retroviruses, adenoviruses, replication defective adenoviruses, and adeno-associated viruses). Viral vectors also include polynucleotides carried by a virus for transfection into a host cell. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome.

    [0132] In one example embodiment, the vector is a plasmid, which refers to a circular double stranded DNA loop into which additional DNA segments can be inserted, such as by standard molecular cloning techniques.

    [0133] In one example embodiment, RNAi molecules are delivered via liposomes. The RNAi molecules may be modified.

    Use of Gene Editing Systems to Reduce B3GNT2, MCL1, BCLA21, and/or JunB Expression or Activity in Tumor Cells

    [0134] In one example embodiment, a gene editing system is used to reduce the expression or activity of one or more of B3GNT2, MCL1, BCLA21 and JUNB (collectively target sequences) in tumor cells. In one example embodiment, a programmable nuclease is used to make one or more insertions or deletions in one or more that target sequences that results in reduced expression of the one or more target sequences. In another example embodiment, a programmable nuclease, in combination with a donor template, is used to replace a portion one or more target genes with either a non-functional variant of the target gene or a modified target gene that results in expression of a gene produce of reduced activity. In one example embodiment, a catalytically inactive programmable nuclease is used to recruit a functional domain (e.g., repressor domain) to the target gene to reduce expression. In one example embodiment, the gene editing system is a base editing system. In one example embodiment, the base editing system is a DNA base editing system used to make one or more base or base pair edits to one or more target genes that reduce target gene expression. In one example embodiment, the base editing system is a RNA base editing system used to modify mRNA expressed from the one or more genes to reduce protein function, for example, by modifying one or more post-translation modification sites encoded by the mRNA In another example embodiment, the gene editing system is a prime editing system. A prime editing system may be used to edit DNA like a base editing system. A prime editing system may also be used to replace all or a portion of the target genes to produce a non-functional variant or expression of a gene product with reduced activity.

    Programmable Nucleases

    [0135] In certain example embodiments, a programmable nuclease may be used to edit a genomic region comprising one or more genomic variants associated with decreased expression or activity of B3GNT2. Gene editing using programmable nucleases may utilize two different cell repair pathways, non-homologous end joining (NHEJ) and homology-directed repair (HDR). In certain example embodiment, HDR is used to provide a template that replaces a genomic region comprising the variant with a donor that edits the risk variant to a wild-type or non-risk variant. Example programmable nucleases for use in this manner include zinc finger nucleases (ZFN), TALE nucleases (TALENS), meganucleases, and CRISPR-Cas systems.

    CRISPR-Cas

    [0136] In one example embodiment, the gene editing system is a CRISPR-Cas system. The CRISPR-Cas system comprises a Cas polypeptide and a guide sequence, wherein the guide sequence is capable of forming a CRISPR-Cas complex with the Cas polypeptide and directing site-specific binding of the CRISPR-Cas sequence to a target sequence. The Cas polypeptide may induce a double- or single-stranded break at a designated site in the target sequence. The site of CRISPR-Cas cleavage, for most CRISPR-Cas systems, is dictated by distance from a protospacer-adjacent motif (PAM), discussed in further detail below. Accordingly, a guide sequence may be selected to direct the CRISPR-Cas system to induce cleavage at a desired target site at or near the one or more variants.

    NHEJ-Based Editing

    B3GNT2

    [0137] In one example embodiment, the CRISPR-Cas system is used to introduce one or more insertions or deletions that reduces or inhibits B3GNT2 expression or activity. More than one guide sequence may be selected to insert multiple insertions, deletions, or combinations thereof. Likewise, more than one Cas protein type may be used, for example, to maximize targets sites adjacent to different PAMs. In one example embodiment, a guide sequence is selected that directs the CRISPR-Cas system to make one or more insertions or deletions in wild type B3GNT2 that reduces B3GNT2 expression. The wild type human B3GNT2 gene, Locus and Accession number NM_006577, is 2761 bp encoding a protein of 397 amino acids. The B3GNT2 gene contains two exons from nt 1-241 and from nt 242 to 2761. The B3GNT2 ORF contains the feature of having an in-frame stop codon at nt 245 to nt 247. The B3GNT2 amino acid sequence contains a transmembrane region from AA 272 to 334, glycosylation sites at AA 485 to 487, 515 to 517, 629 to 631, 767 to 769, 905 to 907, a polyA signal sequence (AATAAA) at AA 2740 to 2745 and a major polyA site at AA 2761. In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more deletions that affects one or more splicing sites in the B3GNT2 gene causing a decrease in the expression of the B3GNT2 ORF. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make a deletion in the B3GNT2 gene such that a frame-shift is introduced into the ORF causing a decrease in expression of the full-length B3GNT2 transcript. In one example embodiment, a guide sequence is selected that directs the CRISPR-Cas system to make an insertion that affects one or more splicing sites in the B3GNT2 gene, which causes a decrease in the expression of the B3GNT2 gene. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make an insertion in the B3GNT2 gene such that a frame-shift is introduced into the ORF causing a decrease in expression of the full-length B3GNT2 transcript.

    [0138] In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make a deletion that affects the transmembrane region of the B3GNT2 protein, which causes instability and a decrease in the activity of the B3GNT2 protein. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make a deletion in the B3GNT2 ORF such that a frame-shift is introduced into the ORF introducing a stop codon which leads to a decrease in activity of the truncated B3GNT2 protein. In an example embodiment, a guide is selected that directs the CRISPR-Cas system to make a substitution at amino acid position 245 (D, aspartic acid) which abolishes catalytic activity. In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make a deletion or insertion of the B3GNT2 gene, which leads to disruption of the polyA signal sequence region of the protein, causing a decrease in activity of the B3GNT2 protein.

    MCL1

    [0139] In one example embodiment, the CRISPR-Cas system is used to introduce one or more insertions or deletions that reduces or inhibits MCL1 expression or activity. More than one guide sequence may be selected to insert multiple insertions, deletions, or combinations thereof. Likewise, more than one Cas protein type may be used, for example, to maximize targets sites adjacent to different PAMs. In one example embodiment, a guide sequence is selected that directs the CRISPR-Cas system to make one or more insertions or deletions in wild type MCL1 that reduces MCL1 expression. The wild type human MCL1 gene, Locus and Accession number NM_021960, is 3950 bp encoding a protein of 350 amino acids. The MCL1 ORF contains three exons from nt 1-768, from nt 769 to 1016 and from nt 1017 to 3950. The MCL1 gene contains the feature of having a transcription initiation site at nt 1. The MCL1 amino acid sequence contains functional domains for multiple phosphorylation sites, a PEST-like site, two cleavage sites, a BH3-binding site, a BH2-binding site, a BH1-binding region, a transmembrane region, a polyA signal sequence and a major polyA site. In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more deletions that affects one or more splicing sites in the MCL1 gene causing a decrease in the expression of the MCL1 gene. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make a deletion in the MCL1 gene such that a frame-shift is introduced into the ORF causing a decrease in expression of the full-length MCL1 transcript. In one example embodiment, a guide sequence is selected that directs the CRISPR-Cas system to make one or more insertions that affects one or more splicing sites in the MCL1 gene, which causes a decrease in the expression of the MCL1 gene. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more insertions in the MCL1 gene such that a frame-shift is introduced into the ORF causing a decrease in expression of the full-length MCL1 transcript.

    [0140] In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more deletions that affects or disrupts one or more phosphorylation sites, one or more cleavage sites, the BH1-, BH2-, BH3-binding sites or the transmembrane region of the MCL1 protein, or any combination thereof, all of which cause protein instability and a decrease in the activity of the MCL1 protein. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make a deletion in the MCL1 ORF such that a frame-shift is introduced into the ORF introducing a stop codon which leads to a decrease in activity of the truncated MCL1 protein. In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more deletions or insertions of the MCL1 gene, which leads to disruption of the polyA signal sequence region of the MCL1 protein, causing a decrease in activity of the MCL1 protein.

    BCL2A1

    [0141] In one example embodiment, the CRISPR-Cas system is used to introduce one or more insertions or deletions that reduces or inhibits BCL2A1 expression or activity. More than one guide sequence may be selected to insert multiple insertions, deletions, or combinations thereof. Likewise, more than one Cas protein type may be used, for example, to maximize targets sites adjacent to different PAMs. In one example embodiment, a guide sequence is selected that directs the CRISPR-Cas system to make one or more insertions or deletions in wild type BCL2A1 that reduces BCL2A1 expression. The wild type human BCL2A1 gene, Locus and Accession number NM_004049 is 780 bp encoding a protein of 175 amino acids. The BCL2A1 ORF contains two exons from nt 1-497 and from nt 498 to 780. The BCL2A1 ORF contains the feature of having an in-frame stop codon at nt 3 to nt 5. The BCL2A1 amino acid sequence contains a BH2-binding site, a BH1-binding site, a polyA signal sequence and a major polyA site. In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more deletions that affects one or more splicing sites in the BCL2A1 gene causing a decrease in the expression of the BCL2A1 gene. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make a deletion in the BCL2A1 gene such that a frame-shift is introduced into the ORF causing a decrease in expression of the full-length BCL2A1 transcript. In one example embodiment, a guide sequence is selected that directs the CRISPR-Cas system to make one or more insertions that affects one or more splicing sites in the BCL2A1 gene, which causes a decrease in the expression of the BCL2A1 gene. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more insertions in the BCL2A1 gene such that a frame-shift is introduced into the ORF causing a decrease in expression of the full-length BCL2A1 transcript.

    [0142] In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more deletions that affects the transmembrane region of the BCL2A1 protein, which causes instability and a decrease in the activity of the BCL2A1 protein. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make a deletion in the BCL2A1 ORF such that a frame-shift is introduced into the ORF introducing a stop codon which leads to a decrease in activity of the BCL2A1 protein. In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more deletions or insertions of the BCL2A1 gene which leads to disruption of the polyA signal sequence region of the BCL2A1 protein, causing a decrease in activity of the BCL2A1 protein.

    JUNB

    [0143] In one example embodiment, the CRISPR-Cas system is used to introduce one or more insertions or deletions that reduces or inhibits JUNB expression or activity. More than one guide sequence may be selected to insert multiple insertions, deletions, or combinations thereof. Likewise, more than one Cas protein type may be used, for example, to maximize targets sites adjacent to different PAMs. In one example embodiment, a guide sequence is selected that directs the CRISPR-Cas system to make one or more insertions or deletions in wild type JUNB that reduces JUNB expression. The wild type human JUNB gene, Locus and Accession number NM_002229 is 1830 bp encoding a protein of 347 amino acids. The JUNB gene contains one exon from nt 1-1830. The JUNB gene contains the feature of having an in-frame stop codon at nt 8 to nt 10. The JUNB amino acid sequence contains multiple phosphorylation sites, an acetylation site, a leucine zipper region a polyA signal sequence and a major polyA site. In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more deletions that affects the splicing site in the JUNB gene causing a decrease in the expression of the JUNB gene. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make a deletion in the JUNB gene such that a frame-shift is introduced into the ORF causing a decrease in expression of the full-length JUNB transcript. In one example embodiment, a guide sequence is selected that directs the CRISPR-Cas system to make one or more insertions that affects the splicing site in the JUNB gene, which causes a decrease in the expression of the JUNB gene. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more insertions in the JUNB gene such that a frame-shift is introduced into the ORF causing a decrease in expression of the full-length JUNB transcript.

    [0144] In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more deletions that affects or disrupts one or more phosphorylation sites and/or the acetylation site, or combinations thereof, which cause protein instability and a decrease in the activity of the JUNB protein. In an embodiment, a guide is selected that directs the CRISPR-Cas system to make a deletion in the JUNB gene such that a frame-shift is introduced into the ORF introducing a stop codon which leads to a decrease in activity of the truncated JUNB protein. In one example embodiment, a guide is selected that directs the CRISPR-Cas system to make one or more deletions or insertions of the JUNB gene which leads to disruption of the polyA signal sequence region of the JUNB protein, causing a decrease in activity of the JUNB protein.

    HDR Template Based Editing

    [0145] In one example embodiment, a donor template is provided to replace a genomic sequence comprising one or more variants that reduce B3GNT2 expression. A donor template may comprise an insertion sequence flanked by two homology regions. The insertion sequence comprises an edited sequence to be inserted in place of the target sequence (e.g. a portion of genomic DNA comprising the one or more variants). The homology regions comprise sequences that are homologous to the genomic DNA strands at the site of the CRISPR-Cas induced double-strand break. Cellular HDR mechanisms then facilitate insertion of the insertion sequence at the site of the DSB. Accordingly, in certain example embodiments, a donor template and guide sequence are selected to direct excision and replacement of a section of genome DNA comprising a variant that reduces B3GNT2 expression with an insertion sequence that edits the one or more variants to a wild-type or non-risk variant. In one example embodiment, the insertion sequence comprises a wild-type or non-risk variant that reduces B3GNT2 expression. In one example embodiment, the insertion sequence encodes a portion of genomic DNA in which the variant is changed from a C to a T.

    [0146] The donor template may include a sequence which results in a change in sequence of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more nucleotides of the target sequence.

    [0147] A donor template may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length. In an embodiment, the template nucleic acid may be 20+/?10, 30+/?10, 40+/?10, 50+/?10, 60+/?10, 70+/?10, 80+/?10, 90+/?10, 100+/?10, 1 10+/?10, 120+/?10, 130+/?10, 140+/?10, 150+/?10, 160+/?10, 170+/?10, 1 80+/?10, 190+/?10, 200+/?10, 210+/?10, of 220+/?10 nucleotides in length. In an embodiment, the template nucleic acid may be 30+/?20, 40+/?20, 50+/?20, 60+/?20, 70+/?20, 80+/?20, 90+/?20, 100+/?20, 1 10+/?20, 120+/?20, 130+/?20, 140+/?20, I 50+/?20, 160+/?20, 170+/?20, 180+/?20, 190+/?20, 200+/?20, 210+/?20, of 220+/?20 nucleotides in length. In an embodiment, the template nucleic acid is 10 to 1,000, 20 to 900, 30 to 800, 40 to 700, 50 to 600, 50 to 500, 50 to 400, 50 to300, 50 to 200, or 50 to 100 nucleotides in length.

    [0148] The homology regions of the donor template may be complementary to a portion of a polynucleotide comprising the target sequence. When optimally aligned, a donor template might overlap with one or more nucleotides of a target sequences (e.g. about or more than about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or more nucleotides). In some embodiments, when a template sequence and a polynucleotide comprising a target sequence are optimally aligned, the nearest nucleotide of the template polynucleotide is within about 1, 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.

    [0149] The donor template comprises a sequence to be integrated (e.g., a mutated gene). The sequence for integration may be a sequence endogenous or exogenous to the cell. Examples of a sequence to be integrated include polynucleotides encoding a protein or a non-coding RNA (e.g., a microRNA). Thus, the sequence for integration may be operably linked to an appropriate control sequence or sequences. Alternatively, the sequence to be integrated may provide a regulatory function.

    [0150] Homology arms of the donor template may comprise from about 20 bp to about 2500 bp, for example, about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 bp. In some methods, the exemplary upstream or downstream sequence have about 200 bp to about 2000 bp, about 600 bp to about 1000 bp, or more particularly about 700 bp to about 1000.

    [0151] In one example embodiment, one or both homology arms may be shortened to avoid including certain sequence repeat elements. For example, a 5 homology arm may be shortened to avoid a sequence repeat element. In other embodiments, a 3 homology arm may be shortened to avoid a sequence repeat element. In some embodiments, both the 5 and the 3 homology arms may be shortened to avoid including certain sequence repeat elements.

    [0152] The donor template may further comprise a marker. Such a marker may make it easy to screen for targeted integrations. Examples of suitable markers include restriction sites, fluorescent proteins, or selectable markers. The donor template of the disclosure can be constructed using recombinant techniques (see, for example, Sambrook et al., 2001 and Ausubel et al., 1996).

    [0153] In one example embodiment, a donor template is a single-stranded oligonucleotide. When using a single-stranded oligonucleotide, 5 and 3 homology arms may range up to about 200 base pairs (bp) in length, e.g., at least 25, 50, 75, 100, 125, 150, 175, or 200 bp in length.

    [0154] Suzuki et al. describe in vivo genome editing via CRISPR/Cas9 mediated homology-independent targeted integration (2016, Nature 540:144-149).

    Class 1 Systems

    [0155] The CRISPR-Cas therapeutic methods disclosed herein may be designed for use with Class 1 CRISPR-Cas systems. In certain example embodiments, the Class 1 system may be Type I, Type III or Type IV CRISPR-Cas as described in Makarova et al. Evolutionary classification of CRISPR-Cas systems: a burst of class 2 and derived variants Nature Reviews Microbiology, 18:67-81 (February 2020), incorporated in its entirety herein by reference, and particularly as described in FIG. 1, p. 326. The Class 1 systems typically use a multi-protein effector complex, which can, in some embodiments, include ancillary proteins, such as one or more proteins in a complex referred to as a CRISPR-associated complex for antiviral defense (Cascade), one or more adaptation proteins (e.g. Cas1, Cas2, RNA nuclease), and/or one or more accessory proteins (e.g. Cas 4, DNA nuclease), CRISPR associated Rossman fold (CARF) domain containing proteins, and/or RNA transcriptase. Although Class 1 systems have limited sequence similarity, Class 1 system proteins can be identified by their similar architectures, including one or more Repeat Associated Mysterious Protein (RAMP) family subunits, e.g. Cas 5, Cas6, Cas7. RAMP proteins are characterized by having one or more RNA recognition motif domains. Large subunits (for example cas8 or cas10) and small subunits (for example, cas11) are also typical of Class 1 systems. See, e.g., FIGS. 1 and 2. Koonin E V, Makarova K S. 2019 Origins and evolution of CRISPR-Cas systems. Phil. Trans. R. Soc. B 374: 20180087, DOI: 10.1098/rstb.2018.0087. In one aspect, Class 1 systems are characterized by the signature protein Cas3. The Cascade in particular Class1 proteins can comprise a dedicated complex of multiple Cas proteins that binds pre-crRNA and recruits an additional Cas protein, for example Cas6 or Cas5, which is the nuclease directly responsible for processing pre-crRNA. In one aspect, the Type I CRISPR protein comprises an effector complex comprises one or more Cas5 subunits and two or more Cas7 subunits. Class 1 subtypes include Type I-A, I-B, I-C, I-U, I-D, I-E, and I-F, Type IV-A and IV-B, and Type III-A, III-D, III-C, and III-B. Class 1 systems also include CRISPR-Cas variants, including Type I-A, I-B, I-E, I-F and I-U variants, which can include variants carried by transposons and plasmids, including versions of subtype I-F encoded by a large family of Tn7-like transposon and smaller groups of Tn7-like transposons that encode similarly degraded subtype I-B systems. Peters et al., PNAS 114 (35) (2017); DOI: 10.1073/pnas. 1709035114; see also, Makarova et al, the CRISPR Journal, v. 1, n5, FIG. 5.

    Class 2 Systems

    [0156] The CRISPR-Cas therapeutic methods disclosed herein may be designed for use with. Class 2 systems are distinguished from Class 1 systems in that they have a single, large, multi-domain effector protein. In certain example embodiments, the Class 2 system can be a Type II, Type V, or Type VI system, which are described in Makarova et al. Evolutionary classification of CRISPR-Cas systems: a burst of class 2 and derived variants Nature Reviews Microbiology, 18:67-81 (February 2020), incorporated herein by reference. Each type of Class 2 system is further divided into subtypes. See Markova et al. 2020, particularly at Figure. 2. Class 2, Type II systems can be divided into 4 subtypes: II-A, II-B, II-C1, and II-C2. Class 2, Type V systems can be divided into 17 subtypes: V-A, V-B1, V-B2, V-C, V-D, V-E, V-F1, V-F1(V-U3), V-F2, V-F3, V-G, V-H, V-I, V-K (V-U5), V-U1, V-U2, and V-U4. Class 2, Type IV systems can be divided into 5 subtypes: VI-A, VI-B1, VI-B2, VI-C, and VI-D.

    [0157] The distinguishing feature of these types is that their effector complexes consist of a single, large, multi-domain protein. Type V systems differ from Type II effectors (e.g., Cas9), which contain two nuclear domains that are each responsible for the cleavage of one strand of the target DNA, with the HNH nuclease inserted inside a split Ruv-C like nuclease domain sequence. The Type V systems (e.g., Cas12) only contain a RuvC-like nuclease domain that cleaves both strands. Some Type V systems have also been found to possess this collateral activity with two single-stranded DNA in in vitro contexts.

    [0158] In one example embodiment, the Class 2 system is a Type II system. In one example embodiment, the Type II CRISPR-Cas system is a II-A CRISPR-Cas system. In one example embodiment, the Type II CRISPR-Cas system is a II-B CRISPR-Cas system. In one example embodiment, the Type II CRISPR-Cas system is a II-C1 CRISPR-Cas system. In one example embodiment, the Type II CRISPR-Cas system is a II-C2 CRISPR-Cas system. In one example embodiments, the Type II system is a Cas9 system. In some embodiments, the Type II system includes a Cas9.

    [0159] In one example embodiment, the Class 2 system is a Type V system. In one example embodiment, the Type V CRISPR-Cas system is a V-A CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-B1 CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-B2 CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-C CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-D CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-E CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-F1 CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-F1 (V-U3) CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-F2 CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-F3 CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-G CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-H CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-I CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-K (V-U5) CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-U1 CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-U2 CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas system is a V-U4 CRISPR-Cas system. In one example embodiment, the Type V CRISPR-Cas is a Cas12a (Cpf1), Cas12b (C2c1), Cas12c (C2c3), Cas12d (CasY), Cas12e (CasX), Cas14, and/or Cas?.

    Guide Molecules

    [0160] The following include general design principles that may be applied to the guide molecule. The terms guide molecule, guide sequence and guide polynucleotide refer to polynucleotides capable of guiding Cas to a target genomic locus and are used interchangeably as in foregoing cited documents such as International Patent Publication No. WO 2014/093622 (PCT/US2013/074667). In general, a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence. The guide molecule can be a polynucleotide.

    [0161] The ability of a guide sequence (within a nucleic acid-targeting guide RNA) to direct sequence-specific binding of a nucleic acid-targeting complex to a target nucleic acid sequence may be assessed by any suitable assay. For example, the components of a nucleic acid-targeting CRISPR system sufficient to form a nucleic acid-targeting complex, including the guide sequence to be tested, may be provided to a host cell having the corresponding target nucleic acid sequence, such as by transfection with vectors encoding the components of the nucleic acid-targeting complex, followed by an assessment of preferential targeting (e.g., cleavage) within the target nucleic acid sequence, such as by Surveyor assay (Qui et al. 2004. BioTechniques. 36(4)702-707). Similarly, cleavage of a target nucleic acid sequence may be evaluated in a test tube by providing the target nucleic acid sequence, components of a nucleic acid-targeting complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions. Other assays are possible and will occur to those skilled in the art.

    [0162] In some embodiments, the guide molecule is an RNA. The guide molecule(s) (also referred to interchangeably herein as guide polynucleotide and guide sequence) that are included in the CRISPR-Cas or Cas based system can be any polynucleotide sequence having sufficient complementarity with a target nucleic acid sequence to hybridize with the target nucleic acid sequence and direct sequence-specific binding of a nucleic acid-targeting complex to the target nucleic acid sequence. In some embodiments, the degree of complementarity, when optimally aligned using a suitable alignment algorithm, can be about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting examples of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g., the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; available at www.novocraft.com), ELAND (Illumina, San Diego, CA), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).

    [0163] A guide sequence, and hence a nucleic acid-targeting guide, may be selected to target any target nucleic acid sequence. The target sequence may be DNA. The target sequence may be any RNA sequence. In some embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of messenger RNA (mRNA), pre-mRNA, ribosomal RNA (rRNA), transfer RNA (tRNA), micro-RNA (miRNA), small interfering RNA (siRNA), small nuclear RNA (snRNA), small nucleolar RNA (snoRNA), double stranded RNA (dsRNA), non-coding RNA (ncRNA), long non-coding RNA (lncRNA), and small cytoplasmatic RNA (scRNA). In some preferred embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of mRNA, pre-mRNA, and rRNA. In some preferred embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of ncRNA, and lncRNA. In some more preferred embodiments, the target sequence may be a sequence within an mRNA molecule or a pre-mRNA molecule.

    [0164] In some embodiments, a nucleic acid-targeting guide is selected to reduce the degree secondary structure within the nucleic acid-targeting guide. In some embodiments, about or less than about 75%, 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 1%, or fewer of the nucleotides of the nucleic acid-targeting guide participate in self-complementary base pairing when optimally folded. Optimal folding may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFold, as described by Zuker and Stiegler (Nucleic Acids Res. 9 (1981), 133-148). Another example folding algorithm is the online webserver RNAfold, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g., A. R. Gruber et al., 2008, Cell 106(1): 23-24; and P A Carr and G M Church, 2009, Nature Biotechnology 27(12): 1151-62).

    [0165] In one example embodiment, a guide RNA or crRNA may comprise, consist essentially of, or consist of a direct repeat (DR) sequence and a guide sequence or spacer sequence. In another example embodiment, the guide RNA or crRNA may comprise, consist essentially of, or consist of a direct repeat sequence fused or linked to a guide sequence or spacer sequence. In another example embodiment, the direct repeat sequence may be located upstream (i.e., 5) from the guide sequence or spacer sequence. In other embodiments, the direct repeat sequence may be located downstream (i.e., 3) from the guide sequence or spacer sequence.

    [0166] In one example embodiment, the crRNA comprises a stem loop, preferably a single stem loop. In one example embodiment, the direct repeat sequence forms a stem loop, preferably a single stem loop.

    [0167] In one example embodiment, the spacer length of the guide RNA is from 15 to 35 nt. In another example embodiment, the spacer length of the guide RNA is at least 15 nucleotides. In another example embodiment, the spacer length is from 15 to 17 nt, e.g., 15, 16, or 17 nt, from 17 to 20 nt, e.g., 17, 18, 19, or 20 nt, from 20 to 24 nt, e.g., 20, 21, 22, 23, or 24 nt, from 23 to 25 nt, e.g., 23, 24, or 25 nt, from 24 to 27 nt, e.g., 24, 25, 26, or 27 nt, from 27 to 30 nt, e.g., 27, 28, 29, or 30 nt, from 30 to 35 nt, e.g., 30, 31, 32, 33, 34, or 35 nt, or 35 nt or longer.

    [0168] The tracrRNA sequence or analogous terms includes any polynucleotide sequence that has sufficient complementarity with a crRNA sequence to hybridize. In some embodiments, the degree of complementarity between the tracrRNA sequence and crRNA sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. In some embodiments, the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length. In some embodiments, the tracr sequence and crRNA sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin.

    [0169] In general, degree of complementarity is with reference to the optimal alignment of the sca sequence and tracr sequence, along the length of the shorter of the two sequences. Optimal alignment may be determined by any suitable alignment algorithm and may further account for secondary structures, such as self-complementarity within either the sca sequence or tracr sequence. In some embodiments, the degree of complementarity between the tracr sequence and sca sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher.

    [0170] In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence can be about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or 100%; a guide or RNA or sgRNA can be about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length; or guide or RNA or sgRNA can be less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length; and tracr RNA can be 30 or 50 nucleotides in length. In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence is greater than 94.5% or 95% or 95.5% or 96% or 96.5% or 97% or 97.5% or 98% or 98.5% or 99% or 99.5% or 99.9%, or 100%. Off target is less than 100% or 99.9% or 99.5% or 99% or 99% or 98.5% or 98% or 97.5% or 97% or 96.5% or 96% or 95.5% or 95% or 94.5% or 94% or 93% or 92% or 91% or 90% or 89% or 88% or 87% or 86% or 85% or 84% or 83% or 82% or 81% or 80% complementarity between the sequence and the guide, with it being advantageous that off target is 100% or 99.9% or 99.5% or 99% or 99% or 98.5% or 98% or 97.5% or 97% or 96.5% or 96% or 95.5% or 95% or 94.5% complementarity between the sequence and the guide.

    [0171] In some embodiments according to the invention, the guide RNA (capable of guiding Cas to a target locus) may comprise (1) a guide sequence capable of hybridizing to a genomic target locus in the eukaryotic cell; (2) a tracr sequence; and (3) a tracr mate sequence. All of (1) to (3) may reside in a single RNA, i.e., an sgRNA (arranged in a 5 to 3 orientation), or the tracr RNA may be a different RNA than the RNA containing the guide and tracr sequence. The tracr hybridizes to the tracr mate sequence and directs the CRISPR/Cas complex to the target sequence. Where the tracr RNA is on a different RNA than the RNA containing the guide and tracr sequence, the length of each RNA may be optimized to be shortened from their respective native lengths, and each may be independently chemically modified to protect from degradation by cellular RNase or otherwise increase stability.

    [0172] Many modifications to guide sequences are known in the art and are further contemplated within the context of this invention. Various modifications may be used to increase the specificity of binding to the target sequence and/or increase the activity of the Cas protein and/or reduce off-target effects. Example guide sequence modifications are described in International Patent Application No. PCT US2019/045582, specifically paragraphs [0178]-[0333]. which is incorporated herein by reference.

    Target Sequences, PAMs, and PESs

    [0173] In the context of formation of a CRISPR complex, target sequence refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex. In other words, the target polynucleotide can be a polynucleotide or a part of a polynucleotide to which a part of the guide sequence is designed to have complementarity with and to which the effector function mediated by the complex comprising the CRISPR effector protein and a guide molecule is to be directed. In some embodiments, a target sequence is located in the nucleus or cytoplasm of a cell.

    [0174] PAM elements are sequences that can be recognized and bound by Cas proteins. Cas proteins/effector complexes can then unwind the dsDNA at a position adjacent to the PAM element. It will be appreciated that Cas proteins and systems target RNA do not require PAM sequences (Marraffini et al. 2010. Nature. 463:568-571). Instead, many rely on PFSs, which are discussed elsewhere herein. In one example embodiment, the target sequence should be associated with a PAM (protospacer adjacent motif) or PFS (protospacer flanking sequence or site), that is, a short sequence recognized by the CRISPR complex. Depending on the nature of the CRISPR-Cas protein, the target sequence should be selected, such that its complementary sequence in the DNA duplex (also referred to herein as the non-target sequence) is upstream or downstream of the PAM. In the embodiments, the complementary sequence of the target sequence is downstream or 3 of the PAM or upstream or 5 of the PAM. The precise sequence and length requirements for the PAM differ depending on the Cas protein used, but PAMs are typically 2-5 base pair sequences adjacent the protospacer (that is, the target sequence). Examples of the natural PAM sequences for different Cas proteins are provided herein below and the skilled person will be able to identify further PAM sequences for use with a given Cas protein.

    [0175] The ability to recognize different PAM sequences depends on the Cas polypeptide(s) included in the system. See e.g., Gleditzsch et al. 2019. RNA Biology. 16(4):504-517. Table 3 (from Gleditzsch et al. 2019) below shows several Cas polypeptides and the PAM sequence they recognize.

    TABLE-US-00001 TABLE3 ExamplePAMSequences CasProtein PAMSequence SpCas9 NGG/NRG SaCas9 NGRRTorNGRRN NmeCas9 NNNNGATT CjCas9 NNNNRYAC StCas9 NNAGAAW Cas12a(Cpf1) TTTV (including LbCpf1and AsCpf1) Cas12b(C2c1) TTT,TTA,andTTC Cas12c(C2c3) TA Cas12d(CasY) TA Cas12e(CasX) 5-TTCN-3 Cas1 5-CTT-3 Cas8e 5-ATG-3 TypeI-A 5-CCN-3 TypeI-B TTC,ACT,TAA,TAT, TAG,andCAC TypeI-C NTTC TypeI-E 5-AAG-3 TypeI-F GG

    [0176] In a preferred embodiment, the CRISPR effector protein may recognize a 3 PAM. In one example embodiment, the CRISPR effector protein may recognize a 3 PAM which is 5H, wherein His A, C or U.

    [0177] Further, engineering of the PAM Interacting (PI) domain on the Cas protein may allow programing of PAM specificity, improve target site recognition fidelity, and increase the versatility of the CRISPR-Cas protein, for example as described for Cas9 in Kleinstiver B P et al. Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature. 2015 Jul. 23; 523(7561):481-5. doi: 10.1038/nature14592. As further detailed herein, the skilled person will understand that Cas 13 proteins may be modified analogously. Gao et al, Engineered Cpf1 Enzymes with Altered PAM Specificities, bioRxiv 091611; doi: http://dx.doi.org/10.1101/091611 (Dec. 4, 2016). Doench et al. created a pool of sgRNAs, tiling across all possible target sites of a panel of six endogenous mouse and three endogenous human genes and quantitatively assessed their ability to produce null alleles of their target gene by antibody staining and flow cytometry. The authors showed that optimization of the PAM improved activity and also provided an on-line tool for designing sgRNAs.

    [0178] PAM sequences can be identified in a polynucleotide using an appropriate design tool, which are commercially available as well as online. Such freely available tools include, but are not limited to, CRISPRFinder and CRISPRTarget. Mojica et al. 2009. Microbiol. 155(Pt. 3):733-740; Atschul et al. 1990. J. Mol. Biol. 215:403-410; Biswass et al. 2013 RNA Biol. 10:817-827; and Grissa et al. 2007. Nucleic Acid Res. 35:W52-57. Experimental approaches to PAM identification can include, but are not limited to, plasmid depletion assays (Jiang et al. 2013. Nat. Biotechnol. 31:233-239; Esvelt et al. 2013. Nat. Methods. 10:1116-1121; Kleinstiver et al. 2015. Nature. 523:481-485), screened by a high-throughput in vivo model called PAM-SCNAR (Pattanayak et al. 2013. Nat. Biotechnol. 31:839-843 and Leenay et al. 2016. Mol. Cell. 16:253), and negative screening (Zetsche et al. 2015. Cell. 163:759-771).

    [0179] As previously mentioned, CRISPR-Cas systems that target RNA do not typically rely on PAM sequences. Instead, such systems typically recognize protospacer flanking sites (PFSs) instead of PAMs Thus, Type VI CRISPR-Cas systems typically recognize protospacer flanking sites (PFSs) instead of PAMs. PFSs represents an analogue to PAMs for RNA targets. Type VI CRISPR-Cas systems employ a Cas13. Some Cas13 proteins analyzed to date, such as Cas13a (C2c2) identified from Leptotrichia shahii (LShCAs13a) have a specific discrimination against G at the 3end of the target RNA. The presence of a C at the corresponding crRNA repeat site can indicate that nucleotide pairing at this position is rejected. However, some Cas13 proteins (e.g., LwaCAs13a and PspCas13b) do not seem to have a PFS preference. See e.g., Gleditzsch et al. 2019. RNA Biology. 16(4):504-517.

    [0180] Some Type VI proteins, such as subtype B, have 5-recognition of D (G, T, A) and a 3-motif requirement of NAN or NNA. One example is the Cas13b protein identified in Bergeyella zoohelcum (BzCas13b). See e.g., Gleditzsch et al. 2019. RNA Biology. 16(4):504-517.

    [0181] Overall Type VI CRISPR-Cas systems appear to have less restrictive rules for substrate (e.g., target sequence) recognition than those that target DNA (e.g., Type V and type II).

    Sequences Related to Nucleus Targeting and Transportation

    [0182] In some embodiments, one or more components (e.g., the Cas protein) in the composition for engineering cells may comprise one or more sequences related to nucleus targeting and transportation. Such sequences may facilitate the one or more components in the composition for targeting a sequence within a cell. In order to improve targeting of the CRISPR-Cas protein used in the methods of the present disclosure to the nucleus, it may be advantageous to provide one or both of these components with one or more nuclear localization sequences (NLSs).

    [0183] In one example embodiment, the NLSs used in the context of the present disclosure are heterologous to the proteins. Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 1) or PKKKRKVEAS (SEQ ID NO: 2); the NLS from nucleoplasmin (e.g., the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK (SEQ ID NO: 3)); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 4) or RQRRNELKRSP (SEQ ID NO: 5); the hRNPA1 M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 6); the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 7) of the IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO: 8) and PPKKARED (SEQ ID NO: 9) of the myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 10) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 11) of mouse c-abl IV; the sequences DRLRR (SEQ ID NO: 12) and PKQKKRK (SEQ ID NO: 13) of the influenza virus NS1; the sequence RKLKKKIKKL (SEQ ID NO: 14) of the Hepatitis virus delta antigen; the sequence REKKKFLKRR (SEQ ID NO: 15) of the mouse Mx1 protein; the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 16) of the human poly(ADP-ribose) polymerase; and the sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 17) of the steroid hormone receptors (human) glucocorticoid. In general, the one or more NLSs are of sufficient strength to drive accumulation of the DNA-targeting Cas protein in a detectable amount in the nucleus of a eukaryotic cell. In general, strength of nuclear localization activity may derive from the number of NLSs in the CRISPR-Cas protein, the particular NLS(s) used, or a combination of these factors. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to the nucleic acid-targeting protein, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g., a stain specific for the nucleus such as DAPI). Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of nucleic acid-targeting complex formation (e.g., assay for deaminase activity) at the target sequence, or assay for altered gene expression activity affected by DNA-targeting complex formation and/or DNA-targeting), as compared to a control not exposed to the Cas protein, or exposed to a Cas protein lacking the one or more NLSs.

    [0184] The Cas proteins may be provided with 1 or more, such as with, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more heterologous NLSs. In some embodiments, the proteins comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g., zero or at least one or more NLS at the amino-terminus and zero or at one or more NLS at the carboxy terminus). When more than one NLS is present, each may be selected independently of the others, such that a single NLS may be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies. In some embodiments, an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus. In preferred embodiments of the Cas proteins, an NLS attached to the C-terminal of the protein.

    Zinc-Finger Nucleases (ZFN)

    [0185] Other preferred tools for genome editing for use in the context of this invention include zinc finger systems. One type of programmable DNA-binding domain is provided by artificial zinc-finger (ZF) technology, which involves arrays of ZF modules to target new DNA-binding sites in the genome. Each finger module in a ZF array targets three DNA bases. A customized array of individual zinc finger domains is assembled into a ZF protein (ZFP). Zinc-finger nuclease (ZFNs) have been used to modify endogenous genes in various organisms, including viruses, bacteria, nematodes, frogs, plants, insects, fish and mammals such as mice, rats and pigs, as well as in cultured mammalian and avian cells.

    [0186] In one example embodiment, a method of enhancing the anti-tumor immunity of a subject in need thereof comprises administering administering a zinc-finger nuclease editing system that generates variants with decreased expression or activity of B3GNT2.

    [0187] ZFPs can comprise a functional domain. The first synthetic zinc finger nucleases (ZFNs) were developed by fusing a ZF protein to the catalytic domain of the Type IIS restriction enzyme FokI. (Kim, Y. G. et al., 1994, Chimeric restriction endonuclease, Proc. Natl. Acad. Sci. U.S.A. 91, 883-887; Kim, Y. G. et al., 1996, Hybrid restriction enzymes: zinc finger fusions to Fok I cleavage domain. Proc. Natl. Acad. Sci. U.S.A. 93, 1156-1160). Increased cleavage specificity can be attained with decreased off target activity by use of paired ZFN heterodimers, each targeting different nucleotide sequences separated by a short spacer. (Doyon, Y. et al., 2011, Enhancing zinc-finger-nuclease activity with improved obligate heterodimeric architectures. Nat. Methods 8, 74-79). ZFPs can also be designed as transcription activators and repressors and have been used to target many genes in a wide variety of organisms. Exemplary methods of genome editing using ZFNs can be found for example in U.S. Pat. Nos. 6,534,261, 6,607,882, 6,746,838, 6,794,136, 6,824,978, 6,866,997, 6,933,113, 6,979,539, 7,013,219, 7,030,215, 7,220,719, 7,241,573, 7,241,574, 7,585,849, 7,595,376, 6,903,185, and 6,479,626, all of which are specifically incorporated by reference.

    TALENs

    [0188] As disclosed herein editing can be made by way of the transcription activator-like effector nucleases (TALENs) system. In some embodiments, the programmable nuclease may be a transcription activator-like effector nuclease (TALEN), a functional fragment thereof, or a variant thereof. The present disclosure also includes nucleotide sequences that are or encode one or more components of a TALEN system. As disclosed herein, editing can be made by way of the transcription activator-like effector (TALEs) system, which have been used to modify endogenous genes in various species, including viruses, yeast, plants, nematodes, insects, frogs, fish and mammals such as mice, rats and pigs, as well as in cultured mammalian cells.

    [0189] Naturally occurring TALEs or wild type TALEs are nucleic acid binding proteins secreted by numerous species of proteobacteria. TALE polypeptides contain a nucleic acid binding domain composed of tandem repeats of highly conserved monomer polypeptides that are predominantly 33, 34 or 35 amino acids in length and that differ from each other mainly in amino acid positions 12 and 13. Transcription activator-like effectors (TALEs) can be engineered to bind practically any desired DNA sequence. Exemplary methods of genome editing using the TALEN system can be found for example in Cermak T. Doyle E L. Christian M. Wang L. Zhang Y. Schmidt C, et al. Efficient design and assembly of custom TALEN and other TAL effector-based constructs for DNA targeting. Nucleic Acids Res. 2011; 39:e82; Zhang F. Cong L. Lodato S. Kosuri S. Church G M. Arlotta P Efficient construction of sequence-specific TAL effectors for modulating mammalian transcription. Nat Biotechnol. 2011; 29:149-153 and U.S. Pat. Nos. 8,450,471, 8,440,431 and 8,440,432, all of which are specifically incorporated by reference. The structure and function of TALEs is further described in, for example, Moscou et al., Science 326:1501 (2009); Boch et al., Science 326:1509-1512 (2009); and Zhang et al., Nature Biotechnology 29:149-153 (2011).

    [0190] In some embodiments, provided herein include isolated, non-naturally occurring, recombinant or engineered DNA binding proteins that comprise TALE monomers as a part of their organizational structure that enable the targeting of nucleic acid sequences with improved efficiency and expanded specificity.

    [0191] In one example embodiment, a method of enhancing the anti-tumor immunity of a subject in need thereof comprises administering administering a TALENs editing system that generates variants with decreased expression or activity of B3GNT2.

    [0192] In some embodiments, TALENs can be designed to target almost any given DNA sequence, which is a crucial advantage of TALENs over other types of nucleases. For example, small DNA sequences (such as enhancers or miRNA-coding sequences) may lack targetable sites for ZFNs or CRISPR-Cas systems but can be mutated preferentially using TALENs. The only limitation in the design of TALENs seems to be the requirement for a thymine at the 5 end of the target sequence, which is recognized by two amino-terminal cryptic repeat folds. Although there have been conflicting reports that emphasize or refute the importance of this 5 thymine, choosing a target sequence with a thymine at the 5 end is usually recommended. Recently developed TALE variants that recognize other bases at the 5 end would further broaden the range of targetable sites. Conventional TALENs cannot cleave target DNA that contains methylated cytosines. However, a methylated cytosine is indistinguishable from a thymine in the major groove; hence, the His-Asp RVD repeat (which recognizes cytosines) can be replaced with an Asn-Gly RVD repeat (which recognizes thymines) to generate TALENs that can cleave methylated DNA.

    [0193] As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), TALE polypeptide binding efficiency may be increased by including amino acid sequences from the capping regions that are directly N-terminal or C-terminal of the DNA binding region of naturally occurring TALEs into the engineered TALEs at positions N-terminal or C-terminal of the engineered TALE DNA binding region. Thus, in certain embodiments, the TALE polypeptides described herein further comprise an N-terminal capping region and/or a C-terminal capping region.

    [0194] In some embodiments described herein, the TALE polypeptides of the invention include a nucleic acid binding domain linked to the one or more effector domains. The terms effector domain or regulatory and functional domain refer to a polypeptide sequence that has an activity other than binding to the nucleic acid sequence recognized by the nucleic acid binding domain. By combining a nucleic acid binding domain with one or more effector domains, the polypeptides of the invention may be used to target the one or more functions or activities mediated by the effector domain to a particular target DNA sequence to which the nucleic acid binding domain specifically binds.

    Meganucleases

    [0195] In some embodiments, the programmable nuclease may be a meganuclease or system thereof. Meganucleases, which are endodeoxyribonucleases characterized by a large recognition site (double-stranded DNA sequences of 12 to 40 base pairs). Exemplary methods for using meganucleases can be found in U.S. Pat. Nos. 8,163,514, 8,133,697, 8,021,867, 8,119,361, 8,119,381, 8,124,369, and 8,129,134, which are specifically incorporated by reference.

    [0196] In one example embodiment, a method of enhancing the anti-tumor immunity of a subject in need thereof comprises administering administering a meganuclease or system thereof that generates variants with decreased expression or activity of B3GNT2.

    Base Editing

    [0197] Provided herein are methods for editing DNA or RNA, i.e., base editing, without inducing double-stranded breaks in the DNA targeted for modification. A base-editing system may comprise a Cas polypeptide linked to a nucleobase deaminase (base editing system) and a guide molecule capable of forming a complex with the Cas polypeptide and directing sequence-specific binding of the base editing system at a target sequence. In one example embodiment, the Cas polypeptide is catalytically inactive. In another example embodiment, the Cas polypeptide is a nickase. The Cas polypeptide may be any of the Cas polypeptides disclosed above. In one example embodiment, the Cas polypeptide is a Type II Cas polypeptide. In one example embodiment, the Cas polypeptide is a Cas9 polypeptide. In another example embodiment, the Cas polypeptide is a Type V Cas polypeptide. In one example embodiment, the Cas polypeptide is a Cas 12a or Cas 12b polypeptide. The nucleobase deaminase may be cytosine base editor (CBE) or adenosine base editors (ABEs). CBEs convert C.Math.G base pairs into a T.Math.A base pair (Komor et al. 2016. Nature. 533:420-424; Nishida et al. 2016. Science. 353; and Li et al. Nat. Biotech. 36:324-327) and ABEs convert an A.Math.T base pair to a G.Math.C base pair. Collectively, CBEs and ABEs can mediate all four possible transition mutations (C to T, A to G, T to C, and G to A). Example base editing systems are disclosed in Rees and Liu (2018), Nat. Rev. Genet. 19(12): 770-788, particularly at FIGS. 1b, 2a-2c, 3a-3f, and Table 1, which is specifically incorporated herein by reference. In certain example embodiments, the base editing system may further comprise a DNA glycosylase inhibitor.

    [0198] In one example embodiment, a method of enhancing the anti-tumor immunity of a subject in need thereof comprises administering a base editing system that generates one or more variants with decreased expression or activity of B3GNT2.

    [0199] The editing window of a base editing system may range over a 5-8 nucleotide window, depending on the base editing system used. Id. Accordingly, given the base editing system used, a guide sequence may be selected to direct the base editing system to convert a base or base pair of one or more variants resulting in reduced B3GNT2 expression. In one example embodiment, the variant is generated as using one or more of the gene editing methods described herein.

    ARCUS Based Editing

    [0200] In one example embodiment, a method of enhancing the anti-tumor immunity of a subject in need thereof comprises administering administering an ARCUS base editing system. Exemplary methods for using ARCUS can be found in U.S. Pat. No. 10,851,358, US Publication No. 2020-0239544, and WIPO Publication No. 2020/206231 which are incorporated herein by reference

    DNA Base Editing

    [0201] In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a base editing system. In some embodiments, a Cas protein is connected or fused to a nucleotide deaminase. Thus, in some embodiments the Cas-based system can be a base editing system. As used herein, base editing refers generally to the process of polynucleotide modification via a CRISPR-Cas-based or Cas-based system that does not include excising nucleotides to make the modification. Base editing can convert base pairs at precise locations without generating excess undesired editing byproducts that can be made using traditional CRISPR-Cas systems.

    [0202] In some embodiments, the nucleotide deaminase may be a DNA base editor used in combination with a DNA binding Cas protein such as, but not limited to, Class 2 Type II and Type V systems. Two classes of DNA base editors are generally known: cytosine base editors (CBEs) and adenine base editors (ABEs). CBEs convert a C.Math.G base pair into a T.Math.A base pair (Komor et al. 2016. Nature. 533:420-424; Nishida et al. 2016. Science. 353; and Li et al. Nat. Biotech. 36:324-327) and ABEs convert an A.Math.T base pair to a G.Math.C base pair. Collectively, CBEs and ABEs can mediate all four possible transition mutations (C to T, A to G, T to C, and G to A). Rees and Liu. 2018. Nat. Rev. Genet. 19(12): 770-788, particularly at FIGS. 1b, 2a-2c, 3a-3f, and Table 1. In some embodiments, the base editing system includes a CBE and/or an ABE. In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a base editing system. Rees and Liu. 2018. Nat. Rev. Gent. 19(12): 770-788. Base editors also generally do not need a DNA donor template and/or rely on homology-directed repair. Komor et al. 2016. Nature. 533:420-424; Nishida et al. 2016. Science. 353; and Gaudeli et al. 2017. Nature. 551:464-471. Upon binding to a target locus in the DNA, base pairing between the guide RNA of the system and the target DNA strand leads to displacement of a small segment of ssDNA in an R-loop. Nishimasu et al. Cell. 156:935-949. DNA bases within the ssDNA bubble are modified by the enzyme component, such as a deaminase. In some systems, the catalytically disabled Cas protein can be a variant or modified Cas can have nickase functionality and can generate a nick in the non-edited DNA strand to induce cells to repair the non-edited strand using the edited strand as a template. Komor et al. 2016. Nature. 533:420-424; Nishida et al. 2016. Science. 353; and Gaudeli et al. 2017. Nature. 551:464-471. Base editors may be further engineered to optimize conversion of nucleotides (e.g. A:T to G:C). Richter et al. 2020. Nature Biotechnology. doi.org/10.1038/s41587-020-0453-z.

    [0203] Other Example Type V base editing systems are described in International Patent Publication Nos. WO 2018/213708, WO 2018/213726, and International Patent Applications No. PCT/US2018/067207, PCT/US2018/067225, and PCT/US2018/067307, each of which is incorporated herein by reference.

    RNA Base Editing

    [0204] The present application relates, in part, to modifying a target RNA sequence of interest. In certain example embodiments, the base editing system may be a RNA base editing system. As with DNA base editors, a nucleotide deaminase capable of converting nucleotide bases may be fused to a Cas protein. However, in these embodiments, the Cas protein will need to be capable of binding RNA. Example RNA binding Cas proteins include, but are not limited to, RNA-binding Cas9s such as Francisella novicida Cas9 (FnCas9), and Class 2 Type VI Cas systems. The nucleotide deaminase may be a cytidine deaminase or an adenosine deaminase, or an adenosine deaminase engineered to have cytidine deaminase activity. In certain example embodiments, the RNA based editor may be used to delete or introduce a post-translational modification site in the expressed mRNA. In contrast to DNA base editors, whose edits are permanent in the modified cell, RNA base editors can provide edits where finer temporal control may be needed, for example in modulating a particular immune response. Example Type VI RNA-base editing systems are described in Cox et al. 2017. Science 358: 1019-1027, WO 2019/005884, WO 2019/005886, WO 2019/071048, PCT/US20018/05179, PCT/US2018/067207, which are incorporated herein by reference. An example FnCas9 system that may be adapted for RNA base editing purposes is described in WO 2016/106236, which is incorporated herein by reference.

    [0205] An example method for delivery of base-editing systems, including use of a split-intein approach to divide CBE and ABE into reconstitutable halves, is described in Levy et al. Nature Biomedical Engineering doi.org/10.1038/s41441-019-0505-5 (2019), which is incorporated herein by reference.

    [0206] Using RNA-targeting rather than DNA targeting offers several advantages relevant for therapeutic development. First, there are substantial safety benefits to targeting RNA: there will be fewer off-target events because the available sequence space in the transcriptome is significantly smaller than the genome, and if an off-target event does occur, it will be transient and less likely to induce negative side effects. Second, RNA-targeting therapeutics will be more efficient because they are cell-type independent and do not have to enter the nucleus, making them easier to deliver.

    [0207] In an embodiment, the present disclosure includes an engineered composition for site-directed base editing comprising: a targeting domain; and an adenosine deaminase or catalytic domain thereof, wherein the adenosine deaminase is modified to convert activity to a cytidine deaminase.

    [0208] In some embodiments, the adenosine deaminase is modified by one or more mutations at one or more positions selected from E396, C451, V351, R455, T375, K376, S486, Q488, R510, K594, R348, G593, S397, H443, L444, Y445, F442, E438, T448, A353, V355, T339, P539, V525 and 1520. In some embodiments, the adenosine deaminase is mutated at one or more positions selected from E488, V351, S486, T375, S370, P462, and N597. In some embodiments, the adenosine deaminase comprises one or more mutations selected from E488Q, V351G, S486A, T375S, S370C, P462A, and N597I. In some embodiments, the adenosine deaminase protein or catalytic domain thereof is a human, cephalopod, or Drosophila adenosine deaminase protein or catalytic domain thereof. In some embodiments, said adenosine deaminase protein or catalytic domain thereof has been modified to comprise a mutation at glutamic acid488 of the hADAR2-D amino acid sequence, or a corresponding position in a homologous ADAR protein. In some embodiments, said glutamic acid residue at position 488 or a corresponding position in a homologous ADAR protein is replaced by a glutamine residue (E488Q). In some embodiments, said adenosine deaminase protein or catalytic domain thereof is a mutated hADAR2d comprising mutation E488Q or a mutated hADAR1d comprising mutation E1008Q. In some embodiments, the targeting domain is a catalytically inactive Cas13 protein, or a nucleotide sequence encoding said catalytically inactive Cas13 protein. In some embodiments, the catalytically inactive Cas13 protein is catalytically inactive Cas13a, catalytically inactive Cas 13b, or catalytically inactive Cas13c. In some embodiments, said catalytically inactive Cas13 protein is obtained from a Cas13 nuclease derived from a bacterial species selected from the group consisting of the bacterial species listed in any of Tables 1, 2, 3, or 4. In some embodiments, the composition further comprising a guide molecule which comprises a guide sequence linked to a direct repeat sequence, or a nucleotide sequence encoding said guide molecule. In some embodiments, said adenosine deaminase protein or catalytic domain thereof is covalently or non-covalently linked to the targeting domain.

    [0209] In another embodiment, the disclosure relates to a method of modifying an Adenine in a target RNA sequence of interest. In particular embodiments, the method comprises delivering to said target RNA: (a) a catalytically inactive (dead) Cas13 protein; (b) a guide molecule which comprises a guide sequence linked to a direct repeat sequence; and (c) an adenosine deaminase protein or catalytic domain thereof; wherein said adenosine deaminase protein or catalytic domain thereof is covalently or non-covalently linked to said dead Cas 13 protein or said guide molecule or is adapted to link thereto after delivery; wherein guide molecule forms a complex with said dead Cas13 protein and directs said complex to bind said target RNA sequence of interest, wherein said guide sequence is capable of hybridizing with a target sequence comprising said Adenine to form an RNA duplex, wherein said guide sequence comprises a non-pairing Cytosine at a position corresponding to said Adenine resulting in an A-C mismatch in the RNA duplex formed; wherein said adenosine deaminase protein or catalytic domain thereof deaminates said Adenine in said RNA duplex.

    [0210] In some embodiments, the RNA editing is carried out using the Cas13 protein, wherein the Cas13 protein is Cas13a, Cas13b or Cas13c.

    [0211] The adenosine deaminase protein or catalytic domain thereof is fused to N- or C-terminus of said dead Cas13 protein. In some embodiments, the adenosine deaminase protein or catalytic domain thereof is fused to said dead Cas13 protein by a linker.

    [0212] In some embodiments, the adenosine deaminase protein or catalytic domain thereof is linked to an adaptor protein and said guide molecule or said dead Cas 13 protein comprises an aptamer sequence capable of binding to said adaptor protein. The adaptor sequence may be selected from MS2, PP7, QB, F2, GA, fr, JP501, M12, R17, BZ13, JP34, JP500, KU1, M11, MX1, TW18, VK, SP, FI, ID2, NL95, TW19, AP205, ?Cb5, ?Cb8r, ?Cb12r, ?Cb23r, 7s and PRR1.

    [0213] In some embodiments, the adenosine deaminase protein or catalytic domain thereof is inserted into an internal loop of said dead Cas13 protein. In some embodiments, the Cas13a protein comprises one or more mutations in the two HEPN domains, particularly at position R474 and R1046 of Cas 13a protein originating from Leptotrichia wadei or amino acid positions corresponding thereto of a Cas13a ortholog.

    [0214] In some embodiments, the Cas13 protein is a Cas13b proteins, and the Cas13b comprises a mutation in one or more of positions R116, H121, R1177, H1182 of Cas13b protein originating from Bergeyella zoohelcum ATCC 43767 or amino acid positions corresponding thereto of a Cas 13b ortholog. In some embodiments, the mutation is one or more of R116A, H121A, R1177A, H1182A of Cas13b protein originating from Bergeyella zoohelcum ATCC 43767 or amino acid positions corresponding thereto of a Cas13b ortholog.

    [0215] In some embodiments, the guide sequence has a length of about 29-53 nt capable of forming said RNA duplex with said target sequence. In some embodiments, the guide sequence has a length of about 40-50 nt capable of forming said RNA duplex with said target sequence. In some embodiments, the distance between said non-pairing C and the 5 end of said guide sequence is 20-30 nucleotides.

    [0216] In some embodiments, the adenosine deaminase protein or catalytic domain thereof is a human, cephalopod, or Drosophila adenosine deaminase protein or catalytic domain thereof. In certain example embodiments, the adenosine deaminase protein or catalytic domain thereof has been modified to comprise a mutation at glutamic acid488 of the hADAR2-D amino acid sequence, or a corresponding position in a homologous ADAR protein. In some embodiments, the glutamic acid residue may be at position 488 or a corresponding position in a homologous ADAR protein is replaced by a glutamine residue (E488Q).

    [0217] In some embodiments, the adenosine deaminase protein or catalytic domain thereof is a mutated hADAR2d comprising mutation E488Q or a mutated hADAR1d comprising mutation E1008Q.

    [0218] In some embodiments, the guide sequence comprises more than one mismatch corresponding to different adenosine sites in the target RNA sequence or wherein two guide molecules are used, each comprising a mismatch corresponding to a different adenosine site in the target RNA sequence.

    [0219] In some embodiments, the Cas13 protein and optionally said adenosine deaminase protein or catalytic domain thereof comprise one or more heterologous nuclear localization signal(s) (NLS(s)).

    [0220] In some embodiments, the method further comprises, determining the target sequence of interest and selecting an adenosine deaminase protein or catalytic domain thereof which most efficiently deaminates said adenine present in then target sequence.

    [0221] The components of the systems described herein may be delivered to said cell as a ribonucleoprotein complex or as one or more polynucleotide molecules. The one or more polynucleotide molecules may comprise one or more mRNA molecules encoding the components. The one or more polynucleotide molecules may be comprised within one or more vectors. The one or more polynucleotide molecules may further comprise one or more regulatory elements operably configured to express said Cas13 protein, said guide molecule, and said adenosine deaminase protein or catalytic domain thereof, optionally wherein said one or more regulatory elements comprise inducible promoters. The one or more polynucleotide molecules or said ribonucleoprotein complex may be delivered via particles, vesicles, or one or more viral vectors. The particles may comprise a lipid, a sugar, a metal or a protein. The particles may comprise lipid nanoparticles. The vesicles may comprise exosomes or liposomes. The one or more viral vectors may comprise one or more of adenovirus, one or more lentivirus or one or more adeno-associated virus.

    [0222] The RNA editing methods disclosed herein may be used to modify a cell, a cell line or an organism by manipulation of one or more target RNA sequences.

    [0223] In some embodiments, the deamination of said Adenine in said target RNA of interest remedies a disease caused by transcripts containing a pathogenic G.fwdarw.A or C.fwdarw.T point mutation.

    [0224] The methods disclosed herein, may be used to make a modification that affects specific, targeted genes of an organism (e.g., B3GNT2). The modification may affect splicing of said target RNA sequence. The modification may introduce a mutation in a transcript that reduces expression of the targeted gene. The modification may introduce an amino acid change and cause a reduction in activity of the targeted protein.

    [0225] In some embodiments, the deamination of the adenine in said target RNA of interest causes a loss of function or reduced expression of a gene. In certain example embodiments, the loss of function or reduced expression of the gene leads to an enhancement of anti-tumor immunity in a subject.

    [0226] In some embodiments, the cytosine of the adenosine deaminase is not 5 flanked by guanosine. In certain embodiments, said adenosine deaminase is ADAR, optionally huADAR, optionally (hu)ADAR1 or (hu)ADAR2. In certain embodiments, said Cas13, preferably Cas13b, is truncated, preferably C-terminally truncated, preferably wherein said Cas 13 is a truncated functional variant of the corresponding wild type Cas13.

    [0227] In another aspect, the present disclosure includes a method of modifying an Adenine in a target RNA sequence of interest, comprising delivering to said target RNA: (a) a catalytically inactive (dead) Cas13 protein; (b) a guide molecule which comprises a guide sequence linked to a direct repeat sequence; and (c) an adenosine deaminase protein or catalytic domain thereof mutated to convert activity to a cytidine deaminase; wherein said adenosine deaminase protein or catalytic domain thereof is covalently or non-covalently linked to said dead Cas13 protein or said guide molecule or is adapted to link thereto after delivery; wherein said guide molecule forms a complex with said dead Cas13 protein and directs said complex to bind said target RNA sequence of interest, wherein said guide sequence is capable of hybridizing with a target sequence comprising said adenine to form an RNA duplex, wherein said guide sequence comprises a non-pairing cytosine at a position corresponding to said adenine resulting in an A-C mismatch in the RNA duplex formed; wherein said adenosine deaminase protein or catalytic domain thereof deaminates said adenine in said RNA duplex.

    [0228] In some embodiments, the adenosine deaminase is mutated at one or more positions selected from E396, C451, V351, R455, T375, K376, S486, Q488, R510, K594, R348, G593, S397, H443, L444, Y445, F442, E438, T448, A353, V355, T339, P539, V525 and I520. In some example embodiments, the adenosine deaminase is mutated at one or more positions selected from E488, V351, S486, T375, S370, P462, and N597.

    [0229] In some embodiments, the present disclosure includes an engineered, non-naturally occurring RNA editing system suitable for modifying an adenine in a target locus of interest. comprising (a) a guide molecule which comprises a guide sequence linked to a direct repeat sequence, or a nucleotide sequence encoding said guide molecule; (b) a catalytically inactive Cas13 protein, or a nucleotide sequence encoding said catalytically inactive Cas13 protein; (c) an adenosine deaminase protein or catalytic domain thereof, or a nucleotide sequence encoding said adenosine deaminase protein or catalytic domain thereof; wherein the adenosine deaminase is modified to convert activity to a cytidine deaminase; wherein said adenosine deaminase protein or catalytic domain thereof is covalently or non-covalently linked to said Cas13 protein or said guide molecule or is adapted to link thereto after delivery; wherein said guide sequence is capable of hybridizing with a target RNA sequence comprising an adenine to form an RNA duplex, wherein said guide sequence comprises a non-pairing cytosine at a position corresponding to said Adenine resulting in an A-C mismatch in the RNA duplex formed

    [0230] In some embodiments, the adenosine deaminase is modified by one or more mutations selected from E396, C451, V351, R455, T375, K376, S486, Q488, R510, K594, R348, G593, S397, H443, L444, Y445, F442, E438, T448, A353, V355, T339, P539, V525 and I520. In some embodiments, the adenosine deaminase is mutated at one or more positions selected from E488, V351, S486, T375, S370, P462, and N597.

    Prime Editing

    [0231] In one example embodiment, a method of enhancing the anti-tumor immunity of a subject in need thereof comprises administering administering a prime editing system that generates one or more variants with decreased expression or activity of B3GNT21. Like base editing systems, prime editing systems are capable of targeted modification of a polynucleotides without generating double stranded breaks. See e.g. Anzalone et al. 2019. Nature. 576: 149-157, incorporated herein by reference. Prime editing can operate via a search-and-replace methodology and can mediate targeted insertions, deletions, as well as all 12 possible base-to-base conversion and combinations thereof.

    [0232] In one example embodiment, a prime editing system comprises a Cas polypeptide having nickase activity, a reverse transcriptase, and a prime editing guide RNA (pegRNA). Cas polypeptide, and/or reverse transcriptase can be coupled together or otherwise associate with each other to form a prime editing complex and edit a target sequence. The Cas polypeptide may be any of the Cas polypeptides disclosed above. In one example embodiment, the Cas polypeptide is a Type II Cas polypeptide. In another example embodiment, the Cas polypeptide is a Cas9 nickase. In one example embodiment, the Cas polypeptide is a Type V Cas polypeptide. In another example embodiment, the Cas polypeptide is a Cas12a or Cas12b.

    [0233] The prime editing guide molecule (pegRNA) comprises a primer binding site (PBS) configured to hybridize with a portion of a nicked strand on a target polynucleotide (e.g. genomic DNA) a reverse transcriptase (RT) template comprising the edit to be inserted in the genomic DNA and a spacer sequence designed to hybridize to a target sequence at the site of the desired edit. The nicking site is dependent on the Cas polypeptide used and standard cutting preference for that Cas polypeptide relative to the PAM. Thus, based on the Cas polypeptide used, a pegRNA can be designed to direct the prime editing system to introduce a nick where the desired edit should take place. In one example embodiment, a pegRNA is configured to direct the prime editing system to convert a single base or base pair of the one or more variants associated with reduced B3GNT2 expression. In one example embodiment, a pegRNA is configured to direct the prime editing system to convert a single base or base pair of one or more variants associated with reduced B3GNT2 expression such that B3GNT2 protein activity is reduced.

    [0234] The pegRNA can be about 10 to about 200 or more nucleotides in length, such as 10 to/or 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, or 200 or more nucleotides in length. Optimization of the peg guide molecule can be accomplished as described in Anzalone et al. 2019. Nature. 576: 149-157, particularly at pg. 3, FIG. 2a-2b, and Extended Data FIGS. 5a-c

    CRISPR-Associated Transposases (CAST) Systems

    [0235] In one example embodiment, a method of enhancing the anti-tumor immunity of a subject in need thereof comprises administering a CAST system that incorporates or inserts a genomic region comprising one or more variants associated with decreased expression or activity of B3GNT2. In one example embodiment, a CAST system is used to replace all or a portion of B3GNT2 comprising one or more variants that reduce B3GNT2 expression or activity. In one example embodiment, the variant is generated using one or more of the gene editing methods described herein.

    [0236] CAST systems comprise a Cas polypeptide, a guide sequence, a transposase, and a donor construct. The transposase is linked to or otherwise capable of forming a complex with the Cas polypeptide. The donor construct comprises a donor sequence to be inserted into a target polynucleotide and one or more transposase recognition elements. The transposase is capable of binding the donor construct and excising the donor template and directing insertion of the donor template into a target site on a target polynucleotide (e.g. genomic DNA). The guide molecule is capable of forming a CRISPR-Cas complex with the Cas polypeptide, and can be programmed to direct the entire CAST complex such that the transposase is positioned to insert the donor sequence at the target site on the target polynucleotide. For multimeric transposase, only those transposases needed for recognition of the donor construct and transposition of the donor sequence into the target polypeptide may be required. The Cas may be naturally catalytically inactive or engineered to be catalyically inactive.

    [0237] In one example embodiment, the CAST system is a Tn7-like CAST system, wherein the transposase comprises one or more polypeptides from a Tn7 or Tn7-like transposase. The Cas polypeptide of the Tn7-like transposase may be a Class 1 (multimeric effector complex) or Class 2 (single protein effector) Cas polypeptide.

    [0238] In one example embodiments, the Cas polypeptide is a Class 1 Type-If Cas polypeptide. In one example embodiment, the Cas polypeptide may comprise a cas6, a cas7, and a cas8-cas5 fusion. In one example embodiments, the Tn7 transposase may comprise TnsB, TnsC, and TniQ. In another example embodiment, the Tn7 transposase may comprise TnsB, TnsC, and TnsD. In certain example embodiments, the Tn7 transposase may comprise TnsD, TnsE, or both. As used herein, the terms TnsAB, TnsAC, TnsBC, or TnsABC refer to a transponson complex comprising TnsA and TnsB, TnsA and TnsC, TnsB and TnsC, TnsA and TnsB and TnsC, respectively. In these combinations, the transposases (TnsA, TnsB, TnsC) may form complexes or fusion proteins with each other. Similarly, the term TnsABC-TniQ refer to a transposon comprising TnsA, TnsB, TnsC, and TniQ, in a form of complex or fusion protein. An example Type If-Tn7 CAST system is described in Klompe et al. Nature, 2019, 571:219-224 and Vo et al. bioRxiv, 2021, doi.org/10.1101/2021.02.11.430876, which are incorporated herein by reference.

    [0239] In one example embodiment, the Cas polypeptide is a Class 1 Type-1b Cas polypeptide. In one example embodiment, the Cas polypeptide may comprise a cas6, a cas7, and a cas8b (e.g. a ca8b3). In one example embodiments, the Tn7 transposase may comprise TnsB, TnsC, and TniQ. In another example embodiment, the Tn7 transposase may comprise TnsB, TnsC, and TnsD. In certain example embodiments, the Tn7 transposase may comprise TnsD, TnsE, or both. As used herein, the terms TnsAB, TnsAC, TnsBC, or TnsABC refer to a transponson complex comprising TnsA and TnsB, TnsA and TnsC, TnsB and TnsC, TnsA and TnsB and TnsC, respectively. In these combinations, the transposases (TnsA, TnsB, TnsC) may form complexes or fusion proteins with each other. Similarly, the term TnsABC-TniQ refer to a transposon comprising TnsA, TnsB, TnsC, and TniQ, in a form of complex or fusion protein.

    [0240] In one example embodiment, the Cas polypeptide is Class 2, Type V Cas polypeptide. In one example embodiment, the Type V Cas polypeptide is a Cas12k. In one example embodiments, the Tn7 transposase may comprise TnsB, TnsC, and TniQ. In another example embodiment, the Tn7 transposase may comprise TnsB, TnsC, and TnsD. In certain example embodiments, the Tn7 transposase may comprise TnsD, TnsE, or both. As used herein, the terms TnsAB, TnsAC, TnsBC, or TnsABC refer to a transponson complex comprising TnsA and TnsB, TnsA and TnsC, TnsB and TnsC, TnsA and TnsB and TnsC, respectively. In these combinations, the transposases (TnsA, TnsB, TnsC) may form complexes or fusion proteins with each other. Similarly, the term TnsABC-TniQ refer to a transposon comprising TnsA, TnsB, TnsC, and TniQ, in a form of complex or fusion protein. An example Cas12k-Tn7 CAST system is described in Strecker et al. Science, 2019 365:48-53, which is incorporated herein by reference.

    [0241] In one example embodiment, the CAST system is a Mu CAST system, wherein the transposase comprises one or more polypeptides of a Mu transposase. An example Mu CAST system is disclosed in WO/2021/041922 which is incorporated herein by reference.

    [0242] In one example embodiment, the CAST comprise a catalytically inactive Type II Cas polypeptide (e.g. dCas9) fused to one or more polypeptides of a Tn5 transposase. In another example embodiment, the CAST system comprises a catalytically inactive Type II Cas polypeptide (e.g. dCas9) fused to a piggyback transposase.

    Donor Polynucleotides

    [0243] The system may further comprise one or more donor polynucleotides (e.g., for insertion into the target polynucleotide). A donor polynucleotide may be an equivalent of a transposable element that can be inserted or integrated to a target site. The donor polynucleotide may be or comprise one or more components of a transposon. A donor polynucleotide may be any type of polynucleotides, including, but not limited to, a gene, a gene fragment, a non-coding polynucleotide, a regulatory polynucleotide, a synthetic polynucleotide, etc. The donor polynucleotide may include a transposon left end (LE) and transposon right end (RE). The LE and RE sequences may be endogenous sequences for the CAST used or may be heterologous sequences recognizable by the CAST used, or the LE or RE may be synthetic sequences that comprise a sequence or structure feature recognized by the CAST and sufficient to allow insertion of the donor polynucleotide into the target polynucleotides. In certain example embodiments, the LE and RE sequences are truncated. In certain example embodiments may be between 100-200 bps, between 100-190 base pairs, 100-180 base pairs, 100-170 base pairs, 100-160 base pairs, 100-150 base pairs, 100-140 base pairs, 100-130 base pairs, 100-120 base pairs, 100-110 base pairs, 20-100 base pairs, 20-90 base pairs, 20-80 base pairs, 20-70 base pairs, 20-60 base pairs, 20-50 base pairs, 20-40 base pairs, 20-30 base pairs, 50 to 100 base pairs, 60-100 base pairs, 70-100 base pairs, 80-100 base pairs, or 90-100 base pairs in length

    [0244] The donor polynucleotide may be inserted at a position upstream or downstream of a PAM on a target polynucleotide. In some embodiments, a donor polynucleotide comprises a PAM sequence. Examples of PAM sequences include TTTN, ATTN, NGTN, RGTR, VGTD, or VGTR.

    [0245] The donor polynucleotide may be inserted at a position between 10 bases and 200 bases, e.g., between 20 bases and 150 bases, between 30 bases and 100 bases, between 45 bases and 70 bases, between 45 bases and 60 bases, between 55 bases and 70 bases, between 49 bases and 56 bases or between 60 bases and 66 bases, from a PAM sequence on the target polynucleotide. In some cases, the insertion is at a position upstream of the PAM sequence. In some cases, the insertion is at a position downstream of the PAM sequence. In some cases, the insertion is at a position from 49 to 56 bases or base pairs downstream from a PAM sequence. In some cases, the insertion is at a position from 60 to 66 bases or base pairs downstream from a PAM sequence.

    [0246] The donor polynucleotide may be used for editing the target polynucleotide. In some cases, the donor polynucleotide comprises one or more mutations to be introduced into the target polynucleotide. Examples of such mutations include substitutions, deletions, insertions, or a combination thereof. The mutations may cause a shift in an open reading frame on the target polynucleotide. In some cases, the donor polynucleotide alters a stop codon in the target polynucleotide. For example, the donor polynucleotide may correct a premature stop codon. The correction may be achieved by deleting the stop codon or introduces one or more mutations to the stop codon. In other example embodiments, the donor polynucleotide addresses loss of function mutations, deletions, or translocations that may occur, for example, in certain disease contexts by inserting or restoring a functional copy of a gene, or functional fragment thereof, or a functional regulatory sequence or functional fragment of a regulatory sequence. A functional fragment refers to less than the entire copy of a gene by providing sufficient nucleotide sequence to restore the functionality of a wild type gene or non-coding regulatory sequence (e.g. sequences encoding long non-coding RNA). In certain example embodiments, the systems disclosed herein may be used to replace a single allele of a defective gene or defective fragment thereof. In another example embodiment, the systems disclosed herein may be used to replace both alleles of a defective gene or defective gene fragment. A defective gene or defective gene fragment is a gene or portion of a gene that when expressed fails to generate a functioning protein or non-coding RNA with functionality of a corresponding wild-type gene. In certain example embodiments, these defective genes may be associated with one or more disease phenotypes. In certain example embodiments, the defective gene or gene fragment is not replaced but the systems described herein are used to insert donor polynucleotides that encode gene or gene fragments that compensate for or override defective gene expression such that cell phenotypes associated with defective gene expression are eliminated or changed to a different or desired cellular phenotype.

    [0247] In certain embodiments of the invention, the donor may include, but not be limited to, genes or gene fragments, encoding proteins or RNA transcripts to be expressed, regulatory elements, repair templates, and the like. According to the invention, the donor polynucleotides may comprise left end and right end sequence elements that function with transposition components that mediate insertion.

    [0248] In certain cases, the donor polynucleotide manipulates a splicing site on the target polynucleotide. In some examples, the donor polynucleotide disrupts a splicing site. The disruption may be achieved by inserting the polynucleotide to a splicing site and/or introducing one or more mutations to the splicing site. In certain examples, the donor polynucleotide may restore a splicing site. For example, the polynucleotide may comprise a splicing site sequence.

    [0249] The donor polynucleotide to be inserted may have a size from 10 bases to 50 kb in length, e.g., from 50 to 40 kb, from 100 to 30 kb, from 100 bases to 300 bases, from 200 bases to 400 bases, from 300 bases to 500 bases, from 400 bases to 600 bases, from 500 bases to 700 bases, from 600 bases to 800 bases, from 700 bases to 900 bases, from 800 bases to 1000 bases, from 900 bases to from 1100 bases, from 1000 bases to 1200 bases, from 1100 bases to 1300 bases, from 1200 bases to 1400 bases, from 1300 bases to 1500 bases, from 1400 bases to 1600 bases, from 1500 bases to 1700 bases, from 600 bases to 1800 bases, from 1700 bases to 1900 bases, from 1800 bases to 2000 bases, from 1900 bases to 2100 bases, from 2000 bases to 2200 bases, from 2100 bases to 2300 bases, from 2200 bases to 2400 bases, from 2300 bases to 2500 bases, from 2400 bases to 2600 bases, from 2500 bases to 2700 bases, from 2600 bases to 2800 bases, from 2700 bases to 2900 bases, or from 2800 bases to 3000 bases in length.

    [0250] The components in the systems herein may comprise one or more mutations that alter their (e.g., the transposase(s)) binding affinity to the donor polynucleotide. In some examples, the mutations increase the binding affinity between the transposase(s) and the donor polynucleotide. In certain examples, the mutations decrease the binding affinity between the transposase(s) and the donor polynucleotide. The mutations may alter the activity of the Cas and/or transposase(s).

    [0251] In certain embodiments, the systems disclosed herein are capable of unidirectional insertion, that is the system inserts the donor polynucleotide in only one orientation.

    B3GNT2 Example Target Modifications

    [0252] B3GNT2-specific mutations may be introduced using the gene editing systems described above B3GNT2 structure, including human B3GNT2, has been elucidated and active site mutations reducing or eliminating polylactosamine synthesis activity have been performed (Hao, Y et al. J Biol. Chem. (2021), 296 100042; Kadirvelraj, R. et al. (2021), J. Biol. Chem. Research 296 100110). These studies evaluated the importance of specific residues in catalysis and substrate recognition and are expressly incorporated herein by reference. Prior studies by Okada, Y. et al. (2012), Reveille, J (2010) and Tsoi, L. (2012) implicated B3GNT2 as having a crucial role in immune responses involved in polylactosamine synthesis. Those studies supported the connection of B3GNT2 and immune system function in genome-wide association studies that revealed single nucleotide polymorphisms reduced expression of B3GNT2 and were associated with autoimmune diseases including rheumatoid arthritis, ankylosing spondylitis and psoriasis in different populations. Hao et al. reconstituted B3GNT2-deficient Jurkat cells with various point mutations and assessed polylactosamine levels via flow cytometry using the LEA lectin derived from Lycopersicon esculentum. CRISPR-mediated deletion of B3GNT2 in Jurkat cells resulted in a significant decrease in LEA binding relative to wildtype (WT) cells demonstrating B3GNT2 as the major N-acetylglucosaminyltransferase involved in polylactosamine biosynthesis. LEA staining in B3GNT2 KO cells could be recovered by retroviral overexpression if WT B3GNT2 but not empty GFP vector alone. In contrast, reconstitution of KO cells with point mutations within residues required for metal binding (D247A, H376Q, H376L, H376E), substrate binding (K149A, D245A, Y289F, D332A), or within the active site base (D333N) failed to restore cell surface polylactosamine levels, suggesting significantly reduced enzyme activity. Ala279 from the B5-B6 loop is less than 4 ? from the acetyl group of the GlcNAc of the acceptor substrate. A mutation of Ala279 to either Val or Leu may create steric hindrance with the GlcNAc and failed to restore LEA staining when expressed in KO cells. In comparison, expression of a A279G point mutant partially restored polylactosamine levels, although not as robustly as WT B3GNT2. Ala279 is conserved among the seven B3GNTs (B3GNT2-B3GNT8) except for B3GNT3 and B3GNT6 where it is replaced by a Val and a Ser, respectively.

    [0253] In an embodiment, a programmable nuclease is used to generate an edited B3GNT2 protein that results in a reduction in polylactosamine synthesis (i.e., reduction in B3GNT2 activity). In an embodiment, B3GNT2 is edited to contain point mutations within residues required for metal binding (D247A, H376Q, H376L, H376E), any of which fails to produce polylactosamine or restore cell surface polylactosamine levels in living cells as a consequence of significantly reduced or no B3GNT2 enzyme activity (e.g., base editing). In an embodiment, B3GNT2 is edited to contain point mutations within residues required for substrate binding (K149A, D245A, Y289F, D332A), any of which fails to produce polylactosamine or restore cell surface polylactosamine levels in living cells as a consequence of significantly reduced or no B3GNT2 enzyme activity (e.g., base editing). In an embodiment, B3GNT2 is edited to contain a point mutation within the active site base (e.g., D333N), which fails to produce polylactosamine or restore cell surface polylactosamine levels in living cells as a consequence of significantly reduced or no B3GNT2 enzyme activity (e.g., base editing). In an embodiment, B3GNT2 is edited to contain a mutation of Ala279 from the ?5-?6 loop of the B3GNT2 protein, which is less than 4 ? from the acetyl group of the GlcNAc of the acceptor substrate, to either a Val or Leu to create steric hindrance with the GlcNAc, resulting in a B3GNT2 protein which is unable to synthesize polylactosamine as a consequence of significantly reduced or no B3GNT2 enzyme activity.

    MCL1 Example Target Modifications

    [0254] MCL1 is an anti-apoptotic protein of the BCL-2 family that is essential for the survival of multiple cell lineages and that is highly amplified in human cancer. Under physiological conditions, MCL1 expression is tightly regulated at multiple levels, involving transcriptional, post-transcriptional and post-translational processes. Initial studies of MCL1 identified that its expression was growth-factor dependent in many situations, and that it was capable of protecting cells from growth factor withdrawal-induced apoptosis (Bodrug, S. E. et al. Cell Death Diff. (1995), 2(3), 173-182). Ubiquitination of MCL1, that targets it for proteasomal degradation, allows for rapid elimination of the protein and triggering of cell death, in response to various cellular events. MCL1-specific mutations may be introduced using the gene editing systems described above. BCL-2-related proteins all contain at least one of the four conserved BCL-2 homology domains (BH1-BH4), which enable protein-protein interactions between the different members of the family. Proteins of the BCL-2 family display either anti-apoptotic or pro-apoptotic functions. The members that inhibit apoptosis include Bcl-2, Bcl-XL, MCL1, (BCL2A1; Bfl-1/A1), BCL-B and BCL-W. These anti-apoptotic proteins and the pro-apoptotic effector members, such as Bax and Bak, share at least three BH domains and a similar globular structure. These two groups are thus named multi-domain proteins and they mainly reside at the mitochondria. (Moldoveanu, T. et al. Trends Biochem. Sci. (2014), 39, 101-111).

    [0255] A growing list of trophic factors has been shown to induce transcriptional upregulation of MCL1, including cytokines such as the interleukins IL-3, IL-5, IL-6, and granulocyte-macrophage colony-stimulating factor (GM-CSF), as well as growth factors such as epidermal growth factor (EGF) and vascular endothelial growth factor (VEGF). Intracellular regulation of MCL1 transcription is mediated by a number of externally activated and constitutively activated transcription factors, notably the signal transducers and activators of transcription (STAT) family. The promoter region of MCL1, characterized by Akgul et al. (Cell Mol. Life Sci. 57(4), 684-691), contains an array of putative and confirmed transcription factor binding sites, including consensus STAT response elements, cAMP response elements (CRE), and nuclear factor kappaB binding sites. Both STAT3, in response to IL-6, VEGF and IL-3, and STAT5, in response to Bcr-Abl signaling in chronic myeloid leukemia, have been shown to upregulate MCL1 transcription. It has been suggested that STAT3 activation by phosphorylation is absolutely required for MCL1-mediated macrophage survival (Liu, H. et al. Blood (2003), 102(1), 344-352). Other confirmed transcription factors known to upregulate MCL1 expression include cAMP response element binding protein, PU.1, SP1, and under hypoxic conditions, hypoxia-inducible factor 1a (Liu X. H., et al. J. Cell Biochem. (2006), 97(4), 755-765). Conversely, MCL1 may be down-regulated transcriptionally under a number of conditions, particularly under growth factor withdrawal, and on the induction of apoptosis induced by a variety of treatments, including staurosporine and UV exposure (Nijhawan, D. et al. Genes Dev. (2003), 7(12), 1475-1486). In most cases, down-regulation is mediated by inactivation of the transcription factors stimulating MCL1 transcription, but the MCL1 promoter is directly repressed by the binding of the E2F-1 transcription factor. Unlike other BCL-2-related survival proteins, MCL1 harbors a long unstructured N-terminus that appears to be involved in different post-translational modifications of MCL1 (Le Gouill, S., et al. Cell Cycle (2004), 3, 1259-1262). For example, it has been shown that, during apoptosis, MCL1 protein can be cleaved by caspases and granzyme B, at two distinct sites (Asp127 and Asp157) within the N-terminus (Han, J. et al. J. Biol. Chem. (2005), 280, 16383-16392; Herrant, M., et al. Oncogene (2004), 23, 7863-7873). Some studies reported that cleavage at these sites impairs the anti-apoptotic properties of MCL1, or even converts it into a pro-apoptotic protein (Han, J. et al. J. Biol. Chem. (2005), 280, 16383-16392; Micheals, J. et al. Oncogene (2004), 23, 4818-4827; Herrant, M., et al. Oncogene (2004), 23, 7863-7873). Cleavage of MCL1 thus appears to be a process through which apoptotic cells can inactivate residual MCL1 that could act as a brake to the achievement of cell death. The N-terminus of MCL1 contains PEST regions (Kozopas, K. M. et al., Proc. Natl. Acad. Sci. (1993), 90, 3516-3520), enriched in proline (P), glutamate (E), serine (S) and threonine (T) residues, which are common features of rapidly degraded proteins (Rechsteiner, M. et al. Trends Biochem. Sci. (1996), 21, 267-271). These regions contain the two caspase cleavage sites of MCL1 and many phosphorylation sites. Differential phosphorylation of MCL1 at specific sites has been reported to result in different outcomes. For example, the cell cycle-dependent phosphorylation of Ser64 by CDK1, CDK2 and JNK1 enhances the anti-apoptotic function of MCL1 by increasing its interaction with pro-apoptotic members of the BCL-2 family, without modifying its half-life (Kobayashi, S. et al. J. Biol. Chem. (2007), 282, 18407-18417). Two independent groups have also shown that MCL1 phosphorylation at Thr92 and Thr163, stimulated by TPA-induced ERK activation, stabilizes MCL1 in some cancer cell lines (Domina, A. M. et al. Oncogene (2004), 23, 5301-5315; Ding, Q. Cancer Res. (2008), 68, 6109-6117; Nifoussi, S. K. PloS One (2012), 7, e47060). Likewise, Ser121 and Thr163 have been found to be phosphorylated by JNK (Inoshita, S., J. Biol. Chem. (2002), 277, 43730-43734; Kodama, Y. et al., Gastroenterology 136, 1423-1434). In hepatocytes, this JNK-mediated phosphorylation stabilizes MCL1 and affords protection against TNF-induced apoptosis, whereas in endothelial cells submitted to oxidative stress, this phosphorylation reduces the anti-apoptotic effect of MCL1 (Inoshita, S., J. Biol. Chem. (2002), 277, 43730-43734; Kodama, Y. et al., Gastroenterology 136, 1423-1434). Moreover, phosphorylation of MCL1 at Ser155, Ser159 and Thr163, in a different cellular context, has been shown to favor MCL1 degradation by the ubiquitin-proteosome system (UPS).

    [0256] In an embodiment, a gene editing system as described above is used to generate an edited MCL1 gene that results in a reduction or inhibition in MCL1 expression or activity. In an embodiment, MCL1 is edited to contain mutations including point mutations, deletions and insertions within the MCL1 promoter region required for upregulation of expression by an array of putative and confirmed transcription factors, including consensus STAT response elements, cAMP response elements (CRE), and nuclear factor kappaB binding sites, which lead to a reduction or inhibition in MCL1 expression because the transcription factor(s) can no longer bind efficiently to the MCL1 promoter region. Both STAT3, in response to IL-6, VEGF and IL-3, and STAT5, in response to Ber-Abl signaling in chronic cancer (e.g. myeloid leukemia), have been shown to upregulate MCL1 transcription. It has been suggested that STAT3 activation by phosphorylation is absolutely required for MCL1-mediated macrophage survival. In an embodiment, MCL1 is edited to contain mutations including point mutations, deletions and insertions within the MCL1 promoter region that reduces or inhibits STAT3 binding which leads to a reduction or inhibition in MCL1 expression or activity. In an embodiment, editing is used to mutate one or more transcription factor genes that stimulate MCL1 transcription. In an embodiment, the MCL1 transcription factors STAT3, cAMP response element binding protein, PU.1, SP1 and hypoxia-inducible factor 1a are edited and mutated, which leads to a reduction or inhibition of MCL1 expression or activity because the above transcription factors, either alone and in any combination thereof, are inactivated.

    [0257] The MCL1 promoter is directly repressed by the binding of the E2F-1 transcription factor. In an embodiment, MCL1 expression and activity is decreased by editing and imparting mutations in the E2F-1 transcription factor whereby E2F-1 binding is increased by stabilizing the binding interaction between E2F-1 to the MCL1 promoter region, which leads to a reduction or inhibition in MCL1 expression and activity.

    [0258] As disclosed herein, MCL1 protein can be cleaved by caspases and granzyme B at two distinct sites (Asp127 and Asp157) within the N-terminus and it appears that cleavage at these sites impairs the anti-apoptotic properties of MCL1, or even converts it into a pro-apoptotic protein. Cleavage of MCL1 thus appears to be a process through which apoptotic cells can inactivate residual MCL1, which in turn could act as a brake on apoptosis. In an embodiment, MCL1 is edited to contain one or more mutations to stabilize the Asp127 and Asp157 cleavage sites such that caspases and granzyme cleave the MCL1 Asp127 and Asp157 sites more efficiently during apoptosis leading to more cancer cell death.

    [0259] As disclosed herein, the N-terminus of MCL1 contains PEST regions, which as described above are enriched in proline (P), glutamate (E), serine (S) and threonine (T) residues and are common features of rapidly degraded proteins. These regions contain the two caspase cleavage sites of MCL1 (Asp127 and Asp 157 discussed above) and many phosphorylation sites. Differential phosphorylation of MCL1 at specific sites has been reported to result in different outcomes. For example, the cell cycle-dependent phosphorylation of Ser64 by CDK1, CDK2 and JNK1 enhances the anti-apoptotic function of MCL1 by increasing its interaction with pro-apoptotic members of the BCL-2 family, without modifying its half-life. In an embodiment, MCL1 is edited at Ser64 which decreases or eliminates phosphorylation of the Ser64 residue which in turn reduces the anti-apoptotic function of MCL1 by reducing its interaction with pro-apoptotic members of the BCL-2 family. As discussed above, it has been shown that MCL1 phosphorylation at Thr92 and Thr163, stimulated by TPA-induced ERK activation, stabilizes MCL1 in some cancer cell lines. In an embodiment, MCL1 is edited at Thr92 and Thr163, which reduces phosphorylation at these two residues and leads to a reduction in MCL1 activity because the MCL1 protein is destabilized. Likewise, Ser121 and Thr163 have been found to be phosphorylated by JNK. In hepatocytes, JNK-mediated phosphorylation stabilizes MCL1 and affords protection against TNF-induced apoptosis, whereas in endothelial cells submitted to oxidative stress, this phosphorylation reduces the anti-apoptotic effect of MCL1. In an embodiment, MCL1 is edited and mutated at Ser121 and Thr163, which reduces phosphorylation at these two residues and leads to a reduction in MCL1 stabilization and affords a reduction in protection against TNF-induced apoptosis. Moreover, phosphorylation of MCL1 at Ser155, Ser159 and Thr163, in a different cellular context, has been shown to favor MCL1 degradation by the ubiquitin-proteosome system (UPS). In an embodiment, MCL1 is edited at one or more of Ser155, Ser 159 and Thr163, which increases phosphorylation at one or more of these residues and increases MCL1 degradation by the ubiquitin-proteosome system (UPS).

    BCL2A1 Example Target Modifications

    [0260] The transcription of BCL2A1 is highly regulated. It was originally identified by as a gene induced by GM-CSF and LPS, suggesting that it may be an early-response gene. Later on it was found to be inducible by tumor necrosis factor A and identified as an NF-?B target gene (Zong, W. et al. Genes Dev (1999), 13, 382-387). Simultaneously, BCL2A1 transcription was reported to be induced in response to antigen receptor stimulation. Subsequently, several reports have demonstrated the importance of BCL2A1 upregulation for B-lymphocyte survival upon CD40 signaling (Lee, H. et al. Proc. Natl. Acad. Sci. (1999), 96, 9136-9141). In addition to CD40 signaling, PI3K and ERK signaling initiated by ICAM-1 binding have been found to induce NF-?B and subsequently BCL2A1 expression. Interestingly, both hyperoxia and low levels of reactive oxygen species were described to increase BCL2A1 transcription, possibly in an NF-?B-dependent manner (Kim, H. et al. Oncogene (2005), 24, 1252-1261). In both situations, BCL2A1 exerted a pro-survival function to prevent cell death. Besides NF-?B, several other transcription factors have been implicated in BCL2A1 transcriptional regulation, including all-trans retinoic acids or retinoic X receptor agonists, the (_EX5/_KTS) isoform of WT-142 and the transcriptional enhancer Spi-1/PU.1. On the other hand, BCL2A1 transcription is repressed by the plasma cell transcription factor PRDI-BF1/Blimp-1 (Shaffer, A. et al. Immunity (2002), 17, 51-62). In addition to the transcriptional regulation, BCL2A1 is also controlled at the post-translational level. In this regard, BCL2A1 is regulated by the ubiquitin/proteasome pathway and undergoes constitutive proteasome-mediated turnover, resulting in a short half-life of the protein. However, thus far no E3-ligase for BCL2A1 has been identified. Whether the proteasomal degradation of BCL2A1 can also be controlled by certain pro- or anti-apoptotic stimuli, for example, via phosphorylation events, has not been investigated yet but may provide an extra layer of regulation. In addition to the proteasomal turnover, cleavage by m-calpain can convert BCL2A1 from an anti-into a pro-apoptotic protein (Kucharczak, J. et al. Cell Death Diff. (2005), 12, 1225-1239).

    [0261] BCL2A1 shares all four BH-domains with BCL-2. Of these, the BH1 and BH2 domains are highly conserved while the BH3 and in particular the BH4 domains have little homology with those of the cognate anti-apoptotic proteins. Similar to the other anti-apoptotic BCL-2 proteins, BCL2A1 consists of 8 a-helixes. In particular, the helixes ?4, ?5 and ?6, corresponding to the BH3, BH1 and BH2 domains, respectively, form a groove on the protein surface that is able to interact with the BH3 domain of the pro-apoptotic BCL-2 family proteins (Smits, C. et al. Structure (2008), 16, 818-829). Despite the overall structural homology, BCL2A1 differs from all the other anti-apoptotic BCL-2 family members in its C-terminal end (Herman, M. et al. FEBS Letters (2008), 582, 3590-3594). While BCL-2, BCL-XL, BCL-W and MCL1 localize predominantly to inner cellular membranes via their hydrophobic region at the C-terminal end, the C-terminal portion of BCL2A1 contains a hydrophilic stretch responsible for ubiquitination and degradation via the proteosome pathway. Interestingly among all the pro-survival family members only BCL2A1 and MCL1 show such a rapid turnover rate. The half-life of BCL2A1 and MCL1 is estimated to be as short as 30 min while the half-life of BCL-2 is estimated to be around 24 h (Herold, J. et al. J. Biol. Chem., (2006), 281, 13663-13671). Whether BCL2A1 membrane association can be equated with insertion, as reported for BCL-W, remains to be investigated. Of note, BCL2A1 may interact with all BH-123 proteins, including Bok, as well as several BH3-only proteins. In a second study using in vitro translated protein, human A1/Bfl-1 was found to co-immunoprecipitate only with Bax when its transmembrane domain was deleted (Zhang, H. et al. J. Biol. Chem. (2000), 275, 11092-11099). Other studies performed in a more physiological context, reported a strong association between both human and murine BCL2A1 and endogenous Bak but not with Bax (Simmons, M. Oncogene (2008), 27, 1421-1428). BCL2A1 with Bax or Bak reflects a preferential binding affinity that can be found also in the other pro-survival members of the family. In general, the anti-apoptotic proteins can be subdivided depending on their ability to interact strongly with either Bax or Bak. The BH3-only peptide of Bax is able to interact with high affinity with BCL-2 and BCL-W, while Bak peptide binds potently Bcl-xL, MCL1 and BCL2A1 (Willis, S. et al. Genes Dev. (2005), 19, 1294-1305; Ku, B. et al. Cell Res. (2010), 21, 627-641). BCL2A1 interacts with different affinity also to the BH3-only proteins. Competitive binding assays using BH3-peptides show that BCL2A1, similarly to MCL1, has no affinity for Bad whereas it binds very tightly to Bim, Bid and BBC3 (PUMA); while BCL-2, Bcl-xL and Bcl-w interact potently with Bad, Bmf, Bim and BBC3 (PUMA) (Chen, L. et al. Mol. Cell (2005), 17, 393-403). The specific interaction pattern of BCL2A1 is probably due to the presence of an acidic residue, glutamate 78, within the binding groove that serves as an interaction surface for the BH3-domains of the pro-apoptotic BCL-2 family members (Ottina, E. et al. Exp. Cell Res. (2012), 318, 1291-1313). In contrast, all other anti-apoptotic proteins have a hydrophobic or slightly positively charged binding groove. Moreover, BCL2A1 can be stabilized by the interaction with Bim (Herold M. et al. J. Biol. Chem. (2006), 281, 13663-13671). The ability to be stabilized by BH3-only proteins and its cytosolic localization suggest that mouse BCL2A1 might act as a first barrier against premature or faulty activation of the apoptotic machinery. However, this feature does not seem to be conserved, as human BCL2A1 can target mitochondria, although it is unclear if it could also do so in the absence of pro-apoptotic BCL-2 family proteins.

    [0262] The Bfl-1-Bim-BH3 peptide-binding pocket has similar overall properties as the corresponding groove in other BCL-2 proteins. Several hydrophobic patches line along the pocket at positions conserved in the BCL-2 proteins These hydrophobic patches interact with highly conserved residues on the amphipathic helix of BH3-only proteins. In the Bim peptide these residues are represented by Ile148, Leu152, Ile155 and Phe159. The Bim peptide makes two additional hydrophobic interactions; Trp147 of Bim stacks onto a surface patch formed by Leu52 and Cys55 of Bfl-1, and Tyr163 of Bim makes hydrophobic interactions with Phe148 and Val40 of BCL2A1(Bfl-1) (Herman, M. et al. FEBS Letters (2008), 582, 3590-3594). Since these latter residues are highly conserved in other anti-apoptotic BCL-2 proteins, this region is labeled the h5 patch. The part of the pocket lined by helix a4 and a5 has several polar interactions similar to those in other BCL-2 proteins. The most notable is the conserved Arg88 of the WGR motif in BH1, which interacts with the strictly conserved Asp157 of Bim. A characteristic feature of the Bfl-1 BH3-binding groove is the higher negative charge in its central region, contributed by Glu78 and Glu80 at the end of helix a4 (Herman, M. et al. FEBS Letters (2008), 582, 3590-3594).

    [0263] In an embodiment, a gene editing system is used to generate an edited BCL2A1 gene that results in a reduction or inhibition in BCL2A1 expression or activity. In an embodiment, BCL2A1 is edited to contain mutations including point mutations, deletions and insertions within the BCL2A1 promoter region required for upregulation of expression by an array of putative and confirmed transcription factors, in which CD40 signaling, PI3K and ERK signaling initiated by ICAM-1 binding have been found to induce NF-?B and subsequently BCL2A1 expression. Further, both hyperoxia and low levels of reactive oxygen species were described to increase BCL2A1 transcription, possibly in an NF-?B-dependent manner. In an embodiment, the promoter region involved in binding the transcription activating factor NF-kB is mutated, which leads to a reduction or inhibition in BCL2A1 expression and activity because the NF-?B transcription factor can no longer bind efficiently to the BCL2A1 promoter region. Besides NF-?B, several other transcription factors have been implicated in BCL2A1 transcriptional regulation, including all-trans retinoic acids or retinoic X receptor agonists, the (_EX5/_KTS) isoform of WT-142 and the transcriptional enhancer Spi-1/PU.1. In an embodiment, the BCL2A1 promoter region involved in binding the transcription factors trans retinoic acids or retinoic X receptor agonists, the (_EX5/_KTS) isoform of WT-142 and the transcriptional enhancer Spi-1/PU.1 is mutated which leads to a reduction or inhibition in BCL2A1 expression and activity because the transcription factors can no longer bind efficiently to the BCL2A1 promoter region. Alternatively, BCL2A1 transcription is repressed by the plasma cell transcription factor PRDI-BF1/Blimp-1. In an embodiment, the BCL2A1 promoter region involved in binding transcription factor PRDI-BF1/Blimp-1 is mutated, which leads to an increase or improvement in BLIMP-1 binding and consequently increased repression of BCL2A1 expression and activity because the transcription factor binds more efficiently to the BCL2A1 promoter region.

    [0264] As described herein, competitive binding assays using BH3-peptides show that BCL2A1, similarly to MCL1, has no affinity for Bad whereas it binds very tightly to Bim, Bid andBBC3 (PUMA); while BCL-2, Bcl-xL and Bcl-w interact potently with Bad, Bmf, Bim andBBC3 (PUMA). The specific interaction pattern of BCL2A1 is probably due to the presence of an acidic residue, glutamate 78, within the binding groove that serves as an interaction surface for the BH3-domains of the pro-apoptotic BCL-2 family members. In an embodiment, BCL2A1 protein activity is decreased by editing and imparting mutations corresponding to the acidic residue located at glutamate 78 (Glu78) in the native protein within the binding groove, which leads to a decrease in BCL2A1 activity due to a reduced binding interaction with BH3 peptide domains.

    [0265] As described herein, the Bfl-1-Bim-BH3 peptide-binding pocket has similar overall properties as the corresponding groove in other BCL-2 proteins. Several hydrophobic patches line along the pocket at positions conserved in the BCL-2 proteins. These hydrophobic patches interact with highly conserved residues on the amphipathic helix of BH3-only proteins. In the Bim peptide these residues are represented by Ile148, Leu152, Ile155 and Phe159. In an embodiment, BCL2A1 protein activity is decreased by editing and imparting substitution mutations corresponding to the hydrophobic patches that interact with one or more highly conserved residues on the amphipathic helix of BH3-only proteins for example, the Bim peptide where these residues are represented by Ile148, Leu152, Ile155 and Phe159, which leads to a decrease in BCL2A1 activity due to a reduced binding interaction with BH3 (e.g., Bim) peptide domains. The Bim peptide makes two additional hydrophobic interactions with BCL2A1. Trp147 of Bim stacks onto a surface patch formed by Leu52 and Cys55 of BCL2A1 and Tyr163 of Bim makes hydrophobic interactions with Phe148 and Val40 of BCL2A1. In an embodiment, BCL2A1 protein activity is decreased by editing and imparting mutations corresponding to one or more of the additional hydrophobic regions that interact with highly conserved residues Trp147 of Bim, Leu52 and Cys55 of BCL2A1 and Tyr163 of Bim and makes hydrophobic interactions with Phe148 and Val40, of BCL2A1 which leads to a decrease in BCL2A1 activity due to a reduced binding interaction with Bim peptide domains.

    [0266] These Phe148 and Val40 residues are highly conserved in other anti-apoptotic BCL-2 proteins. The part of the pocket lined by helix a4 and a5 has several polar interactions similar to those in other BCL-2 proteins. The most notable is the conserved Arg88 of the WGR motif in BH1, which interacts with the strictly conserved Asp157 of Bim. In an embodiment, BCL2A1 protein activity is decreased by editing and imparting substitution mutations corresponding to Arg88 of the WGR motif in BH1, which leads to a reduction in BCL2A1 activity because the polar interactions between Arg88 and Asp157 are reduced or eliminated.

    JUNB Example Target Modifications

    [0267] The product of the junB gene is a member of the AP-1 family of transcription factors that activates transcription by binding to TPA-responsive elements (TREs) within the promoters of target genes. Components of AP-1 are immediate-early genes whose expression is upregulated by a plethora of extracellular stimuli and are important in mediating cellular proliferation and differentiation. Such stimuli include the pleiotropic cytokine interleukin-6 (IL-6) which plays a role in immune and inflammatory responses and ciliary neurotrophic factor (CNTF) which enhances survival and differentiation of neurons and glia. Expression from junB promoter-CAT reporter constructs in HepG2 cells identified a region between ?196 and ?91 that can mediate response to IL-6 and CNTF and was able to confer responsiveness to a heterologous promoter. It was shown by gel retardation analysis that distinct nuclear factors induced by IL-6 specifically bind to this interleukin-6 response element (IRE) (Lutticken, C. et al. Oncogene (1995), 10(5), 985-994). This region contains both a putative ETS- and a STAT-transcription factor binding site. Further, it was shown by mutational analysis and supershift data that the IL-6 induced complex contains the transcription factor APRF/Stat3 that is both necessary and sufficient for activation. This site does not appear to bind STAT1 itself, as was shown by supershift analysis and a lack of response to IFN-gamma both at the DNA-binding and transcriptional level. Furthermore, it was demonstrated that the junB-IRE-binding activity induced by IL-6 requires tyrosine kinase activity, whereas induced transactivation of IRE-constructs additionally occurs through an H7-sensitive pathway that is p21ras-independent, implicating serine/threonine kinases in the transactivation of IRE-binding factors (Lutticken, C. et al. Oncogene (1995), 10(5), 985-994).

    [0268] JunB differs considerably from c-Jun in its ability to activate AP-1-responsive genes and induce oncogenic transformation. It has been demonstrated that the decreased ability of JunB to activate gene expression is the result of a small number of amino acid changes between its DNA-binding and dimerization motifs and the corresponding regions of c-Jun (Deng, T. et al. Genes and Dev. (1993), 7:479-490). Changes in its DNA-binding and dimerization motifs led to a 10-fold decrease in the DNA-binding activity of JunB. JunB can be converted into a c-Jun-like activator by substituting four amino acids in its DNA-binding and dimerization motifs with the corresponding c-Jun sequences. JunB can also attenuate trans-activation by c-Jun, an activity mediated by its leucine zipper. This ability depends on two glycine residues that decrease the stability of the JunB leucine zipper, resulting in decreased homodimerization and increased heterodimerization. It has been shown that small changes in primary structure, including chemically conservative changes, can result in functional divergence of two highly related transcriptional regulators.

    [0269] The role of the DNA-binding domain in JUN proteins, was investigated by generating a restriction site at the sequence surrounding codons 260 of c-Jun and 273 of JunB, which correspond to the exact amino termini of their basic regions (Vogt. P. et al. Adv. Cancer Res. (1990), 55, 1-35). The results indicated that chimeras containing amino acids 1-260 of c-Jun and the JunB DNA-binding domain, CB5, was an inefficient activator of reporter gene expression as with JunB, whereas the reverse chimera BC5, was a potent activator similar to c-Jun. A chimera containing the first 278 amino acids of c-Jun, CB6, whose basic region is derived from c-Jun, but whose leucine zipper is from JunB was two-fold less efficient than c-Jun. Hence, the JunB leucine zipper may not be as effective as the corresponding region of c-Jun. This finding was further supported by the significant increase in activity of the reverse chimera, BC6, which contains mostly JunB sequences with the exception of the leucine zipper derived from c-Jun. In comparison with wild-type JunB, BC6 was 3.5-fold more active. These results indicated that the major determinants of the differential activity of c-Jun and JunB are located in the basic region, which directly contacts DNA, and the leucine zipper, which mediates dimerization (Vinson, C et al., Science et al. (1989), 246: 911-916).

    [0270] Among the 11-amino acid differences between the two DNA-binding domains, all except two, E293G and N299G, are conservative changes. Importantly, these sequence substitutions result in the presence of two glycines within the leucine zipper of JunB. Glycine and proline residues are helix destabilizers and are discriminated against within leucine zippers (Landschulz, W. et al. Science (1988a), 240: 1759-1764). Therefore, these glycines are likely to decrease the stability of the ?-helix formed by the JunB leucine zipper. Replacement of the two glycines of JunB with the corresponding c-Jun sequences, resulted in a four-to-five-fold increase in activity. Replacement of either glycine alone resulted in a smaller increase in JunB activity. Two of the other sequence differences, I264L and S267T, between the DNA-binding domains of c-Jun and JunB, reside in the basic region. Despite the conserved nature of these changes, replacement of the JunB sequences with the corresponding c-Jun sequences (L264I/T267S), resulted in a six-to-seven-fold increase in activity. The effect of the single substitutions was smaller, with T267S being more effective than L264I. Combination of the two basic region substitutions with the two leucine zipper substitutions resulted in a 12-fold increase in JunB activity, reaching almost the same level of activity as c-Jun. To confirm the importance of the two glycine substitutions within the leucine zipper, three other positions within the JunB leucine zipper were converted to the corresponding c-Jun sequences (A292S, S295A, and A297T). Individually, none of these substitutions had any effect on JunB activity (Deng, T, et al., Genes and Dev. (1993), 7, 479-490).

    [0271] In an embodiment, a gene editing system as described above is used to generate an edited JUNB gene that results in a reduction or inhibition in JUNB expression or activity. In an embodiment, JUNB is edited to contain mutations including point mutations, deletions and insertions within the JUNB promoter region required for upregulation of expression by an array of putative and confirmed AP-1 family of transcription factors that activate transcription by binding to TPA-responsive elements (TREs) within the promoter region of JUNB. In an embodiment, the JUNB promoter region involved in binding the AP-1 family of transcription factors that activates transcription by binding to TPA-responsive elements (TREs) is mutated which leads to a reduction or inhibition in JUNB expression and activity because the binding of the transcription factors is decreased or inhibited at the JUNB promoter region.

    [0272] In an embodiment, a programmable nuclease is used to generate an edited JUNB gene in the leucine zipper basic region which leads to a reduction in JUNB activity. In an embodiment, the gene edited mutation leads to an altered protein sequence with substitutions occurring from E293G and N299G to E293P and N299G, or E293G and N299P, or E293P and N299P. Importantly, any of these sequence substitutions result in the presence of one glycine and one proline or two prolines within the leucine zipper of JunB. Glycine and proline residues are known helix destabilizers and are discriminated against within leucine zippers. In an embodiment, the edited JUNB protein containing substitutions from residues E293G and N299G to E293P and N299G lead to a reduction in JUNB activity because the mutations decrease dimerization of the JUNB proteins. In an embodiment, the edited JUNB protein containing substitutions from residues E293G and N299G to E293G and N299P lead to a reduction in JUNB activity because the mutations decrease dimerization of the JUNB proteins. In an embodiment, the edited JUNB protein containing substitutions from residues E293G and N299G to E293P and N299P lead to a reduction in JUNB activity because the mutations decrease dimerization of the JUNB protein. Replacement of the two glycines of JunB with the corresponding c-Jun sequences, resulted in a four-to-five-fold increase in activity, indicating the importance of these residues on functional activity. Two of the other sequence differences, I264L and S267T, between the DNA-binding domains of c-Jun and JunB, reside in the basic region. Despite the conserved nature of these changes, replacement of the JunB sequences with the corresponding c-Jun sequences (L264I/T267S), resulted in a six-to-seven-fold increase in activity. In an embodiment, the edited JUNB protein containing substitutions in the basic region at positions 1264 and S267 lead to a reduction in JUNB activity because the basic region amino acids 1264 and S267 have been mutated. In an embodiment, the edited JUNB protein containing substitutions in the basic region at positions 1264 and S267 lead to a reduction in JUNB activity because the basic region amino acids 1264 and S267 have been mutated by substituting to non-conserved amino acids. The effect of the single substitutions was smaller, with T267S being more effective than L264I. In an embodiment, the edited JUNB protein containing a substitution in the basic region containing a single substitution at position I264 leads to a reduction in JUNB activity because the basic region amino acid 1264 has been mutated by substituting to a non-conserved amino acid. In an embodiment, the edited JUNB protein containing a substitution in the basic region containing a single mutation at position T267 leads to a reduction in JUNB activity because the basic region amino acid T267 has been mutated by substituting to a non-conserved amino acid. Combination of the two basic region substitutions with the two leucine zipper substitutions resulted in a 12-fold increase in JunB activity, reaching almost the same level of activity as c-Jun. In an embodiment, the edited JUNB protein containing substitutions in the two basic regions lead to a significant reduction in JUNB activity because the two basic regions amino acids 1264 and T267 and E293 and N299 have been mutated by substituting to non-conserved amino acids at one or more or all of these positions. The importance of the two glycine substitutions within the leucine zipper, were determined at three other positions within the JunB leucine zipper by converting to the corresponding c-Jun sequences at positions A292S, S295A, and A297T. Individually, none of these substitutions had any effect on JunB activity, thus demonstrating the importance of the above described amino acids. (Deng, T, et al., Genes and Dev. (1993), 7, 479-490).

    Method of Enhancing Anti-Tumor Immunity by Inhibiting Poly-LacNac Synthesis

    [0273] Poly-LacNac is increased on glycoproteins on the surface of tumors to inhibit binding of certain T cell activating surface proteins, thus allowing tumors to evade an anti-tumor immune response (e.g., by overexpressing B3GNT2). Poly-LacNac consists of repeated N-acetyl-lactosamine (Gal?1-4GlcNAc).sub.n residues formed as GlcNAc residues and are attached to galactosyl termini via the enzymatic activity of ?-1,3 N-acetylglucosaminyltransferase (B3GNT family, including B3GNT2). B3GNT2 is a beta-1,3-N-acetylglucosaminyltransferase involved in poly-LacNac synthesis that has been suggested to glycosylate PD-1 in T cells and to affect T cell activation (Sun et al. 2020). In the present disclosure, B3GNT2 was shown to promote resistance through an orthogonal pathway by increasing poly-LacNac on at least 10 tumor ligands and receptors (CD276, CD70, CD58, NECTIN2, HLA-A, TNFRSF1A, IFNGR2, FAS, IFNARI, MICB). Increased poly-LacNac was confirmed using the potent inhibitors kifunensine or benzyl-ON-acetylgalactosamide (BAG). All of these ligands and receptors are N-glycosylated, whereas a subset (CD276, CD58, NECTIN2, IFNGR2, FAS, and IFNAR1) are O-glycosylated (Example 1, FIG. 12). In a prior study investigating the function of B3GNT2, it was shown that B3GNT2 knockout mice have lower polyLacNac on B and T cells, resulting in hyperactivity (Togayachi et al. 2010).

    [0274] In one example embodiments, one or more agents capable of decreasing Poly-LacNac is administered to a subject to enhance an anti-tumor immune response or an immunotherapy. In certain embodiments, the one or more therapeutics described herein are administered to a subject that has a tumor overexpressing B3GNT2 or has increased poly-LacNac on surface proteins. The present invention also provides for determining subjects that may respond to inhibition of poly-LacNac. For example, the tumor overexpresses B3GNT2 and does not overexpress another protein that allows evasion of an immune response.

    Small Molecule Inhibitors of Poly-LacNac Synthesis

    [0275] In embodiments, the present disclosure provides methods of enhancing anti-tumor immunity by inhibiting poly-N-acetyl-lactosamine (poly-LacNac) synthesis. Poly-LacNac synthesis can be inhibited by agents that block synthesis of N- or O-linked glycan extension or inhibit a-mannosidase activity. For example, tunicamycin, is a potent inhibitor of N-glycan synthesis and kefunensine inhibits human endoplasmic reticulum a-1,2-mannosidase I and Golgi Class I mannosidases IA, IB and IC with Ki values of 130 and 23 nM, respectively.

    [0276] In embodiments, poly-LacNac synthesis is inhibited by administering one or more small molecule agents selected from the group consisting of benzyl-ON-acetylgalactosamide (BAG), kifunensine (KIF), tunicamycin, 3-Azidothymidine (AZT), 2-acetamido-1,3,6-tri-O-acetyl-4-deoxy-4-fluoro-D-glucopyranose [4-F-GlcNAc], and deoxymannojirimycin (DMN).

    Conjugated Antibodies for Reduction of Poly-LacNAc on Tumor Surface

    [0277] In another embodiment, the one or more agents comprise an antibody that binds to a tumor-specific marker and is linked to an enzyme capable of cleaving poly-LacNac. The marker can be any tumor specific surface marker or a tumor antigen presented on the surface by class I HLA molecules. The conjugated antibody may be an antibody or antigen binding fragment thereof, chemically linked to one or more enzymes. In a preferred embodiment, an antibody includes a linker that enables attachment or conjugation of the enzyme to the antibody. The term antibody is used interchangeably with the term immunoglobulin herein, and includes intact antibodies, fragments of antibodies, e.g., Fab, F(ab)2 fragments, and intact antibodies and fragments that have been mutated either in their constant and/or variable region (e.g., mutations to produce chimeric, partially humanized, or fully humanized antibodies, as well as to produce antibodies with a desired trait, e.g., enhanced binding and/or reduced FcR binding). The term fragment refers to a part or portion of an antibody or antibody chain comprising fewer amino acid residues than an intact or complete antibody or antibody chain. Fragments can be obtained via chemical or enzymatic treatment of an intact or complete antibody or antibody chain. Fragments can also be obtained by recombinant means. Exemplary fragments include Fab, Fab, F(ab)2, Fabc, Fd, dAb, V.sub.HH and scFv and/or Fv fragments.

    [0278] Non-limiting tumor markers include the following: MR1 (see, e.g., Crowther, et al., 2020, Genome-wide CRISPR-Cas9 screening reveals ubiquitous T cell cancer targeting via the monomorphic MHC class I-related protein MR1, Nature Immunology volume 21, pages 178-185), B cell maturation antigen (BCMA) (see, e.g., Friedman et al., Effective Targeting of Multiple BCMA-Expressing Hematological Malignancies by Anti-BCMA CAR T Cells, Hum Gene Ther. 2018 Mar. 8; Berdeja J G, et al. Durable clinical responses in heavily pretreated patients with relapsed/refractory multiple myeloma: updated results from a multicenter study of bb2121 anti-Bcma CAR T cell therapy. Blood. 2017; 130:740; and Mouhieddine and Ghobrial, Immunotherapy in Multiple Myeloma: The Era of CAR T Cell Therapy, Hematologist, May-June 2018, Volume 15, issue 3); PSA (prostate-specific antigen); prostate-specific membrane antigen (PSMA); PSCA (Prostate stem cell antigen); Tyrosine-protein kinase transmembrane receptor ROR1; fibroblast activation protein (FAP); Tumor-associated glycoprotein 72 (TAG72); Carcinoembryonic antigen (CEA); Epithelial cell adhesion molecule (EPCAM); Mesothelin; Human Epidermal growth factor Receptor 2 (ERBB2 (Her2/neu)); Prostase; Prostatic acid phosphatase (PAP); elongation factor 2 mutant (ELF2M); Insulin-like growth factor 1 receptor (IGF-1R); gplOO; BCR-ABL (breakpoint cluster region-Abelson); tyrosinase; New York esophageal squamous cell carcinoma 1 (NY-ESO-1); K-light chain, LAGE (L antigen); MAGE (melanoma antigen); Melanoma-associated antigen 1 (MAGE-A1); MAGE A3; MAGE A6; legumain; Human papillomavirus (HPV) E6; HPV E7; prostein; survivin; PCTA1 (Galectin 8); Melan-A/MART-1; Ras mutant; TRP-1 (tyrosinase related protein 1, or gp75); Tyrosinase-related Protein 2 (TRP2); TRP-2/INT2 (TRP-2/intron 2); RAGE (renal antigen); receptor for advanced glycation end products 1 (RAGE1); Renal ubiquitous 1, 2 (RU1, RU2); intestinal carboxyl esterase (ICE); Heat shock protein 70-2 (HSP70-2) mutant; thyroid stimulating hormone receptor (TSHR); CD123; CD171; CD19; CD20; CD22; CD26; CD30; CD33; CD44v7/8 (cluster of differentiation 44, exons 7/8); CD53; CD92; CD100; CD148; CD150; CD200; CD261; CD262; CD362; CS-1 (CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24); C-type lectin-like molecule-1 (CLL-1); ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); Tn antigen (Tn Ag); Fms-Like Tyrosine Kinase 3 (FLT3); CD38; CD138; CD44v6; B7H3 (CD276); KIT (CD117); Interleukin-13 receptor subunit alpha-2 (IL-13Ra2); Interleukin 11 receptor alpha (IL-11Ra); prostate stem cell antigen (PSCA); Protease Serine 21 (PRSS21); vascular endothelial growth factor receptor 2 (VEGFR2); Lewis(Y) antigen; CD24; Platelet-derived growth factor receptor beta (PDGFR-beta); stage-specific embryonic antigen-4 (SSEA-4); Mucin 1, cell surface associated (MUC1); mucin 16 (MUC16); epidermal growth factor receptor (EGFR); epidermal growth factor receptor variant III (EGFRvIII); neural cell adhesion molecule (NCAM); carbonic anhydrase IX (CAIX); Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2); ephrin type-A receptor 2 (EphA2); Ephrin B2; Fucosyl GM1; sialyl Lewis adhesion molecule (sLe); ganglioside GM3 (aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); TGS5; high molecular weight-melanoma-associated antigen (HMWMAA); o-acetyl-GD2 ganglioside (OAcGD2); Folate receptor alpha; Folate receptor beta; tumor endothelial marker 1 (TEMI/CD248); tumor endothelial marker 7-related (TEM7R); claudin 6 (CLDN6); G protein-coupled receptor class C group 5, member D (GPRC5D); chromosome X open reading frame 61 (CXORF61); CD97; CD179a; anaplastic lymphoma kinase (ALK); Polysialic acid; placenta-specific 1 (PLAC1); hexasaccharide portion of globoH glycoceramide (GloboH); mammary gland differentiation antigen (NY-BR-1); uroplakin 2 (UPK2); Hepatitis A virus cellular receptor 1 (HAVCR1); adrenoceptor beta 3 (ADRB3); pannexin 3 (PANX3); G protein-coupled receptor 20 (GPR20); lymphocyte antigen 6 complex, locus K 9 (LY6K); Olfactory receptor 51E2 (OR51E2); TCR Gamma Alternate Reading Frame Protein (TARP); Wilms tumor protein (WT1); ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML); sperm protein 17 (SPA17); X Antigen Family, Member 1A (XAGE1); angiopoietin-binding cell surface receptor 2 (Tie 2); CT (cancer/testis (antigen)); melanoma cancer testis antigen-1 (MAD-CT-1); melanoma cancer testis antigen-2 (MAD-CT-2); Fos-related antigen 1; p53; p53 mutant; human Telomerase reverse transcriptase (hTERT); sarcoma translocation breakpoints; melanoma inhibitor of apoptosis (ML-IAP); ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene); N-Acetyl glucosaminyl-transferase V (NA17); paired box protein Pax-3 (PAX3); Androgen receptor; Cyclin B1; Cyclin D1; v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN); Ras Homolog Family Member C (RhoC); Cytochrome P450 1B1 (CYP1B1); CCCTC-Binding Factor (Zinc Finger Protein)-Like (BORIS); Squamous Cell Carcinoma Antigen Recognized By T Cells-1 or 3 (SART1, SART3); Paired box protein Pax-5 (PAX5); proacrosin binding protein sp32 (OY-TES1); lymphocyte-specific protein tyrosine kinase (LCK); A kinase anchor protein 4 (AKAP-4); synovial sarcoma, X breakpoint-1, -2, -3 or -4 (SSX1, SSX2, SSX3, SSX4); CD79a; CD79b; CD72; Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1); Fc fragment of IgA receptor (FCAR); Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2); CD300 molecule-like family member f (CD300LF); C-type lectin domain family 12 member A (CLEC12A); bone marrow stromal cell antigen 2 (BST2); EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2); lymphocyte antigen 75 (LY75); Glypican-3 (GPC3); Fc receptor-like 5 (FCRL5); mouse double minute 2 homolog (MDM2); livin; alphafetoprotein (AFP); transmembrane activator and CAML Interactor (TACI); B-cell activating factor receptor (BAFF-R); V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS); immunoglobulin lambda-like polypeptide 1 (IGLL1); 707-AP (707 alanine proline); ART-4 (adenocarcinoma antigen recognized by T4 cells); BAGE (B antigen; b-catenin/m, b-catenin/mutated); CAMEL (CTL-recognized antigen on melanoma); CAP1 (carcinoembryonic antigen peptide 1); CASP-8 (caspase-8); CDC27m (cell-division cycle 27 mutated); CDK4/m (cycline-dependent kinase 4 mutated); Cyp-B (cyclophilin B); DAM (differentiation antigen melanoma); EGP-2 (epithelial glycoprotein 2); EGP-40 (epithelial glycoprotein 40); Erbb2, 3, 4 (erythroblastic leukemia viral oncogene homolog-2, -3, 4); FBP (folate binding protein); fAchR (Fetal acetylcholine receptor); G250 (glycoprotein 250); GAGE (G antigen); GnT-V (N-acetylglucosaminyltransferase V); HAGE (helicose antigen); ULA-A (human leukocyte antigen-A); HST2 (human signet ring tumor 2); KIAA0205; KDR (kinase insert domain receptor); LDLR/FUT (low density lipid receptor/GDP L-fucose: b-D-galactosidase 2-a-L fucosyltransferase); L1CAM (L1 cell adhesion molecule); MC1R (melanocortin 1 receptor); Myosin/m (myosin mutated); MUM-1, -2, -3 (melanoma ubiquitous mutated 1, 2, 3); NA88-A (NA cDNA clone of patient M88); KG2D (Natural killer group 2, member D) ligands; oncofetal antigen (h5T4); p190 minor bcr-abl (protein of 190KD bcr-abl); Pml/RARa (promyelocytic leukaemia/retinoic acid receptor a); PRAME (preferentially expressed antigen of melanoma); SAGE (sarcoma antigen); TEL/AMLI (translocation Ets-family leukemia/acute myeloid leukemia 1); TPI/m (triosephosphate isomerase mutated); CD70; and any combination thereof.

    [0279] In certain example embodiments, the enzyme is selected from the group consisting of endo H, endo F.sub.2, endo F.sub.3, peptide:N-glycosidase F (PNGase F), endo D, O-glycosidase, endo-?-galactosidase, sialidase and O-sialoglycoprotease.

    Combination Therapy

    [0280] The present invention also provides methods comprising combination therapy. As used herein, combination therapy includes administration of a therapeutically effective amount of the one or more agents described herein in combination with administering an immunotherapy. In an embodiment, the method further comprises administering an immunotherapy in combination with the one or more agents described herein. In embodiments, the immunotherapy is adoptive cell therapy. In another embodiment, the immunotherapy is checkpoint blockade (CPB) therapy, also referred to as immune checkpoint inhibition (ICI). The therapeutic agents described herein may shift a subject from an immunotherapy nonresponder to a responder. In certain embodiments, a tumor may overexpress any of the targets after administered an immunotherapy. Thus, overexpression of a target may be determined during immunotherapy treatment and thus guide the combination therapy.

    Adoptive Cell Transfer

    [0281] In certain embodiments, the methods of enhancing an anti-tumor immune response are administered with adoptive cell transfer (ACT). As used herein, ACT, adoptive cell therapy and adoptive cell transfer may be used interchangeably. Adoptive cell therapy (ACT) can refer to the transfer of cells, most commonly immune-derived cells, back into the same patient or into a new recipient host with the goal of transferring the immunologic functionality and characteristics into the new host. If possible, use of autologous cells helps the recipient by minimizing GVHD issues. The adoptive transfer of autologous tumor infiltrating lymphocytes (TIL) (Zacharakis et al., (2018) Nat Med. 2018 June; 24(6):724-730; Besser et al., (2010) Clin. Cancer Res 16 (9) 2646-55; Dudley et al., (2002) Science 298 (5594): 850-4; and Dudley et al., (2005) Journal of Clinical Oncology 23 (10): 2346-57.) or genetically re-directed peripheral blood mononuclear cells (Johnson et al., (2009) Blood 114 (3): 535-46; and Morgan et al., (2006) Science 314(5796) 126-9) has been used to successfully treat patients with advanced solid tumors, including melanoma, metastatic breast cancer and colorectal carcinoma, as well as patients with CD19-expressing hematologic malignancies (Kalos et al., (2011) Science Translational Medicine 3 (95): 95ra73). In certain embodiments, allogenic cells immune cells are transferred (see, e.g., Ren et al., (2017) Clin Cancer Res 23 (9) 2255-2266). As described further herein, allogenic cells can be edited to reduce alloreactivity and prevent graft-versus-host disease. Thus, use of allogenic cells allows for cells to be obtained from healthy donors and prepared for use in patients as opposed to preparing autologous cells from a patient after diagnosis.

    [0282] In certain embodiments, modified T cells are used for an adoptive cell therapy. In one example embodiment, a modified T cell that expresses an enzyme capable of cleaving poly-LacNAc on its cell surface is administered. Not being bound by a theory, the T cell will be resistant to increased glycosylation on the surface of a tumor. The enzyme may be selected from the group consisting of endo H, endo F2, endo F3, peptide:N-glycosidase F (PNGase F), endo D, O-glycosidase, endo-?-galactosidase, sialidase and O-sialoglycoprotease. Any method of expressing a protein on the cell surface may be used. For example, the enzyme can be fused to a short sequence encoding a lipid modification, such as myristoyl and paloutoyl that automatically targets to the plasma membrane (MyrPalm) (see, e.g., Zacharias D A, Violin J D. Newton A C, Tsien R Y. Partitioning of lipid-modified monomeric GFPs into membrane microdomains of live cells. Science. 2002:296(5569):913-916). Alternative methods for membrane-targeting of the enzyme include other protein modifications (e g. polybasic domains or isoprenylation) or fusing the enzyme to a transmembrane protein.

    [0283] Aspects of the invention involve the adoptive transfer of immune system cells, such as T cells, specific for selected antigens, such as tumor associated antigens or tumor specific neoantigens (see, e.g., Maus et al., 2014, Adoptive Immunotherapy for Cancer or Viruses, Annual Review of Immunology, Vol. 32: 189-225; Rosenberg and Restifo, 2015, Adoptive cell transfer as personalized immunotherapy for human cancer, Science Vol. 348 no. 6230 pp. 62-68; Restifo et al., 2015, Adoptive immunotherapy for cancer: harnessing the T cell response. Nat. Rev. Immunol. 12(4): 269-281; and Jenson and Riddell, 2014, Design and implementation of adoptive therapy with chimeric antigen receptor-modified T cells. Immunol Rev. 257(1): 127-144; and Rajasagi et al., 2014, Systematic identification of personal tumor-specific neoantigens in chronic lymphocytic leukemia. Blood. 2014 Jul. 17; 124(3):453-62).

    [0284] In certain embodiments, an antigen (such as a tumor antigen) to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) may be selected from a group consisting of: MR1 (see, e.g., Crowther, et al., 2020, Genome-wide CRISPR-Cas9 screening reveals ubiquitous T cell cancer targeting via the monomorphic MHC class I-related protein MR1, Nature Immunology volume 21, pages 178-185), B cell maturation antigen (BCMA) (see, e.g., Friedman et al., Effective Targeting of Multiple BCMA-Expressing Hematological Malignancies by Anti-BCMA CAR T Cells, Hum Gene Ther. 2018 Mar. 8; Berdeja J G, et al. Durable clinical responses in heavily pretreated patients with relapsed/refractory multiple myeloma: updated results from a multicenter study of bb2121 anti-Bcma CAR T cell therapy. Blood. 2017; 130:740; and Mouhieddine and Ghobrial, Immunotherapy in Multiple Myeloma: The Era of CAR T Cell Therapy, Hematologist, May-June 2018, Volume 15, issue 3); PSA (prostate-specific antigen); prostate-specific membrane antigen (PSMA); PSCA (Prostate stem cell antigen); Tyrosine-protein kinase transmembrane receptor ROR1; fibroblast activation protein (FAP); Tumor-associated glycoprotein 72 (TAG72); Carcinoembryonic antigen (CEA); Epithelial cell adhesion molecule (EPCAM); Mesothelin; Human Epidermal growth factor Receptor 2 (ERBB2 (Her2/neu)); Prostase; Prostatic acid phosphatase (PAP); elongation factor 2 mutant (ELF2M); Insulin-like growth factor 1 receptor (IGF-1R); gplOO; BCR-ABL (breakpoint cluster region-Abelson); tyrosinase; New York esophageal squamous cell carcinoma 1 (NY-ESO-1); K-light chain, LAGE (L antigen); MAGE (melanoma antigen); Melanoma-associated antigen 1 (MAGE-A1); MAGE A3; MAGE A6; legumain; Human papillomavirus (HPV) E6; HPV E7; prostein; survivin; PCTA1 (Galectin 8); Melan-A/MART-1; Ras mutant; TRP-1 (tyrosinase related protein 1, or gp75); Tyrosinase-related Protein 2 (TRP2); TRP-2/INT2 (TRP-2/intron 2); RAGE (renal antigen); receptor for advanced glycation end products 1 (RAGE1); Renal ubiquitous 1, 2 (RU1, RU2); intestinal carboxyl esterase (ICE); Heat shock protein 70-2 (HSP70-2) mutant; thyroid stimulating hormone receptor (TSHR); CD123; CD171; CD19; CD20; CD22; CD26; CD30; CD33; CD44v7/8 (cluster of differentiation 44, exons 7/8); CD53; CD92; CD100; CD148; CD150; CD200; CD261; CD262; CD362; CS-1 (CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24); C-type lectin-like molecule-1 (CLL-1); ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); Tn antigen (Tn Ag); Fms-Like Tyrosine Kinase 3 (FLT3); CD38; CD138; CD44v6; B7H3 (CD276); KIT (CD117); Interleukin-13 receptor subunit alpha-2 (IL-13Ra2); Interleukin 11 receptor alpha (IL-11Ra); prostate stem cell antigen (PSCA); Protease Serine 21 (PRSS21); vascular endothelial growth factor receptor 2 (VEGFR2); Lewis(Y) antigen; CD24; Platelet-derived growth factor receptor beta (PDGFR-beta); stage-specific embryonic antigen-4 (SSEA-4); Mucin 1, cell surface associated (MUC1); mucin 16 (MUC16); epidermal growth factor receptor (EGFR); epidermal growth factor receptor variant III (EGFRvIII); neural cell adhesion molecule (NCAM); carbonic anhydrase IX (CAIX); Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2); ephrin type-A receptor 2 (EphA2); Ephrin B2; Fucosyl GM1; sialyl Lewis adhesion molecule (sLe); ganglioside GM3 (aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); TGS5; high molecular weight-melanoma-associated antigen (HMWMAA); o-acetyl-GD2 ganglioside (OAcGD2); Folate receptor alpha; Folate receptor beta; tumor endothelial marker 1 (TEMI/CD248); tumor endothelial marker 7-related (TEM7R); claudin 6 (CLDN6); G protein-coupled receptor class C group 5, member D (GPRC5D); chromosome X open reading frame 61 (CXORF61); CD97; CD179a; anaplastic lymphoma kinase (ALK); Polysialic acid; placenta-specific 1 (PLAC1); hexasaccharide portion of globoH glycoceramide (GloboH); mammary gland differentiation antigen (NY-BR-1); uroplakin 2 (UPK2); Hepatitis A virus cellular receptor 1 (HAVCR1); adrenoceptor beta 3 (ADRB3); pannexin 3 (PANX3); G protein-coupled receptor 20 (GPR20); lymphocyte antigen 6 complex, locus K 9 (LY6K); Olfactory receptor 51E2 (OR51E2); TCR Gamma Alternate Reading Frame Protein (TARP); Wilms tumor protein (WT1); ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML); sperm protein 17 (SPA17); X Antigen Family, Member 1A (XAGE1); angiopoietin-binding cell surface receptor 2 (Tie 2); CT (cancer/testis (antigen)); melanoma cancer testis antigen-1 (MAD-CT-1); melanoma cancer testis antigen-2 (MAD-CT-2); Fos-related antigen 1; p53; p53 mutant; human Telomerase reverse transcriptase (hTERT); sarcoma translocation breakpoints; melanoma inhibitor of apoptosis (ML-IAP); ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene); N-Acetyl glucosaminyl-transferase V (NA17); paired box protein Pax-3 (PAX3); Androgen receptor; Cyclin B1; Cyclin D1; v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN); Ras Homolog Family Member C (RhoC); Cytochrome P450 1B1 (CYP1B1); CCCTC-Binding Factor (Zinc Finger Protein)-Like (BORIS); Squamous Cell Carcinoma Antigen Recognized By T Cells-1 or 3 (SART1, SART3); Paired box protein Pax-5 (PAX5); proacrosin binding protein sp32 (OY-TES1); lymphocyte-specific protein tyrosine kinase (LCK); A kinase anchor protein 4 (AKAP-4); synovial sarcoma, X breakpoint-1, -2, -3 or -4 (SSX1, SSX2, SSX3, SSX4); CD79a; CD79b; CD72; Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1); Fc fragment of IgA receptor (FCAR); Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2); CD300 molecule-like family member f (CD300LF); C-type lectin domain family 12 member A (CLEC12A); bone marrow stromal cell antigen 2 (BST2); EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2); lymphocyte antigen 75 (LY75); Glypican-3 (GPC3); Fc receptor-like 5 (FCRL5); mouse double minute 2 homolog (MDM2); livin; alphafetoprotein (AFP); transmembrane activator and CAML Interactor (TACI); B-cell activating factor receptor (BAFF-R); V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS); immunoglobulin lambda-like polypeptide 1 (IGLL1); 707-AP (707 alanine proline); ART-4 (adenocarcinoma antigen recognized by T4 cells); BAGE (B antigen; b-catenin/m, b-catenin/mutated); CAMEL (CTL-recognized antigen on melanoma); CAP1 (carcinoembryonic antigen peptide 1); CASP-8 (caspase-8); CDC27m (cell-division cycle 27 mutated); CDK4/m (cycline-dependent kinase 4 mutated); Cyp-B (cyclophilin B); DAM (differentiation antigen melanoma); EGP-2 (epithelial glycoprotein 2); EGP-40 (epithelial glycoprotein 40); Erbb2, 3, 4 (erythroblastic leukemia viral oncogene homolog-2, -3, 4); FBP (folate binding protein); fAchR (Fetal acetylcholine receptor); G250 (glycoprotein 250); GAGE (G antigen); GnT-V (N-acetylglucosaminyltransferase V); HAGE (helicose antigen); ULA-A (human leukocyte antigen-A); HST2 (human signet ring tumor 2); KIAA0205; KDR (kinase insert domain receptor); LDLR/FUT (low density lipid receptor/GDP L-fucose: b-D-galactosidase 2-a-L fucosyltransferase); L1CAM (L1 cell adhesion molecule); MC1R (melanocortin 1 receptor); Myosin/m (myosin mutated); MUM-1, -2, -3 (melanoma ubiquitous mutated 1, 2, 3); NA88-A (NA cDNA clone of patient M88); KG2D (Natural killer group 2, member D) ligands; oncofetal antigen (h5T4); p190 minor bcr-abl (protein of 190KD bcr-abl); Pml/RARa (promyelocytic leukaemia/retinoic acid receptor a); PRAME (preferentially expressed antigen of melanoma); SAGE (sarcoma antigen); TEL/AML 1 (translocation Ets-family leukemia/acute myeloid leukemia 1); TPI/m (triosephosphate isomerase mutated); CD70; and any combination thereof.

    [0285] In certain embodiments, an antigen to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) is a tumor-specific antigen (TSA).

    [0286] In certain embodiments, an antigen to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) is a neoantigen.

    [0287] In certain embodiments, an antigen to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) is a tumor-associated antigen (TAA).

    [0288] In certain embodiments, an antigen to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) is a universal tumor antigen. In certain preferred embodiments, the universal tumor antigen is selected from the group consisting of: a human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B 1 (CYP1B), HER2/neu, Wilms' tumor gene 1 (WT1), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate-specific membrane antigen (PSMA), p53, cyclin (D1), and any combinations thereof.

    [0289] In certain embodiments, an antigen (such as a tumor antigen) to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) may be selected from a group consisting of: CD19, BCMA, CD70, CLL-1, MAGE A3, MAGE A6, HPV E6, HPV E7, WT1, CD22, CD171, ROR1, MUC16, and SSX2. In certain preferred embodiments, the antigen may be CD19. For example, CD19 may be targeted in hematologic malignancies, such as in lymphomas, more particularly in B-cell lymphomas, such as without limitation in diffuse large B-cell lymphoma, primary mediastinal b-cell lymphoma, transformed follicular lymphoma, marginal zone lymphoma, mantle cell lymphoma, acute lymphoblastic leukemia including adult and pediatric ALL, non-Hodgkin lymphoma, indolent non-Hodgkin lymphoma, or chronic lymphocytic leukemia. For example, BCMA may be targeted in multiple myeloma or plasma cell leukemia (see, e.g., 2018 American Association for Cancer Research (AACR) Annual meeting Poster: Allogeneic Chimeric Antigen Receptor T Cells Targeting B Cell Maturation Antigen). For example, CLL1 may be targeted in acute myeloid leukemia. For example, MAGE A3, MAGE A6, SSX2, and/or KRAS may be targeted in solid tumors. For example, HPV E6 and/or HPV E7 may be targeted in cervical cancer or head and neck cancer. For example, WT1 may be targeted in acute myeloid leukemia (AML), myelodysplastic syndromes (MDS), chronic myeloid leukemia (CML), non-small cell lung cancer, breast, pancreatic, ovarian or colorectal cancers, or mesothelioma. For example, CD22 may be targeted in B cell malignancies, including non-Hodgkin lymphoma, diffuse large B-cell lymphoma, or acute lymphoblastic leukemia. For example, CD171 may be targeted in neuroblastoma, glioblastoma, or lung, pancreatic, or ovarian cancers. For example, ROR1 may be targeted in ROR1+ malignancies, including non-small cell lung cancer, triple negative breast cancer, pancreatic cancer, prostate cancer, ALL, chronic lymphocytic leukemia, or mantle cell lymphoma. For example, MUC16 may be targeted in MUC16ecto+epithelial ovarian, fallopian tube or primary peritoneal cancer. For example, CD70 may be targeted in both hematologic malignancies as well as in solid cancers such as renal cell carcinoma (RCC), gliomas (e.g., GBM), and head and neck cancers (HNSCC). CD70 is expressed in both hematologic malignancies as well as in solid cancers, while its expression in normal tissues is restricted to a subset of lymphoid cell types (see, e.g., 2018 American Association for Cancer Research (AACR) Annual meeting Poster: Allogeneic CRISPR Engineered Anti-CD70 CAR-T Cells Demonstrate Potent Preclinical Activity Against Both Solid and Hematological Cancer Cells).

    [0290] Various strategies may for example be employed to genetically modify T cells by altering the specificity of the T cell receptor (TCR) for example by introducing new TCR a and B chains with selected peptide specificity (see U.S. Pat. No. 8,697,854; PCT Patent Publications: WO2003020763, WO2004033685, WO2004044004, WO2005114215, WO2006000830, WO2008038002, WO2008039818, WO2004074322, WO2005113595, WO2006125962, WO2013166321, WO2013039889, WO2014018863, WO2014083173; U.S. Pat. No. 8,088,379).

    [0291] As an alternative to, or addition to, TCR modifications, chimeric antigen receptors (CARs) may be used in order to generate immunoresponsive cells, such as T cells, specific for selected targets, such as malignant cells, with a wide variety of receptor chimera constructs having been described (see U.S. Pat. Nos. 5,843,728; 5,851,828; 5,912,170; 6,004,811; 6,284,240; 6,392,013; 6,410,014; 6,753,162; 8,211,422; and, PCT Publication WO9215322).

    [0292] In general, CARs are comprised of an extracellular domain, a transmembrane domain, and an intracellular domain, wherein the extracellular domain comprises an antigen-binding domain that is specific for a predetermined target. While the antigen-binding domain of a CAR is often an antibody or antibody fragment (e.g., a single chain variable fragment, scFv), the binding domain is not particularly limited so long as it results in specific recognition of a target. For example, in some embodiments, the antigen-binding domain may comprise a receptor, such that the CAR is capable of binding to the ligand of the receptor. Alternatively, the antigen-binding domain may comprise a ligand, such that the CAR is capable of binding the endogenous receptor of that ligand.

    [0293] The antigen-binding domain of a CAR is generally separated from the transmembrane domain by a hinge or spacer. The spacer is also not particularly limited, and it is designed to provide the CAR with flexibility. For example, a spacer domain may comprise a portion of a human Fc domain, including a portion of the CH3 domain, or the hinge region of any immunoglobulin, such as IgA, IgD, IgE, IgG, or IgM, or variants thereof. Furthermore, the hinge region may be modified so as to prevent off-target binding by FcRs or other potential interfering objects. For example, the hinge may comprise an IgG4 Fc domain with or without a S228P, L235E, and/or N297Q mutation (according to Kabat numbering) in order to decrease binding to FcRs. Additional spacers/hinges include, but are not limited to, CD4, CD8, and CD28 hinge regions.

    [0294] The transmembrane domain of a CAR may be derived either from a natural or from a synthetic source. Where the source is natural, the domain may be derived from any membrane bound or transmembrane protein. Transmembrane regions of particular use in this disclosure may be derived from CD8, CD28, CD3, CD45, CD4, CD5, CDS, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154, TCR. Alternatively, the transmembrane domain may be synthetic, in which case it will comprise predominantly hydrophobic residues such as leucine and valine. Preferably a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain. Optionally, a short oligo- or polypeptide linker, preferably between 2 and 10 amino acids in length may form the linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR. A glycine-serine doublet provides a particularly suitable linker.

    [0295] Alternative CAR constructs may be characterized as belonging to successive generations. First-generation CARs typically consist of a single-chain variable fragment of an antibody specific for an antigen, for example comprising a VL linked to a VH of a specific antibody, linked by a flexible linker, for example by a CD8? hinge domain and a CD8? transmembrane domain, to the transmembrane and intracellular signaling domains of either CD3? or FcR? (scFv-CD33 or scFv-FcR?; see U.S. Pat. Nos. 7,741,465; 5,912,172; 5,906,936). Second-generation CARs incorporate the intracellular domains of one or more costimulatory molecules, such as CD28, OX40 (CD134), or 4-1BB (CD137) within the endodomain (for example scFv-CD28/OX40/4-1BB-CD3?; see U.S. Pat. Nos. 8,911,993; 8,916,381; 8,975,071; 9,101,584; 9,102,760; 9,102,761). Third-generation CARs include a combination of costimulatory endodomains, such a CD3g-chain, CD97, GDI 1a-CD18, CD2, ICOS, CD27, CD154, CDS, OX40, 4-1BB, CD2, CD7, LIGHT, LFA-1, NKG2C, B7-H3, CD30, CD40, PD-1, or CD28 signaling domains (for example scFv-CD28-4-1BB-CD3? or scFv-CD28-OX40-CD3?; see U.S. Pat. Nos. 8,906,682; 8,399,645; 5,686,281; PCT Publication No. WO2014134165; PCT Publication No. WO2012079000). In certain embodiments, the primary signaling domain comprises a functional signaling domain of a protein selected from the group consisting of CD3 zeta, CD3 gamma, CD3 delta, CD3 epsilon, common FcR gamma (FCERIG), FcR beta (Fc Epsilon R1b), CD79a, CD79b, Fc gamma RIIa, DAP10, and DAP12. In certain preferred embodiments, the primary signaling domain comprises a functional signaling domain of CD3? or FcR?. In certain embodiments, the one or more costimulatory signaling domains comprise a functional signaling domain of a protein selected, each independently, from the group consisting of: CD27, CD28, 4-1BB (CD137), OX40, CD30, CD40, PD-1, ICOS, lymphocyte function-associated antigen-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, B7-H3, a ligand that specifically binds with CD83, CDS, ICAM-1, GITR, BAFFR, HVEM (LIGHTR), SLAMF7, NKp80 (KLRF1), CD160, CD19, CD4, CD8 alpha, CD8 beta, IL2R beta, IL2R gamma, IL7R alpha, ITGA4, VLA1, CD49a, ITGA4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, ITGB7, TNFR2, TRANCE/RANKL, DNAM1 (CD226), SLAMF4 (CD244, 2B4), CD84, CD96 (Tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTB-A, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, LAT, GADS, SLP-76, PAG/Cbp, NKp44, NKp30, NKp46, and NKG2D. In certain embodiments, the one or more costimulatory signaling domains comprise a functional signaling domain of a protein selected, each independently, from the group consisting of: 4-1BB, CD27, and CD28. In certain embodiments, a chimeric antigen receptor may have the design as described in U.S. Pat. No. 7,446,190, comprising an intracellular domain of CD3 chain (such as amino acid residues 52-163 of the human CD3 zeta chain, as shown in SEQ ID NO: 14 of U.S. Pat. No. 7,446,190), a signaling region from CD28 and an antigen-binding element (or portion or domain; such as scFv). The CD28 portion, when between the zeta chain portion and the antigen-binding element, may suitably include the transmembrane and signaling domains of CD28 (such as amino acid residues 114-220 of SEQ ID NO: 10, full sequence shown in SEQ ID NO: 6 of U.S. Pat. No. 7,446,190; these can include the following portion of CD28 as set forth in Genbank identifier NM 006139 (sequence version 1, 2 or 3): IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVT VAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS)) (SEQ ID NO: 18). Alternatively, when the zeta sequence lies between the CD28 sequence and the antigen-binding element, intracellular domain of CD28 can be used alone (such as amino sequence set forth in SEQ ID NO: 9 of U.S. Pat. No. 7,446,190). Hence, certain embodiments employ a CAR comprising (a) a zeta chain portion comprising the intracellular domain of human CD3? chain, (b) a costimulatory signaling region, and (c) an antigen-binding element (or portion or domain), wherein the costimulatory signaling region comprises the amino acid sequence encoded by SEQ ID NO: 6 of U.S. Pat. No. 7,446,190.

    [0296] Alternatively, co-stimulation may be orchestrated by expressing CARs in antigen-specific T cells, chosen so as to be activated and expanded following engagement of their native ??TCR, for example by antigen on professional antigen-presenting cells, with attendant co-stimulation. In addition, additional engineered receptors may be provided on the immunoresponsive cells, for example to improve targeting of a T-cell attack and/or minimize side effects

    [0297] By means of an example and without limitation, Kochenderfer et al., (2009) J Immunother. 32 (7): 689-702 described anti-CD19 chimeric antigen receptors (CAR). FMC63-28Z CAR contained a single chain variable region moiety (scFv) recognizing CD19 derived from the FMC63 mouse hybridoma (described in Nicholson et al., (1997) Molecular Immunology 34: 1157-1165), a portion of the human CD28 molecule, and the intracellular component of the human TCR-(molecule. FMC63-CD828BBZ CAR contained the FMC63 scFv, the hinge and transmembrane regions of the CD8 molecule, the cytoplasmic portions of CD28 and 4-1BB, and the cytoplasmic component of the TCR-(molecule. The exact sequence of the CD28 molecule included in the FMC63-28Z CAR corresponded to Genbank identifier NM_006139; the sequence included all amino acids starting with the amino acid sequence IEVMYPPPY (SEQ ID NO: 19) and continuing all the way to the carboxy-terminus of the protein. To encode the anti-CD19 scFv component of the vector, the authors designed a DNA sequence which was based on a portion of a previously published CAR (Cooper et al., (2003) Blood 101: 1637-1644). This sequence encoded the following components in frame from the 5 end to the 3 end: an XhoI site, the human granulocyte-macrophage colony-stimulating factor (GM-CSF) receptor ?-chain signal sequence, the FMC63 light chain variable region (as in Nicholson et al., supra), a linker peptide (as in Cooper et al., supra), the FMC63 heavy chain variable region (as in Nicholson et al., supra), and a NotI site. A plasmid encoding this sequence was digested with XhoI and NotI. To form the MSGV-FMC63-28Z retroviral vector, the XhoI and NotI-digested fragment encoding the FMC63 scFv was ligated into a second XhoI and NotI-digested fragment that encoded the MSGV retroviral backbone (as in Hughes et al., (2005) Human Gene Therapy 16: 457-472) as well as part of the extracellular portion of human CD28, the entire transmembrane and cytoplasmic portion of human CD28, and the cytoplasmic portion of the human TCR-? molecule (as in Maher et al., 2002) Nature Biotechnology 20: 70-75). The FMC63-28Z CAR is included in the KTE-C19 (axicabtagene ciloleucel) anti-CD19 CAR-T therapy product in development by Kite Pharma, Inc. for the treatment of inter alia patients with relapsed/refractory aggressive B-cell non-Hodgkin lymphoma (NHL). Accordingly, in certain embodiments, cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may express the FMC63-28Z CAR as described by Kochenderfer et al. (supra). Hence, in certain embodiments, cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may comprise a CAR comprising an extracellular antigen-binding element (or portion or domain; such as scFv) that specifically binds to an antigen, an intracellular signaling domain comprising an intracellular domain of a CD3? chain, and a costimulatory signaling region comprising a signaling domain of CD28. Preferably, the CD28 amino acid sequence is as set forth in Genbank identifier NM_006139 (sequence version 1, 2 or 3) starting with the amino acid sequence IEVMYPPPY (SEQ ID NO: 19) and continuing all the way to the carboxy-terminus of the protein. The sequence is reproduced herein: IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACY SLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 18). Preferably, the antigen is CD19, more preferably the antigen-binding element is an anti-CD19 scFv, even more preferably the anti-CD19 scFv as described by Kochenderfer et al. (supra).

    [0298] Additional anti-CD19 CARs are further described in WO2015187528. More particularly Example 1 and Table 1 of WO2015187528, incorporated by reference herein, demonstrate the generation of anti-CD19 CARs based on a fully human anti-CD19 monoclonal antibody (47G4, as described in US20100104509) and murine anti-CD19 monoclonal antibody (as described in Nicholson et al. and explained above). Various combinations of a signal sequence (human CD8-alpha or GM-CSF receptor), extracellular and transmembrane regions (human CD8-alpha) and intracellular T-cell signaling domains (CD28-CD32; 4-1BB-CD3?; CD27-CD3?; CD28-CD27-CD3?, 4-1BB-CD27-CD3?; CD27-4-1BB-CD3?; CD28-CD27-Fc?R1 gamma chain; or CD28-Fc?RI gamma chain) were disclosed. Hence, in certain embodiments, cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may comprise a CAR comprising an extracellular antigen-binding element that specifically binds to an antigen, an extracellular and transmembrane region as set forth in Table 1 of WO2015187528 and an intracellular T-cell signaling domain as set forth in Table 1 of WO2015187528. Preferably, the antigen is CD19, more preferably the antigen-binding element is an anti-CD19 scFv, even more preferably the mouse or human anti-CD19 scFv as described in Example 1 of WO2015187528. In certain embodiments, the CAR comprises, consists essentially of or consists of an amino acid sequence of SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11, SEQ ID NO: 12, or SEQ ID NO: 13 as set forth in Table 1 of WO2015187528.

    [0299] By means of an example and without limitation, chimeric antigen receptor that recognizes the CD70 antigen is described in WO2012058460A2 (see also, Park et al., CD70 as a target for chimeric antigen receptor T cells in head and neck squamous cell carcinoma, Oral Oncol. 2018 March; 78:145-150; and Jin et al., CD70, a novel target of CAR T-cell therapy for gliomas, Neuro Oncol. 2018 Jan. 10; 20(1):55-65). CD70 is expressed by diffuse large B-cell and follicular lymphoma and also by the malignant cells of Hodgkins lymphoma, Waldenstrom's macroglobulinemia and multiple myeloma, and by HTLV-1- and EBV-associated malignancies. (Agathanggelou et al. Am. J. Pathol. 1995; 147: 1152-1160; Hunter et al., Blood 2004; 104:4881. 26; Lens et al., J Immunol. 2005; 174:6212-6219; Baba et al., J Virol. 2008; 82:3843-3852.) In addition, CD70 is expressed by non-hematological malignancies such as renal cell carcinoma and glioblastoma. (Junker et al., J Urol. 2005; 173:2150-2153; Chahlavi et al., Cancer Res 2005; 65:5428-5438) Physiologically, CD70 expression is transient and restricted to a subset of highly activated T, B, and dendritic cells.

    [0300] By means of an example and without limitation, chimeric antigen receptor that recognizes BCMA has been described (see, e.g., US20160046724A1; WO2016014789A2; WO2017211900A1; WO2015158671A1; US20180085444A1; WO2018028647A1; US20170283504A1; and WO2013154760A1).

    [0301] In certain embodiments, the immune cell may, in addition to a CAR or exogenous TCR as described herein, further comprise a chimeric inhibitory receptor (inhibitory CAR) that specifically binds to a second target antigen and is capable of inducing an inhibitory or immunosuppressive or repressive signal to the cell upon recognition of the second target antigen. In certain embodiments, the chimeric inhibitory receptor comprises an extracellular antigen-binding element (or portion or domain) configured to specifically bind to a target antigen, a transmembrane domain, and an intracellular immunosuppressive or repressive signaling domain. In certain embodiments, the second target antigen is an antigen that is not expressed on the surface of a cancer cell or infected cell or the expression of which is downregulated on a cancer cell or an infected cell. In certain embodiments, the second target antigen is an MHC-class I molecule. In certain embodiments, the intracellular signaling domain comprises a functional signaling portion of an immune checkpoint molecule, such as for example PD-1 or CTLA4. Advantageously, the inclusion of such inhibitory CAR reduces the chance of the engineered immune cells attacking non-target (e.g., non-cancer) tissues.

    [0302] Alternatively, T-cells expressing CARs may be further modified to reduce or eliminate expression of endogenous TCRs in order to reduce off-target effects. Reduction or elimination of endogenous TCRs can reduce off-target effects and increase the effectiveness of the T cells (U.S. Pat. No. 9,181,527). T cells stably lacking expression of a functional TCR may be produced using a variety of approaches. T cells internalize, sort, and degrade the entire T cell receptor as a complex, with a half-life of about 10 hours in resting T cells and 3 hours in stimulated T cells (von Essen, M. et al. 2004. J. Immunol. 173:384-393). Proper functioning of the TCR complex requires the proper stoichiometric ratio of the proteins that compose the TCR complex. TCR function also requires two functioning TCR zeta proteins with ITAM motifs. The activation of the TCR upon engagement of its MHC-peptide ligand requires the engagement of several TCRs on the same T cell, which all must signal properly. Thus, if a TCR complex is destabilized with proteins that do not associate properly or cannot signal optimally, the T cell will not become activated sufficiently to begin a cellular response.

    [0303] Accordingly, in some embodiments, TCR expression may eliminated using RNA interference (e.g., shRNA, siRNA, miRNA, etc.), CRISPR, or other methods that target the nucleic acids encoding specific TCRs (e.g., TCR-a and TCR-B) and/or CD3 chains in primary T cells. By blocking expression of one or more of these proteins, the T cell will no longer produce one or more of the key components of the TCR complex, thereby destabilizing the TCR complex and preventing cell surface expression of a functional TCR.

    [0304] In some instances, CAR may also comprise a switch mechanism for controlling expression and/or activation of the CAR. For example, a CAR may comprise an extracellular, transmembrane, and intracellular domain, in which the extracellular domain comprises a target-specific binding element that comprises a label, binding domain, or tag that is specific for a molecule other than the target antigen that is expressed on or by a target cell. In such embodiments, the specificity of the CAR is provided by a second construct that comprises a target antigen binding domain (e.g., an scFv or a bispecific antibody that is specific for both the target antigen and the label or tag on the CAR) and a domain that is recognized by or binds to the label, binding domain, or tag on the CAR. See, e.g., WO 2013/044225, WO 2016/000304, WO 2015/057834, WO 2015/057852, WO 2016/070061, U.S. Pat. No. 9,233,125, US 2016/0129109. In this way, a T-cell that expresses the CAR can be administered to a subject, but the CAR cannot bind its target antigen until the second composition comprising an antigen-specific binding domain is administered.

    [0305] Alternative switch mechanisms include CARs that require multimerization in order to activate their signaling function (see, e.g., US 2015/0368342, US 2016/0175359, US 2015/0368360) and/or an exogenous signal, such as a small molecule drug (US 2016/0166613, Yung et al., Science, 2015), in order to elicit a T-cell response. Some CARs may also comprise a suicide switch to induce cell death of the CAR T-cells following treatment (Buddee et al., PLOS One, 2013) or to downregulate expression of the CAR following binding to the target antigen (WO 2016/011210).

    [0306] Alternative techniques may be used to transform target immunoresponsive cells, such as protoplast fusion, lipofection, transfection or electroporation. A wide variety of vectors may be used, such as retroviral vectors, lentiviral vectors, adenoviral vectors, adeno-associated viral vectors, plasmids or transposons, such as a Sleeping Beauty transposon (see U.S. Pat. Nos. 6,489,458; 7,148,203; 7,160,682; 7,985,739; 8,227,432), may be used to introduce CARs, for example using 2nd generation antigen-specific CARs signaling through CD3 and either CD28 or CD137. Viral vectors may for example include vectors based on HIV, SV40, EBV, HSV or BPV. In certain embodiments, inducible gene switches are used to regulate expression of a CAR or TCR (see, e.g., Chakravarti, Deboki et al. Inducible Gene Switches with Memory in Human T Cells for Cellular Immunotherapy. ACS synthetic biology vol. 8, 8 (2019): 1744-1754).

    [0307] Cells that are targeted for transformation may for example include T cells, Natural Killer (NK) cells, cytotoxic T lymphocytes (CTL), regulatory T cells, human embryonic stem cells, tumor-infiltrating lymphocytes (TIL) or a pluripotent stem cell from which lymphoid cells may be differentiated. T cells expressing a desired CAR may for example be selected through co-culture with y-irradiated activating and propagating cells (AaPC), which co-express the cancer antigen and co-stimulatory molecules. The engineered CAR T-cells may be expanded, for example by co-culture on AaPC in presence of soluble factors, such as IL-2 and IL-21. This expansion may for example be carried out so as to provide memory CAR+ T cells (which may for example be assayed by non-enzymatic digital array and/or multi-panel flow cytometry). In this way, CAR T cells may be provided that have specific cytotoxic activity against antigen-bearing tumors (optionally in conjunction with production of desired chemokines such as interferon-?). CAR T cells of this kind may for example be used in animal models, for example to treat tumor xenografts.

    [0308] In certain embodiments, ACT includes co-transferring CD4+ Th1 cells and CD8+ CTLs to induce a synergistic antitumour response (see, e.g., Li et al., Adoptive cell therapy with CD4+ T helper 1 cells and CD8+ cytotoxic T cells enhances complete rejection of an established tumour, leading to generation of endogenous memory responses to non-targeted tumour epitopes. Clin Transl Immunology. 2017 October; 6(10): e160).

    [0309] In certain embodiments, Th17 cells are transferred to a subject in need thereof. Th17 cells have been reported to directly eradicate melanoma tumors in mice to a greater extent than Th1 cells (Muranski P, et al., Tumor-specific Th17-polarized cells eradicate large established melanoma. Blood. 2008 Jul. 15; 112(2):362-73; and Martin-Orozco N, et al., T helper 17 cells promote cytotoxic T cell activation in tumor immunity. Immunity. 2009 Nov. 20; 31(5):787-98). Those studies involved an adoptive T cell transfer (ACT) therapy approach, which takes advantage of CD4T cells that express a TCR recognizing tyrosinase tumor antigen. Exploitation of the TCR leads to rapid expansion of Th17 populations to large numbers ex vivo for reinfusion into the autologous tumor-bearing hosts.

    [0310] In certain embodiments, ACT may include autologous iPSC-based vaccines, such as irradiated iPSCs in autologous anti-tumor vaccines (see e.g., Kooreman, Nigel G. et al., Autologous iPSC-Based Vaccines Elicit Anti-tumor Responses In Vivo, Cell Stem Cell 22, 1-13, 2018, doi.org/10.1016/j.stem.2018.01.016).

    [0311] Unlike T-cell receptors (TCRs) that are MHC restricted, CARs can potentially bind any cell surface-expressed antigen and can thus be more universally used to treat patients (see Irving et al., Engineering Chimeric Antigen Receptor T-Cells for Racing in Solid Tumors: Don't Forget the Fuel, Front. Immunol., 3 Apr. 2017, doi.org/10.3389/fimmu.2017.00267). In certain embodiments, in the absence of endogenous T-cell infiltrate (e.g., due to aberrant antigen processing and presentation), which precludes the use of TIL therapy and immune checkpoint blockade, the transfer of CAR T-cells may be used to treat patients (see, e.g., Hinrichs C S, Rosenberg S A. Exploiting the curative potential of adoptive T-cell therapy for cancer. Immunol Rev (2014) 257(1):56-71. doi:10.1111/imr.12132).

    [0312] Approaches such as the foregoing may be adapted to provide methods of treating and/or increasing survival of a subject having a disease, such as a neoplasia, for example by administering an effective amount of an immunoresponsive cell comprising an antigen recognizing receptor that binds a selected antigen, wherein the binding activates the immunoresponsive cell, thereby treating or preventing the disease (such as a neoplasia, a pathogen infection, an autoimmune disorder, or an allogeneic transplant reaction).

    [0313] In certain embodiments, the treatment can be administered after lymphodepleting pretreatment in the form of chemotherapy (typically a combination of cyclophosphamide and fludarabine) or radiation therapy. Initial studies in ACT had short lived responses and the transferred cells did not persist in vivo for very long (Houot et al., T-cell-based immunotherapy: adoptive cell transfer and checkpoint inhibition. Cancer Immunol Res (2015) 3(10):1115-22; and Kamta et al., Advancing Cancer Therapy with Present and Emerging Immuno-Oncology Approaches. Front. Oncol. (2017) 7:64). Immune suppressor cells like Tregs and MDSCs may attenuate the activity of transferred cells by outcompeting them for the necessary cytokines. Not being bound by a theory lymphodepleting pretreatment may eliminate the suppressor cells allowing the TILs to persist.

    [0314] In one embodiment, the treatment can be administrated into patients undergoing an immunosuppressive treatment (e.g., glucocorticoid treatment). The cells or population of cells, may be made resistant to at least one immunosuppressive agent due to the inactivation of a gene encoding a receptor for such immunosuppressive agent. In certain embodiments, the immunosuppressive treatment provides for the selection and expansion of the immunoresponsive T cells within the patient.

    [0315] In certain embodiments, the treatment can be administered before primary treatment (e.g., surgery or radiation therapy) to shrink a tumor before the primary treatment. In another embodiment, the treatment can be administered after primary treatment to remove any remaining cancer cells.

    [0316] In certain embodiments, immunometabolic barriers can be targeted therapeutically prior to and/or during ACT to enhance responses to ACT or CAR T-cell therapy and to support endogenous immunity (see, e.g., Irving et al., Engineering Chimeric Antigen Receptor T-Cells for Racing in Solid Tumors: Don't Forget the Fuel, Front. Immunol., 3 Apr. 2017, doi.org/10.3389/fimmu.2017.00267).

    [0317] The administration of cells or population of cells, such as immune system cells or cell populations, such as more particularly immunoresponsive cells or cell populations, as disclosed herein may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The cells or population of cells may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, intrathecally, by intravenous or intralymphatic injection, or intraperitoneally. In some embodiments, the disclosed CARs may be delivered or administered into a cavity formed by the resection of tumor tissue (i.e. intracavity delivery) or directly into a tumor prior to resection (i.e. intratumoral delivery). In one embodiment, the cell compositions of the present invention are preferably administered by intravenous injection.

    [0318] The administration of the cells or population of cells can consist of the administration of 10.sup.4-10.sup.9 cells per kg body weight, preferably 10.sup.5 to 10.sup.6 cells/kg body weight including all integer values of cell numbers within those ranges. Dosing in CAR T cell therapies may for example involve administration of from 10.sup.6 to 10.sup.9 cells/kg, with or without a course of lymphodepletion, for example with cyclophosphamide. The cells or population of cells can be administrated in one or more doses. In another embodiment, the effective amount of cells are administrated as a single dose. In another embodiment, the effective amount of cells are administrated as more than one dose over a period time. Timing of administration is within the judgment of managing physician and depends on the clinical condition of the patient. The cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions are within the skill of one in the art. An effective amount means an amount which provides a therapeutic or prophylactic benefit. The dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.

    [0319] In another embodiment, the effective amount of cells or composition comprising those cells are administrated parenterally. The administration can be an intravenous administration. The administration can be directly done by injection within a tumor.

    [0320] To guard against possible adverse reactions, engineered immunoresponsive cells may be equipped with a transgenic safety switch, in the form of a transgene that renders the cells vulnerable to exposure to a specific signal. For example, the herpes simplex viral thymidine kinase (TK) gene may be used in this way, for example by introduction into allogeneic T lymphocytes used as donor lymphocyte infusions following stem cell transplantation (Greco, et al., Improving the safety of cell therapy with the TK-suicide gene. Front. Pharmacol. 2015; 6: 95). In such cells, administration of a nucleoside prodrug such as ganciclovir or acyclovir causes cell death. Alternative safety switch constructs include inducible caspase 9, for example triggered by administration of a small-molecule dimerizer that brings together two nonfunctional icasp9 molecules to form the active enzyme. A wide variety of alternative approaches to implementing cellular proliferation controls have been described (see U.S. Patent Publication No. 20130071414; PCT Patent Publication WO2011146862; PCT Patent Publication WO2014011987; PCT Patent Publication WO2013040371; Zhou et al. BLOOD, 2014, 123/25:3895-3905; Di Stasi et al., The New England Journal of Medicine 2011; 365:1673-1683; Sadelain M, The New England Journal of Medicine 2011; 365:1735-173; Ramos et al., Stem Cells 28(6):1107-15 (2010)).

    [0321] In a further refinement of adoptive therapies, genome editing may be used to tailor immunoresponsive cells to alternative implementations, for example providing edited CAR T cells (see Poirot et al., 2015, Multiplex genome edited T-cell manufacturing platform for off-the-shelfadoptive T-cell immunotherapies, Cancer Res 75 (18): 3853; Ren et al., 2017, Multiplex genome editing to generate universal CAR T cells resistant to PD1 inhibition, Clin Cancer Res. 2017 May 1; 23(9):2255-2266. doi: 10.1158/1078-0432.CCR-16-1300. Epub 2016 Nov. 4; Qasim et al., 2017, Molecular remission of infant B-ALL after infusion of universal TALEN gene-edited CAR T cells, Sci Transl Med. 2017 Jan. 25; 9(374); Legut, et al., 2018, CRISPR-mediated TCR replacement generates superior anticancer transgenic T cells. Blood, 131(3), 311-322; Georgiadis et al., Long Terminal Repeat CRISPR-CAR-Coupled Universal T Cells Mediate Potent Anti-leukemic Effects, Molecular Therapy, In Press, Corrected Proof, Available online 6 Mar. 2018; and Roth, T. L. Editing of Endogenous Genes in Cellular Immunotherapies. Curr Hematol Malig Rep 15, 235-240 (2020)). Cells may be edited using any CRISPR system and method of use thereof as described herein. CRISPR systems may be delivered to an immune cell by any method described herein. In preferred embodiments, cells are edited ex vivo and transferred to a subject in need thereof. Immunoresponsive cells, CAR T cells or any cells used for adoptive cell transfer may be edited. Editing may be performed for example to insert or knock-in an exogenous gene, such as an exogenous gene encoding a CAR or a TCR, at a preselected locus in a cell (e.g. TRAC locus); to eliminate potential alloreactive T-cell receptors (TCR) or to prevent inappropriate pairing between endogenous and exogenous TCR chains, such as to knock-out or knock-down expression of an endogenous TCR in a cell; to disrupt the target of a chemotherapeutic agent in a cell; to block an immune checkpoint, such as to knock-out or knock-down expression of an immune checkpoint protein or receptor in a cell; to knock-out or knock-down expression of other gene or genes in a cell, the reduced expression or lack of expression of which can enhance the efficacy of adoptive therapies using the cell; to knock-out or knock-down expression of an endogenous gene in a cell, said endogenous gene encoding an antigen targeted by an exogenous CAR or TCR; to knock-out or knock-down expression of one or more MHC constituent proteins in a cell; to activate a T cell; to modulate cells such that the cells are resistant to exhaustion or dysfunction; and/or increase the differentiation and/or proliferation of functionally exhausted or dysfunctional CD8+ T-cells (see PCT Patent Publications: WO2013176915, WO2014059173, WO2014172606, WO2014184744, and WO2014191128).

    [0322] In certain embodiments, editing may result in inactivation of a gene. By inactivating a gene, it is intended that the gene of interest is not expressed in a functional protein form. In a particular embodiment, the CRISPR system specifically catalyzes cleavage in one targeted gene thereby inactivating said targeted gene. The nucleic acid strand breaks caused are commonly repaired through the distinct mechanisms of homologous recombination or non-homologous end joining (NHEJ). However, NHEJ is an imperfect repair process that often results in changes to the DNA sequence at the site of the cleavage. Repair via non-homologous end joining (NHEJ) often results in small insertions or deletions (Indel) and can be used for the creation of specific gene knockouts. Cells in which a cleavage induced mutagenesis event has occurred can be identified and/or selected by well-known methods in the art. In certain embodiments, homology directed repair (HDR) is used to concurrently inactivate a gene (e.g., TRAC) and insert an endogenous TCR or CAR into the inactivated locus.

    [0323] Hence, in certain embodiments, editing of cells (such as by CRISPR/Cas), particularly cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may be performed to insert or knock-in an exogenous gene, such as an exogenous gene encoding a CAR or a TCR, at a preselected locus in a cell. Conventionally, nucleic acid molecules encoding CARs or TCRs are transfected or transduced to cells using randomly integrating vectors, which, depending on the site of integration, may lead to clonal expansion, oncogenic transformation, variegated transgene expression and/or transcriptional silencing of the transgene. Directing of transgene(s) to a specific locus in a cell can minimize or avoid such risks and advantageously provide for uniform expression of the transgene(s) by the cells. Without limitation, suitable safe harbor loci for directed transgene integration include CCR5 or AAVS1. Homology-directed repair (HDR) strategies are known and described elsewhere in this specification allowing to insert transgenes into desired loci (e.g., TRAC locus).

    [0324] Further suitable loci for insertion of transgenes, in particular CAR or exogenous TCR transgenes, include without limitation loci comprising genes coding for constituents of endogenous T-cell receptor, such as T-cell receptor alpha locus (TRA) or T-cell receptor beta locus (TRB), for example T-cell receptor alpha constant (TRAC) locus, T-cell receptor beta constant 1 (TRBC1) locus or T-cell receptor beta constant 2 (TRBC1) locus. Advantageously, insertion of a transgene into such locus can simultaneously achieve expression of the transgene, potentially controlled by the endogenous promoter, and knock-out expression of the endogenous TCR. This approach has been exemplified in Eyquem et al., (2017) Nature 543: 113-117, wherein the authors used CRISPR/Cas9 gene editing to knock-in a DNA molecule encoding a CD19-specific CAR into the TRAC locus downstream of the endogenous promoter; the CAR-T cells obtained by CRISPR were significantly superior in terms of reduced tonic CAR signaling and exhaustion.

    [0325] T cell receptors (TCR) are cell surface receptors that participate in the activation of T cells in response to the presentation of antigen. The TCR is generally made from two chains, a and B, which assemble to form a heterodimer and associates with the CD3-transducing subunits to form the T cell receptor complex present on the cell surface. Each a and B chain of the TCR consists of an immunoglobulin-like N-terminal variable (V) and constant (C) region, a hydrophobic transmembrane domain, and a short cytoplasmic region. As for immunoglobulin molecules, the variable region of the ? and ? chains are generated by V(D)J recombination, creating a large diversity of antigen specificities within the population of T cells. However, in contrast to immunoglobulins that recognize intact antigen, T cells are activated by processed peptide fragments in association with an MHC molecule, introducing an extra dimension to antigen recognition by T cells, known as MHC restriction. Recognition of MHC disparities between the donor and recipient through the T cell receptor leads to T cell proliferation and the potential development of graft versus host disease (GVHD). The inactivation of TCR? or TCR? can result in the elimination of the TCR from the surface of T cells preventing recognition of alloantigen and thus GVHD. However, TCR disruption generally results in the elimination of the CD3 signaling component and alters the means of further T cell expansion.

    [0326] Hence, in certain embodiments, editing of cells (such as by CRISPR/Cas), particularly cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may be performed to knock-out or knock-down expression of an endogenous TCR in a cell. For example, NHEJ-based or HDR-based gene editing approaches can be employed to disrupt the endogenous TCR alpha and/or beta chain genes. For example, gene editing system or systems, such as CRISPR/Cas system or systems, can be designed to target a sequence found within the TCR beta chain conserved between the beta 1 and beta 2 constant region genes (TRBC1 and TRBC2) and/or to target the constant region of the TCR alpha chain (TRAC) gene.

    [0327] Allogeneic cells are rapidly rejected by the host immune system. It has been demonstrated that, allogeneic leukocytes present in non-irradiated blood products will persist for no more than 5 to 6 days (Boni, Muranski et al. 2008 Blood 1; 112(12):4746-54). Thus, to prevent rejection of allogeneic cells, the host's immune system usually has to be suppressed to some extent. However, in the case of adoptive cell transfer the use of immunosuppressive drugs also have a detrimental effect on the introduced therapeutic T cells. Therefore, to effectively use an adoptive immunotherapy approach in these conditions, the introduced cells would need to be resistant to the immunosuppressive treatment. Thus, in a particular embodiment, the present invention further comprises a step of modifying T cells to make them resistant to an immunosuppressive agent, preferably by inactivating at least one gene encoding a target for an immunosuppressive agent. An immunosuppressive agent is an agent that suppresses immune function by one of several mechanisms of action. An immunosuppressive agent can be, but is not limited to a calcineurin inhibitor, a target of rapamycin, an interleukin-2 receptor ?-chain blocker, an inhibitor of inosine monophosphate dehydrogenase, an inhibitor of dihydrofolic acid reductase, a corticosteroid or an immunosuppressive antimetabolite. The present invention allows conferring immunosuppressive resistance to T cells for immunotherapy by inactivating the target of the immunosuppressive agent in T cells. As non-limiting examples, targets for an immunosuppressive agent can be a receptor for an immunosuppressive agent such as: CD52, glucocorticoid receptor (GR), a FKBP family gene member and a cyclophilin family gene member.

    [0328] In certain embodiments, editing of cells (such as by CRISPR/Cas), particularly cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may be performed to block an immune checkpoint, such as to knock-out or knock-down expression of an immune checkpoint protein or receptor in a cell. Immune checkpoints are inhibitory pathways that slow down or stop immune reactions and prevent excessive tissue damage from uncontrolled activity of immune cells. In certain embodiments, the immune checkpoint targeted is the programmed death-1 (PD-1 or CD279) gene (PDCD1) (see, e.g., Rupp L J, Schumann K, Roybal K T, et al. CRISPR/Cas9-mediated PD-1 disruption enhances anti-tumor efficacy of human chimeric antigen receptor T cells. Sci Rep. 2017; 7(1):737). In other embodiments, the immune checkpoint targeted is cytotoxic T-lymphocyte-associated antigen (CTLA-4). In additional embodiments, the immune checkpoint targeted is another member of the CD28 and CTLA4 Ig superfamily such as BTLA, LAG3, ICOS, PDL1 or KIR. In further additional embodiments, the immune checkpoint targeted is a member of the TNFR superfamily such as CD40, OX40, CD137, GITR, CD27 or TIM-3.

    [0329] Additional immune checkpoints include Src homology 2 domain-containing protein tyrosine phosphatase 1 (SHP-1) (Watson H A, et al., SHP-1: the next checkpoint target for cancer immunotherapy? Biochem Soc Trans. 2016 Apr. 15; 44(2):356-62). SHP-1 is a widely expressed inhibitory protein tyrosine phosphatase (PTP). In T-cells, it is a negative regulator of antigen-dependent activation and proliferation. It is a cytosolic protein, and therefore not amenable to antibody-mediated therapies, but its role in activation and proliferation makes it an attractive target for genetic manipulation in adoptive transfer strategies, such as chimeric antigen receptor (CAR) T cells. Immune checkpoints may also include T cell immunoreceptor with Ig and ITIM domains (TIGIT/Vstm3/WUCAM/VSIG9) and VISTA (Le Mercier I, et al., (2015) Beyond CTLA-4 and PD-1, the generation Z of negative checkpoint regulators. Front. Immunol. 6:418).

    [0330] WO2014172606 relates to the use of MT1 and/or MT2 inhibitors to increase proliferation and/or activity of exhausted CD8+ T-cells and to decrease CD8+ T-cell exhaustion (e.g., decrease functionally exhausted or unresponsive CD8+ immune cells). In certain embodiments, metallothioneins are targeted by gene editing in adoptively transferred T cells.

    [0331] In certain embodiments, targets of gene editing may be at least one targeted locus involved in the expression of an immune checkpoint protein. Such targets may include, but are not limited to CTLA4, PPP2CA, PPP2CB, PTPN6, PTPN22, PDCD1, ICOS (CD278), PDL1, KIR, LAG3, HAVCR2, BTLA, CD160, TIGIT, CD96, CRTAM, LAIR1, SIGLEC7, SIGLEC9, CD244 (2B4), TNFRSF10B, TNFRSF10A, CASP8, CASP10, CASP3, CASP6, CASP7, FADD, FAS, TGFBRII, TGFRBRI, SMAD2, SMAD3, SMAD4, SMAD10, SKI, SKIL, TGIF1, IL10RA, IL10RB, HMOX2, IL6R, IL6ST, EIF2AK4, CSK, PAG1, SIT1, FOXP3, PRDM1, BATF, VISTA, GUCY1A2, GUCY1A3, GUCY1B2, GUCY1B3, MT1, MT2, CD40, OX40, CD137, GITR, CD27, SHP-1, TIM-3, CEACAM-1, CEACAM-3, or CEACAM-5. In preferred embodiments, the gene locus involved in the expression of PD-1 or CTLA-4 genes is targeted. In other preferred embodiments, combinations of genes are targeted, such as but not limited to PD-1 and TIGIT.

    [0332] By means of an example and without limitation, WO2016196388 concerns an engineered T cell comprising (a) a genetically engineered antigen receptor that specifically binds to an antigen, which receptor may be a CAR; and (b) a disrupted gene encoding a PD-L1, an agent for disruption of a gene encoding a PD-L1, and/or disruption of a gene encoding PD-L1, wherein the disruption of the gene may be mediated by a gene editing nuclease, a zinc finger nuclease (ZFN), CRISPR/Cas9 and/or TALEN. WO2015142675 relates to immune effector cells comprising a CAR in combination with an agent (such as CRISPR, TALEN or ZFN) that increases the efficacy of the immune effector cells in the treatment of cancer, wherein the agent may inhibit an immune inhibitory molecule, such as PD1, PD-L1, CTLA-4, TIM-3, LAG-3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4, TGFR beta, CEACAM-1, CEACAM-3, or CEACAM-5. Ren et al., (2017) Clin Cancer Res 23 (9) 2255-2266 performed lentiviral delivery of CAR and electro-transfer of Cas9 mRNA and gRNAs targeting endogenous TCR, ?-2 microglobulin (B2M) and PD1 simultaneously, to generate gene-disrupted allogeneic CAR T cells deficient of TCR, HLA class I molecule and PD1.

    [0333] In certain embodiments, cells may be engineered to express a CAR, wherein expression and/or function of methylcytosine dioxygenase genes (TET1, TET2 and/or TET3) in the cells has been reduced or eliminated, such as by CRISPR, ZNF or TALEN (for example, as described in WO201704916).

    [0334] In certain embodiments, editing of cells (such as by CRISPR/Cas), particularly cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may be performed to knock-out or knock-down expression of an endogenous gene in a cell, said endogenous gene encoding an antigen targeted by an exogenous CAR or TCR, thereby reducing the likelihood of targeting of the engineered cells. In certain embodiments, the targeted antigen may be one or more antigen selected from the group consisting of CD38, CD138, CS-1, CD33, CD26, CD30, CD53, CD92, CD100, CD148, CD150, CD200, CD261, CD262, CD362, human telomerase reverse transcriptase (hTERT), survivin, mouse double minute 2 homolog (MDM2), cytochrome P450 1B1 (CYP1B), HER2/neu, Wilms' tumor gene 1 (WT1), livin, alphafetoprotein (AFP), carcinoembryonic antigen (CEA), mucin 16 (MUC16), MUC1, prostate-specific membrane antigen (PSMA), p53, cyclin (D1), B cell maturation antigen (BCMA), transmembrane activator and CAML Interactor (TACI), and B-cell activating factor receptor (BAFF-R) (for example, as described in WO2016011210 and WO2017011804).

    [0335] In certain embodiments, editing of cells (such as by CRISPR/Cas), particularly cells intended for adoptive cell therapies, more particularly immunoresponsive cells such as T cells, may be performed to knock-out or knock-down expression of one or more MHC constituent proteins, such as one or more HLA proteins and/or beta-2 microglobulin (B2M), in a cell, whereby rejection of non-autologous (e.g., allogeneic) cells by the recipient's immune system can be reduced or avoided. In preferred embodiments, one or more HLA class I proteins, such as HLA-A, B and/or C, and/or B2M may be knocked-out or knocked-down. Preferably, B2M may be knocked-out or knocked-down. By means of an example, Ren et al., (2017) Clin Cancer Res 23 (9) 2255-2266 performed lentiviral delivery of CAR and electro-transfer of Cas9 mRNA and gRNAs targeting endogenous TCR, ?-2 microglobulin (B2M) and PD1 simultaneously, to generate gene-disrupted allogeneic CAR T cells deficient of TCR, HLA class I molecule and PD1.

    [0336] In other embodiments, at least two genes are edited. Pairs of genes may include, but are not limited to PD1 and TCR?, PD1 and TCR?, CTLA-4 and TCR?, CTLA-4 and TCR?, LAG3 and TCR?, LAG3 and TCR?, Tim3 and TCR?, Tim3 and TCR?, BTLA and TCR?, BTLA and TCR?, BY55 and TCR?, BY55 and TCR?, TIGIT and TCR?, TIGIT and TCR?, B7H5 and TCR?, B7H5 and TCR?, LAIR1 and TCR?, LAIR1 and TCR?, SIGLEC10 and TCR?, SIGLEC10 and TCR?, 2B4 and TCR?, 2B4 and TCR?, B2M and TCR?, B2M and TCR?.

    [0337] In certain embodiments, a cell may be multiply edited (multiplex genome editing) as taught herein to (1) knock-out or knock-down expression of an endogenous TCR (for example, TRBC1, TRBC2 and/or TRAC), (2) knock-out or knock-down expression of an immune checkpoint protein or receptor (for example PD1, PD-L1 and/or CTLA4); and (3) knock-out or knock-down expression of one or more MHC constituent proteins (for example, HLA-A, B and/or C, and/or B2M, preferably B2M).

    [0338] Whether prior to or after genetic modification of the T cells, the T cells can be activated and expanded generally using methods as described, for example, in U.S. Pat. Nos. 6,352,694; 6,534,055; 6,905,680; 5,858,358; 6,887,466; 6,905,681; 7,144,575; 7,232,566; 7,175,843; 5,883,223; 6,905,874; 6,797,514; 6,867,041; and 7,572,631. T cells can be expanded in vitro or in vivo.

    [0339] Immune cells may be obtained using any method known in the art. In one embodiment, allogenic T cells may be obtained from healthy subjects. In one embodiment T cells that have infiltrated a tumor are isolated. T cells may be removed during surgery. T cells may be isolated after removal of tumor tissue by biopsy. T cells may be isolated by any means known in the art. In one embodiment, T cells are obtained by apheresis. In one embodiment, the method may comprise obtaining a bulk population of T cells from a tumor sample by any suitable method known in the art. For example, a bulk population of T cells can be obtained from a tumor sample by dissociating the tumor sample into a cell suspension from which specific cell populations can be selected. Suitable methods of obtaining a bulk population of T cells may include, but are not limited to, any one or more of mechanically dissociating (e.g., mincing) the tumor, enzymatically dissociating (e.g., digesting) the tumor, and aspiration (e.g., as with a needle).

    [0340] The bulk population of T cells obtained from a tumor sample may comprise any suitable type of T cell. Preferably, the bulk population of T cells obtained from a tumor sample comprises tumor infiltrating lymphocytes (TILs).

    [0341] The tumor sample may be obtained from any mammal. Unless stated otherwise, as used herein, the term mammal refers to any mammal including, but not limited to, mammals of the order Logomorpha, such as rabbits; the order Carnivora, including Felines (cats) and Canines (dogs); the order Artiodactyla, including Bovines (cows) and Swines (pigs); or of the order Perssodactyla, including Equines (horses). The mammals may be non-human primates, e.g., of the order Primates, Ceboids, or Simoids (monkeys) or of the order Anthropoids (humans and apes). In some embodiments, the mammal may be a mammal of the order Rodentia, such as mice and hamsters. Preferably, the mammal is a non-human primate or a human. An especially preferred mammal is the human.

    [0342] T cells can be obtained from a number of sources, including peripheral blood mononuclear cells (PBMC), bone marrow, lymph node tissue, spleen tissue, and tumors. In certain embodiments of the present invention, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll separation. In one preferred embodiment, cells from the circulating blood of an individual are obtained by apheresis or leukapheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets. In one embodiment, the cells collected by apheresis may be washed to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In one embodiment of the invention, the cells are washed with phosphate buffered saline (PBS). In an alternative embodiment, the wash solution lacks calcium and may lack magnesium or may lack many if not all divalent cations. Initial activation steps in the absence of calcium lead to magnified activation. As those of ordinary skill in the art would readily appreciate a washing step may be accomplished by methods known to those in the art, such as by using a semi-automated flow-through centrifuge (for example, the Cobe 2991 cell processor) according to the manufacturer's instructions. After washing, the cells may be resuspended in a variety of biocompatible buffers, such as, for example, Ca-free, Mg-free PBS. Alternatively, the undesirable components of the apheresis sample may be removed and the cells directly resuspended in culture media.

    [0343] In another embodiment, T cells are isolated from peripheral blood lymphocytes by lysing the red blood cells and depleting the monocytes, for example, by centrifugation through a PERCOLL? gradient. A specific subpopulation of T cells, such as CD28+, CD4+, CDC, CD45RA+, and CD45RO+ T cells, can be further isolated by positive or negative selection techniques. For example, in one preferred embodiment, T cells are isolated by incubation with anti-CD3/anti-CD28 (i.e., 3?28)-conjugated beads, such as DYNABEADS? M-450 CD3/CD28 T, or XCYTE DYNABEADS? for a time period sufficient for positive selection of the desired T cells. In one embodiment, the time period is about 30 minutes. In a further embodiment, the time period ranges from 30 minutes to 36 hours or longer and all integer values there between. In a further embodiment, the time period is at least 1, 2, 3, 4, 5, or 6 hours. In yet another preferred embodiment, the time period is 10 to 24 hours. In one preferred embodiment, the incubation time period is 24 hours. For isolation of T cells from patients with leukemia, use of longer incubation times, such as 24 hours, can increase cell yield. Longer incubation times may be used to isolate T cells in any situation where there are few T cells as compared to other cell types, such in isolating tumor infiltrating lymphocytes (TIL) from tumor tissue or from immunocompromised individuals. Further, use of longer incubation times can increase the efficiency of capture of CD8+ T cells.

    [0344] Enrichment of a T cell population by negative selection can be accomplished with a combination of antibodies directed to surface markers unique to the negatively selected cells. A preferred method is cell sorting and/or selection via negative magnetic immunoadherence or flow cytometry that uses a cocktail of monoclonal antibodies directed to cell surface markers present on the cells negatively selected. For example, to enrich for CD4+ cells by negative selection, a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CD11b, CD16, HLA-DR, and CD8.

    [0345] Further, monocyte populations (i.e., CD14+ cells) may be depleted from blood preparations by a variety of methodologies, including anti-CD14 coated beads or columns, or utilization of the phagocytotic activity of these cells to facilitate removal. Accordingly, in one embodiment, the invention uses paramagnetic particles of a size sufficient to be engulfed by phagocytotic monocytes. In certain embodiments, the paramagnetic particles are commercially available beads, for example, those produced by Life Technologies under the trade name Dynabeads?. In one embodiment, other non-specific cells are removed by coating the paramagnetic particles with irrelevant proteins (e.g., serum proteins or antibodies). Irrelevant proteins and antibodies include those proteins and antibodies or fragments thereof that do not specifically target the T cells to be isolated. In certain embodiments, the irrelevant beads include beads coated with sheep anti-mouse antibodies, goat anti-mouse antibodies, and human serum albumin.

    [0346] In brief, such depletion of monocytes is performed by preincubating T cells isolated from whole blood, apheresed peripheral blood, or tumors with one or more varieties of irrelevant or non-antibody coupled paramagnetic particles at any amount that allows for removal of monocytes (approximately a 20: 1 bead:cell ratio) for about 30 minutes to 2 hours at 22 to 37 degrees C., followed by magnetic removal of cells which have attached to or engulfed the paramagnetic particles. Such separation can be performed using standard methods available in the art. For example, any magnetic separation methodology may be used including a variety of which are commercially available, (e.g., DYNAL? Magnetic Particle Concentrator (DYNAL MPC?)). Assurance of requisite depletion can be monitored by a variety of methodologies known to those of ordinary skill in the art, including flow cytometric analysis of CD14 positive cells, before and after depletion.

    [0347] For isolation of a desired population of cells by positive or negative selection, the concentration of cells and surface (e.g., particles such as beads) can be varied. In certain embodiments, it may be desirable to significantly decrease the volume in which beads and cells are mixed together (i.e., increase the concentration of cells), to ensure maximum contact of cells and beads. For example, in one embodiment, a concentration of 2 billion cells/ml is used. In one embodiment, a concentration of 1 billion cells/ml is used. In a further embodiment, greater than 100 million cells/ml is used. In a further embodiment, a concentration of cells of 10, 15, 20, 25, 30, 35, 40, 45, or 50 million cells/ml is used. In yet another embodiment, a concentration of cells from 75, 80, 85, 90, 95, or 100 million cells/ml is used. In further embodiments, concentrations of 125 or 150 million cells/ml can be used. Using high concentrations can result in increased cell yield, cell activation, and cell expansion. Further, use of high cell concentrations allows more efficient capture of cells that may weakly express target antigens of interest, such as CD28-negative T cells, or from samples where there are many tumor cells present (i.e., leukemic blood, tumor tissue, etc). Such populations of cells may have therapeutic value and would be desirable to obtain. For example, using high concentration of cells allows more efficient selection of CD8+ T cells that normally have weaker CD28 expression.

    [0348] In a related embodiment, it may be desirable to use lower concentrations of cells. By significantly diluting the mixture of T cells and surface (e.g., particles such as beads), interactions between the particles and cells is minimized. This selects for cells that express high amounts of desired antigens to be bound to the particles. For example, CD4+ T cells express higher levels of CD28 and are more efficiently captured than CD8+ T cells in dilute concentrations. In one embodiment, the concentration of cells used is 5?10.sup.6/ml. In other embodiments, the concentration used can be from about 1?10.sup.5/ml to 1?10.sup.6/ml, and any integer value in between.

    [0349] T cells can also be frozen. Wishing not to be bound by theory, the freeze and subsequent thaw step provides a more uniform product by removing granulocytes and to some extent monocytes in the cell population. After a washing step to remove plasma and platelets, the cells may be suspended in a freezing solution. While many freezing solutions and parameters are known in the art and will be useful in this context, one method involves using PBS containing 20% DMSO and 8% human serum albumin, or other suitable cell freezing media, the cells then are frozen to ?80? C. at a rate of 1? per minute and stored in the vapor phase of a liquid nitrogen storage tank. Other methods of controlled freezing may be used as well as uncontrolled freezing immediately at ?20? C. or in liquid nitrogen.

    [0350] T cells for use in the present invention may also be antigen-specific T cells. For example, tumor-specific T cells can be used. In certain embodiments, antigen-specific T cells can be isolated from a patient of interest, such as a patient afflicted with a cancer or an infectious disease. In one embodiment, neoepitopes are determined for a subject and T cells specific to these antigens are isolated. Antigen-specific cells for use in expansion may also be generated in vitro using any number of methods known in the art, for example, as described in U.S. Patent Publication No. US 20040224402 entitled, Generation and Isolation of Antigen-Specific T Cells, or in U.S. Pat. Nos. 6,040,177. Antigen-specific cells for use in the present invention may also be generated using any number of methods known in the art, for example, as described in Current Protocols in Immunology, or Current Protocols in Cell Biology, both published by John Wiley & Sons, Inc., Boston, Mass.

    [0351] In a related embodiment, it may be desirable to sort or otherwise positively select (e.g. via magnetic selection) the antigen specific cells prior to or following one or two rounds of expansion. Sorting or positively selecting antigen-specific cells can be carried out using peptide-MHC tetramers (Altman, et al., Science. 1996 Oct. 4; 274(5284):94-6). In another embodiment, the adaptable tetramer technology approach is used (Andersen et al., 2012 Nat Protoc. 7:891-902). Tetramers are limited by the need to utilize predicted binding peptides based on prior hypotheses, and the restriction to specific HLAs. Peptide-MHC tetramers can be generated using techniques known in the art and can be made with any MHC molecule of interest and any antigen of interest as described herein. Specific epitopes to be used in this context can be identified using numerous assays known in the art. For example, the ability of a polypeptide to bind to MHC class I may be evaluated indirectly by monitoring the ability to promote incorporation of 1251 labeled ?2-microglobulin (B2m) into MHC class I/B2m/peptide heterotrimeric complexes (see Parker et al., J. Immunol. 152:163, 1994).

    [0352] In one embodiment cells are directly labeled with an epitope-specific reagent for isolation by flow cytometry followed by characterization of phenotype and TCRs. In one embodiment, T cells are isolated by contacting with T cell specific antibodies. Sorting of antigen-specific T cells, or generally any cells of the present invention, can be carried out using any of a variety of commercially available cell sorters, including, but not limited to, MoFlo sorter (DakoCytomation, Fort Collins, Colo.), FACSAria?, FACSArray?, FACSVantage? BD? LSR II, and FACSCalibur? (BD Biosciences, San Jose, Calif.).

    [0353] In a preferred embodiment, the method comprises selecting cells that also express CD3. The method may comprise specifically selecting the cells in any suitable manner. Preferably, the selecting is carried out using flow cytometry. The flow cytometry may be carried out using any suitable method known in the art. The flow cytometry may employ any suitable antibodies and stains. Preferably, the antibody is chosen such that it specifically recognizes and binds to the particular biomarker being selected. For example, the specific selection of CD3, CD8, TIM-3, LAG-3, 4-1BB, or PD-1 may be carried out using anti-CD3, anti-CD8, anti-TIM-3, anti-LAG-3, anti-4-1BB, or anti-PD-1 antibodies, respectively. The antibody or antibodies may be conjugated to a bead (e.g., a magnetic bead) or to a fluorochrome. Preferably, the flow cytometry is fluorescence-activated cell sorting (FACS). TCRs expressed on T cells can be selected based on reactivity to autologous tumors. Additionally, T cells that are reactive to tumors can be selected for based on markers using the methods described in patent publication Nos. WO2014133567 and WO2014133568, herein incorporated by reference in their entirety. Additionally, activated T cells can be selected for based on surface expression of CD107a.

    [0354] In one embodiment of the invention, the method further comprises expanding the numbers of T cells in the enriched cell population. Such methods are described in U.S. Pat. No. 8,637,307 and is herein incorporated by reference in its entirety. The numbers of T cells may be increased at least about 3-fold (or 4-, 5-, 6-, 7-, 8-, or 9-fold), more preferably at least about 10-fold (or 20-, 30-, 40-, 50-, 60-, 70-, 80-, or 90-fold), more preferably at least about 100-fold, more preferably at least about 1,000-fold, or most preferably at least about 100,000-fold. The numbers of T cells may be expanded using any suitable method known in the art. Exemplary methods of expanding the numbers of cells are described in patent publication No. WO 2003057171, U.S. Pat. No. 8,034,334, and U.S. Patent Application Publication No. 2012/0244133, each of which is incorporated herein by reference.

    [0355] In one embodiment, ex vivo T cell expansion can be performed by isolation of T cells and subsequent stimulation or activation followed by further expansion. In one embodiment of the invention, the T cells may be stimulated or activated by a single agent. In another embodiment, T cells are stimulated or activated with two agents, one that induces a primary signal and a second that is a co-stimulatory signal. Ligands useful for stimulating a single signal or stimulating a primary signal and an accessory molecule that stimulates a second signal may be used in soluble form. Ligands may be attached to the surface of a cell, to an Engineered Multivalent Signaling Platform (EMSP), or immobilized on a surface. In a preferred embodiment both primary and secondary agents are co-immobilized on a surface, for example a bead or a cell. In one embodiment, the molecule providing the primary activation signal may be a CD3 ligand, and the co-stimulatory molecule may be a CD28 ligand or 4-1BB ligand.

    [0356] In certain embodiments, T cells comprising a CAR or an exogenous TCR, may be manufactured as described in WO2015120096, by a method comprising: enriching a population of lymphocytes obtained from a donor subject; stimulating the population of lymphocytes with one or more T-cell stimulating agents to produce a population of activated T cells, wherein the stimulation is performed in a closed system using serum-free culture medium; transducing the population of activated T cells with a viral vector comprising a nucleic acid molecule which encodes the CAR or TCR, using a single cycle transduction to produce a population of transduced T cells, wherein the transduction is performed in a closed system using serum-free culture medium; and expanding the population of transduced T cells for a predetermined time to produce a population of engineered T cells, wherein the expansion is performed in a closed system using serum-free culture medium. In certain embodiments, T cells comprising a CAR or an exogenous TCR, may be manufactured as described in WO2015120096, by a method comprising: obtaining a population of lymphocytes; stimulating the population of lymphocytes with one or more stimulating agents to produce a population of activated T cells, wherein the stimulation is performed in a closed system using serum-free culture medium; transducing the population of activated T cells with a viral vector comprising a nucleic acid molecule which encodes the CAR or TCR, using at least one cycle transduction to produce a population of transduced T cells, wherein the transduction is performed in a closed system using serum-free culture medium; and expanding the population of transduced T cells to produce a population of engineered T cells, wherein the expansion is performed in a closed system using serum-free culture medium. The predetermined time for expanding the population of transduced T cells may be 3 days. The time from enriching the population of lymphocytes to producing the engineered T cells may be 6 days. The closed system may be a closed bag system. Further provided is population of T cells comprising a CAR or an exogenous TCR obtainable or obtained by said method, and a pharmaceutical composition comprising such cells.

    [0357] In certain embodiments, T cell maturation or differentiation in vitro may be delayed or inhibited by the method as described in WO2017070395, comprising contacting one or more T cells from a subject in need of a T cell therapy with an AKT inhibitor (such as, e.g., one or a combination of two or more AKT inhibitors disclosed in claim 8 of WO2017070395) and at least one of exogenous Interleukin-7 (IL-7) and exogenous Interleukin-15 (IL-15), wherein the resulting T cells exhibit delayed maturation or differentiation, and/or wherein the resulting T cells exhibit improved T cell function (such as, e.g., increased T cell proliferation; increased cytokine production; and/or increased cytolytic activity) relative to a T cell function of a T cell cultured in the absence of an AKT inhibitor.

    [0358] In certain embodiments, a patient in need of a T cell therapy may be conditioned by a method as described in WO2016191756 comprising administering to the patient a dose of cyclophosphamide between 200 mg/m2/day and 2000 mg/m2/day and a dose of fludarabine between 20 mg/m.sup.2/day and 900 mg/m.sup.2/day.

    [0359] In certain embodiments, a patient in need of adoptive cell transfer may be administered a TLR agonist to enhance anti-tumor immunity (see, e.g., Urban-Wojciuk, et al., The Role of TLRs in Anti-cancer Immunity and Tumor Rejection, Front Immunol. 2019; 10: 2388; and Kaczanowska et al., TLR agonists: our best frenemy in cancer immunotherapy, J Leukoc Biol. 2013 June; 93(6): 847-863). In certain embodiments, TLR agonists are delivered in a nanoparticle system (see, e.g., Buss and Bhatia, Nanoparticle delivery of immunostimulatory oligonucleotides enhances response to checkpoint inhibitor therapeutics, Proc Natl Acad Sci USA. 2020 Jun. 3; 202001569). In certain embodiments, the agonist is a TLR9 agonist. Id.

    [0360] In certain embodiments, the adoptive cell transfer method comprises the administration of CAR (chimeric antigen receptor) T cells or natural killer cells, T cells expressing a T cell receptor (TCR) specific for tumor antigen, or tumor infiltrating lymphocytes (TILs).

    Checkpoint Blockade Therapy

    [0361] In embodiments, the immunotherapy is checkpoint blockade (CPB) therapy. Antibodies that block the activity of checkpoint receptors, including CTLA-4, PD-1, Tim-3, Lag-3, and TIGIT, either alone or in combination, have been associated with improved effector CD8+ T cell responses in multiple pre-clinical cancer models (Johnston et al., 2014. The immunoreceptor TIGIT regulates antitumor and antiviral CD8(+) T cell effector function. Cancer cell 26, 923-937; Ngiow et al., 2011. Anti-TIM3 antibody promotes T cell IFN-gamma-mediated antitumor immunity and suppresses established tumors. Cancer research 71, 3540-3551; Sakuishi et al., 2010. Targeting Tim-3 and PD-1 pathways to reverse T cell exhaustion and restore anti-tumor immunity. The Journal of experimental medicine 207, 2187-2194; and Woo et al., 2012. Immune inhibitory molecules LAG-3 and PD-1 synergistically regulate T-cell function to promote tumoral immune escape. Cancer research 72, 917-927). Similarly, blockade of CTLA-4 and PD-1 in patients (Brahmer et al., 2012. Safety and activity of anti-PD-L1 antibody in patients with advanced cancer. The New England journal of medicine 366, 2455-2465; Hodi et al., 2010. Improved survival with ipilimumab in patients with metastatic melanoma. The New England journal of medicine 363, 711-723; Schadendorf et al., 2015. Pooled Analysis of Long-Term Survival Data From Phase II and Phase III Trials of Ipilimumab in Unresectable or Metastatic Melanoma. Journal of clinical oncology: official journal of the American Society of Clinical Oncology 33, 1889-1894; Topalian et al., 2012. Safety, activity, and immune correlates of anti-PD-1 antibody in cancer. The New England journal of medicine 366, 2443-2454; and Wolchok et al., 2017. Overall Survival with Combined Nivolumab and Ipilimumab in Advanced Melanoma. The New England journal of medicine 377, 1345-1356) has shown increased frequencies of proliferating T cells, often with specificity for tumor antigens, as well as increased CD8.sup.+ T cell effector function (Ayers et al., 2017. IFN-gamma-related mRNA profile predicts clinical response to PD-1 blockade. The Journal of clinical investigation 127, 2930-2940; Das et al., 2015. Combination therapy with anti-CTLA-4 and anti-PD-1 leads to distinct immunologic changes in vivo. Journal of immunology 194, 950-959; Gubin et al., 2014. Checkpoint blockade cancer immunotherapy targets tumour-specific mutant antigens. Nature 515, 577-581; Huang et al., 2017. T-cell invigoration to tumour burden ratio associated with anti-PD-1 response. Nature 545, 60-65; Kamphorst et al., 2017. Proliferation of PD-1+CD8 T cells in peripheral blood after PD-1-targeted therapy in lung cancer patients. Proceedings of the National Academy of Sciences of the United States of America 114, 4993-4998; Kvistborg et al., 2014. Anti-CTLA-4 therapy broadens the melanoma-reactive CD8+ T cell response. Science translational medicine 6, 254ra128; van Rooij et al., 2013. Tumor exome analysis reveals neoantigen-specific T-cell reactivity in an ipilimumab-responsive melanoma. Journal of clinical oncology: official journal of the American Society of Clinical Oncology 31, e439-442; and Yuan et al., 2008. CTLA-4 blockade enhances polyfunctional NY-ESO-1 specific T cell responses in metastatic melanoma patients with clinical benefit. Proceedings of the National Academy of Sciences of the United States of America 105, 20410-20415). Accordingly, the success of checkpoint receptor blockade has been attributed to the binding of blocking antibodies to checkpoint receptors expressed on dysfunctional CD8.sup.+ T cells and restoring effector function in these cells. The check point blockade therapy may be an inhibitor of any check point protein described herein. The checkpoint blockade therapy may comprise anti-TIM3, anti-CTLA4, anti-PD-L1, anti-PD1, anti-TIGIT, anti-LAG3, or combinations thereof. Anti-PD1 antibodies are disclosed in U.S. Pat. No. 8,735,553. Antibodies to LAG-3 are disclosed in U.S. Pat. No. 9,132,281. Anti-CTLA4 antibodies are disclosed in U.S. Pat. Nos. 9,327,014; 9,320,811; and 9,062,111. Specific check point inhibitors include, but are not limited to, anti-CTLA4 antibodies (e.g., Ipilimumab and Tremelimumab), anti-PD-1 antibodies (e.g., Nivolumab, Pembrolizumab), and anti-PD-L1 antibodies (e.g., Atezolizumab).

    [0362] In certain embodiments, checkpoint inhibition may be enhanced by administering a TLR agonist to enhance anti-tumor immunity (see, e.g., Urban-Wojciuk, et al., The Role of TLRs in Anti-cancer Immunity and Tumor Rejection, Front Immunol. 2019; 10: 2388; and Kaczanowska et al., TLR agonists: our best frenemy in cancer immunotherapy, J Leukoc Biol. 2013 June; 93(6): 847-863). In certain embodiments, a TLR9 agonist is administered (see, e.g., Chuang, et al., Adjuvant Effect of Toll-Like Receptor 9 Activation on Cancer Immunotherapy Using Checkpoint Blockade, Front. Immunol., 29 May 2020; and Reilley, et al., TLR9 activation cooperates with T cell checkpoint blockade to regress poorly immunogenic melanoma, J. Immunotherapy Cancer, 2019, 7, 323). In certain embodiments, TLR agonists are delivered in a nanoparticle system (see, e.g., Buss and Bhatia, Nanoparticle delivery of immunostimulatory oligonucleotides enhances response to checkpoint inhibitor therapeutics, Proc Natl Acad Sci USA. 2020 Jun. 3; 202001569).

    Recombinant Protein Formulation, Dosage, and Delivery

    [0363] In one example embodiment, virus like particles (VLPs) are used to facilitate intracellular recombinant protein therapy (see, e.g., WO2020252455A1, U.S. Ser. No. 10/577,397B2). In certain embodiments, VLPs include a Gag-B3GNT2, a Gag-MCL1, a Gag-BCL2A1, or a Gag-JUNB fusion protein. The Gag-B3GNT2, Gag-MCL1, Gag-BCL2A1, or Gag-JUNB fusion proteins may include a matrix protein, a capsid protein, and/or a nucleocapsid protein covalently linked to B3GNT2, MCL1, BCL2A1 or JUNB. In certain embodiments, the VLPs include a membrane comprising a phospholipid bilayer with one or more human endogenous retrovirus (HERV) derived ENV/glycoprotein(s) on the external side; a HERV-derived GAG protein in the VLP core, and a Gag-B3GNT2, a Gag-MCL1, a Gag-BCL2A1, or a Gag-JUNB fusion protein on the inside of the membrane, wherein B3GNT2, MCL1, BCL2A1 OR JUNB is fused to a human-endogenous GAG or other plasma membrane recruitment domain (see, e.g., WO2020252455A1). Fusion proteins can be obtained using standard recombinant protein technology.

    [0364] In one example embodiment, cell-penetrating peptides (CPPs) are used to facilitate intracellular recombinant protein therapy (see, e.g., Dinca A, Chien W-M, Chin M T. Intracellular Delivery of Proteins with Cell-Penetrating Peptides for Therapeutic Uses in Human Disease. International Journal of Molecular Sciences. 2016; 17(2):263). In certain embodiments, cell-penetrating peptides can be conjugated to B3GNT2, MCL1, BCL2A1 or JUNB, for example, using standard recombinant protein technology. In certain embodiments, cell-penetrating peptides can be concurrently delivered with recombinant B3GNT2, MCL1, BCL2A1 or JUNB.

    [0365] In one example embodiment, nanocarriers are used to facilitate intracellular recombinant protein therapy (see, e.g., Lee Y W, Luther D C, Kretzmann J A, Burden A, Jeon T, Zhai S, Rotello V M. Protein Delivery into the Cell Cytosol using Non-Viral Nanocarriers. Theranostics 2019; 9(11):3280-3292). Non-limiting nanocarriers include, but are not limited to nanoparticles (e.g., silica, gold), polymers, lipid based (e.g., cationic lipid within a polymer shell, lipid-like nanoparticles).

    [0366] The pharmaceutical composition of the invention may be administered locally or systemically. In a preferred embodiment, the pharmaceutical composition is administered near the tissue whose cells are to be transduced. In a particular embodiment, the pharmaceutical composition of the invention is administered locally to the subcutaneous adipose tissue, which is composed of varying amounts of the two different types of adipose tissue: white adipose tissue (WAT) that stores energy in the form of triacylglycerol (TAG) and brown adipose tissue (BAT) that dissipates energy as heat, burning fatty acids to maintain body temperature. In one example embodiment, the pharmaceutical composition of the invention is administered in the white adipose tissue (WAT) and/or in the brown adipose tissue (BAT) by intra-WAT or intra-BAT injection. In another preferred embodiment, the pharmaceutical composition of the invention is administered systemically.

    [0367] The adeno-associated virus (AAV) can be formulated with a physiologically acceptable carrier for use in gene transfer and gene therapy applications. The dosage of the formulation can be measured or calculated as viral particles or as genome copies (GC)/viral genomes (vg). Any method known in the art can be used to determine the genome copy (GC) number of the viral compositions of the invention. One method for performing AAV GC number titration is as follows: purified AAV vector samples are first treated with DNase to eliminate un-encapsulated AAV genome DNA or contaminating plasmid DNA from the production process. The DNase resistant particles are then subjected to heat treatment to release the genome from the capsid. The released genomes are then quantitated by real-time PCR using primer/probe sets targeting specific region of the viral genome.

    [0368] In any of the described methods the one or more vectors may be comprised in a delivery system. In any of the described methods the vectors may be delivered via liposomes, particles (e.g. nanoparticles), exosomes, microvesicles, a gene-gun. In any of the described methods viral vectors may be delivered by transduction of viral particles. The delivery systems may be administered systemically or by localized administration (e.g., direct injection). The term systemically administered and systemic administration, as used herein, means that the polynucleotides, vectors, polypeptides, or pharmaceutical compositions of the invention are administered to a subject in a non-localized manner. The systemic administration of the polynucleotides, vectors, polypeptides, or pharmaceutical compositions of the invention may reach several organs or tissues throughout the body of the subject or may reach specific organs or tissues of the subject. For example, the intravenous administration of a pharmaceutical composition of the invention may result in the transduction of more than one tissue or organ in a subject. The term transduce or transduction, as used herein, refers to the process whereby a foreign nucleotide sequence is introduced into a cell via a viral vector. The term transfection, as used herein, refers to the introduction of DNA into a recipient eukaryotic cell.

    [0369] Recombinant protein compositions described herein may be administered systemically (e.g., intravenously) or administered locally to adipose tissue (e.g., injection). In preferred embodiments, the recombinant protein compositions are administered with an appropriate carrier to be administered to a mammal, especially a human, preferably a pharmaceutically acceptable composition. A pharmaceutically acceptable composition refers to a non-toxic semisolid, liquid, or aerosolized filler, diluent, encapsulating material, colloidal suspension or formulation auxiliary of any type. Preferably, this composition is suitable for injection. These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and similar solutions or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.

    Alternate Tumor Immune Evasion Targets

    [0370] Applicants identified additional gene targets that were enriched in the overexpression screens. Applicants used MAGeCK (Li et al., 2014) and FDR analyses to identify candidate genes that were enriched in cells cultured with ESO T cells relative to control (FIG. 1h-k, FIG. 2b, Tables 1A-B, 2, and 3A-B). Pathway analysis performed on 576 genes prioritized by the MAGeCK analysis, which included the top 1% of multiple screening replicates by combining the acute and chronic screens, revealed pathways that were significantly enriched (FDR<0.05) within these top 1% of candidates, including some that have been previously shown to be important for tumor immune evasion, such as lipopolysaccharide response, extrinsic apoptosis signaling, NF-?B activation, JAK-STAT signaling, and antigen presentation (Lawson et al., 2020; Manguso et al., 2017; Pan et al., 2018; Patel et al., 2017; Vredevoogd et al., 2019). This analysis identified the novel immune evasion targets, B3GNT2, MCL1, BCL2A1 and JUNB. Validation studies were performed for these genes and knockout of all genes resulted in enhanced vulnerability to an immunotherapy. A similar approach can be used to test and identify further novel targets for enhancing anti-tumor immunity. In certain embodiments, targets are validated in a tumor animal model. In certain embodiments, the genes are knocked out in a tumor model and tested for resistance and sensitivity to T cell killing. In certain embodiments, the genes are over expressed in a tumor model and tested for resistance and sensitivity to T cell killing. In certain embodiments, the alternative targets are used to enhance anti-tumor immunity. In preferred embodiments, the targets used are one or more of the top ten ranked genes in either Table 1 or Table 3.

    [0371] The additional targets in Table 1 and Table 3 may also be targeted using the same approaches laid out above for the four targets B3GNT2, MCL1, BCLA21, and JUNB. In one example embodiment, any of the aforementioned methods targeting B3GNT2, MCL1, BCLA21, and JUNB, may further comprise targeting one or more genes in Table 1 or Table 3.

    TABLE-US-00002 TABLE 1A MAGeCK analysis results of the CRISPRa screen for resistance to T cell cytotoxicity in the acute screen. Gene targets are in ranked order. Gene names, RefSeq IDs, and MAGeCK P-values for each of the top 1000 screening bioreps are listed. Acute no T Acute T Acute no T Acute T Gene id cells biorep 1 cells biorep 1 cells biorep 2 cells biorep 2 CD274 NM_014143 7.89E?04 2.08E?03 2.54E?03 8.41E?05 MCL1 NM_021960 4.57E?05 2.48E?04 3.23E?03 8.84E?03 ZBTB10 NM_001277145 2.52E?03 7.80E?03 2.18E?03 3.47E?03 LMNA NM_001257374 5.71E?03 1.29E?02 1.93E?04 5.54E?04 C1R NM_001733 4.34E?03 2.65E?03 1.35E?02 4.30E?03 RABGGTA NM_182836 8.06E?04 5.54E?04 6.64E?03 1.79E?02 GNAL NM_001142339 1.67E?02 9.79E?03 1.83E?03 1.06E?03 KCNQ2 NM_004518 4.98E?03 4.13E?03 3.06E?03 2.42E?02 COMMD4 NM_017828 2.54E?02 7.70E?03 3.55E?03 7.36E?03 WRAP53 NM_001143991 1.97E?02 2.41E?02 5.02E?03 1.06E?03 GRIP1 NM_001178074 4.66E?03 1.80E?03 2.72E?02 1.63E?02 SCMH1 NM_001172222 1.40E?02 2.43E?02 1.71E?02 1.28E?02 OLFM1 NM_006334 6.79E?03 7.90E?03 4.73E?02 9.83E?03 RAB27A NM_183234 1.16E?02 2.69E?02 2.18E?02 1.18E?02 MBD3L3 NM_001164425 4.33E?04 7.52E?04 2.45E?02 4.76E?02 HGD NM_000187 3.65E?02 1.36E?02 1.87E?02 5.77E?03 JMJD1C NM_001282948 2.63E?02 2.71E?02 4.16E?03 1.98E?02 NXNL1 NM_138454 1.48E?02 2.48E?02 1.68E?02 2.21E?02 RNF166 NM_001171816 2.38E?02 2.89E?02 7.35E?03 2.14E?02 ISLR NM_201526 4.33E?02 9.40E?03 2.44E?02 4.93E?03 NLRP2 NM_001174081 1.39E?02 1.13E?02 7.85E?03 5.10E?02 JADE3 NM_001077445 1.38E?02 1.16E?02 5.30E?02 7.53E?03 MAGED2 NM_014599 3.03E?02 1.33E?02 3.49E?02 7.73E?03 DUS4L NM_181581 1.58E?02 2.10E?02 2.06E?02 2.92E?02 BCL2L1 NM_001191 1.97E?02 4.92E?02 1.67E?02 1.61E?03 SYCE1 NM_001143764 4.62E?03 1.94E?02 5.93E?02 9.74E?03 C12orf73 NM_001135570 2.26E?02 2.03E?02 2.55E?03 5.37E?02 ST8SIA5 NM_013305 5.83E?03 2.54E?02 5.33E?02 1.59E?02 MYBL1 NM_001144755 2.76E?02 6.64E?02 2.12E?04 6.68E?03 CYB5D2 NM_001254755 8.96E?03 5.72E?03 2.67E?02 6.32E?02 CGREF1 NM_001166241 8.24E?03 3.42E?02 6.81E?03 6.03E?02 SEC22A NM_012430 2.67E?02 1.52E?02 4.59E?02 2.39E?02 PROSC NM_007198 5.23E?02 3.47E?02 3.30E?03 2.15E?02 AHR NM_001621 5.75E?02 1.59E?02 1.98E?02 1.90E?02 FLCN NM_144997 2.57E?02 8.54E?02 9.28E?04 4.42E?04 C7orf76 NM_001201451 1.94E?02 8.94E?02 1.94E?03 5.98E?03 RARRES3 NM_004585 2.93E?02 4.10E?02 5.37E?02 3.87E?03 SDC2 NM_002998 3.77E?02 7.81E?03 7.64E?02 7.01E?03 PNLIPRP1 NM_006229 6.86E?04 1.31E?03 4.58E?02 8.21E?02 R3HDM1 NM_001282799 4.76E?03 9.13E?03 6.55E?02 5.47E?02 TLE2 NM_001144761 2.44E?02 1.11E?01 2.11E?04 2.19E?03 CUZD1 NM_022034 1.50E?02 6.46E?03 6.61E?02 5.16E?02 HIST3H2BB NM_175055 3.05E?02 6.94E?02 2.83E?02 1.78E?02 ARMCX5 NM_001168480 7.73E?02 5.83E?02 6.70E?03 6.20E?03 RPS7 NM_001011 2.02E?02 2.28E?03 2.35E?02 1.09E?01 PANK1 NM_138316 4.77E?03 2.92E?02 1.03E?02 1.11E?01 RABEPK NM_001174153 6.36E?02 8.33E?02 2.50E?03 7.06E?03 SNCA NM_000345 4.28E?02 2.70E?02 6.66E?02 2.03E?02 STAG2 NM_001042749 1.32E?02 3.91E?02 3.59E?02 7.11E?02 TYMS NM_001071 4.00E?02 1.72E?02 6.79E?02 3.58E?02 OR4F29 NM_001005221 3.81E?02 8.66E?02 7.24E?03 3.55E?02 KIAA1958 NM_133465 3.90E?02 1.98E?02 8.09E?02 2.85E?02 INTS10 NM_018142 1.58E?03 1.63E?03 5.73E?02 1.08E?01 CXorf57 NM_018015 6.22E?02 9.19E?02 8.61E?03 6.65E?03 DEFA3 NM_005217 4.14E?02 2.56E?02 5.29E?02 5.05E?02 PRKAG1 NM_002733 8.95E?03 6.46E?02 6.73E?02 2.99E?02 DSC1 NM_004948 4.81E?03 1.69E?02 5.10E?02 9.85E?02 JUNB NM_002229 2.36E?05 2.30E?06 1.53E?01 1.85E?02 RECK NM_021111 2.66E?02 1.18E?01 2.06E?02 8.31E?03 MBD3L2 NM_144614 3.61E?03 1.39E?03 3.29E?02 1.36E?01 PCNA NM_182649 1.05E?02 4.13E?02 2.69E?02 9.57E?02 MGAT5 NM_002410 3.18E?02 2.21E?02 9.13E?02 3.03E?02 UBA3 NM_003968 3.12E?02 6.00E?02 5.92E?02 2.77E?02 AMER3 NM_001105193 2.33E?02 1.43E?01 6.64E?03 8.27E?03 LAMC3 NM_006059 4.70E?02 7.01E?02 2.21E?02 4.24E?02 GSTCD NM_024751 3.47E?02 3.71E?02 9.06E?02 1.99E?02 ACVRL1 NM_001077401 1.62E?02 3.10E?02 2.60E?02 1.10E?01 REG4 NM_001159352 1.26E?01 4.49E?02 2.71E?04 1.46E?02 ZNF750 NM_024702 2.41E?02 3.94E?02 1.03E?01 2.09E?02 CDK16 NM_006201 2.18E?02 7.07E?02 3.78E?02 5.78E?02 GPR161 NM_001267614 5.45E?02 2.03E?02 7.53E?02 3.81E?02 COLEC11 NM_001255988 6.91E?02 2.47E?02 6.03E?02 3.53E?02 TBC1D9B NM_015043 1.85E?02 6.46E?02 6.26E?02 4.44E?02 C17orf105 NM_001136483 2.28E?02 7.64E?02 6.88E?02 2.33E?02 TMEM19 NM_018279 6.92E?02 1.93E?02 5.18E?03 9.76E?02 TRIM58 NM_015431 1.09E?02 1.11E?01 1.03E?02 6.06E?02 RASA2 NM_006506 1.26E?01 2.61E?02 2.31E?02 1.76E?02 RPRM NM_019845 1.63E?02 1.55E?02 2.57E?02 1.40E?01 TMEM201 NM_001010866 4.18E?03 9.52E?03 1.47E?01 3.74E?02 PTRH2 NM_016077 6.69E?02 3.04E?02 9.66E?02 5.56E?03 C11orf70 NM_001195005 9.52E?02 6.53E?03 8.36E?02 1.50E?02 TYK2 NM_003331 1.39E?02 2.17E?02 6.36E?02 1.06E?01 EPHA1 NM_005232 4.17E?02 4.60E?02 1.86E?02 9.93E?02 HIST1H2BI NM_003525 2.52E?02 2.16E?02 8.00E?02 7.89E?02 MFSD12 NM_174983 4.09E?02 9.61E?03 7.30E?02 8.31E?02 TAF1 NM_001286074 3.90E?02 4.67E?02 1.91E?02 1.03E?01 KIF21A NM_001173463 4.10E?02 7.17E?02 8.08E?02 1.53E?02 PRKACB NM_002731 1.27E?01 8.23E?02 1.08E?03 2.93E?04 GPT2 NM_001142466 1.94E?02 3.63E?02 6.58E?02 8.94E?02 CNP NM_033133 3.06E?02 7.91E?03 7.74E?02 9.67E?02 STARD13 NM_178006 1.17E?01 7.94E?02 9.75E?03 6.71E?03 SH2D1B NM_053282 7.33E?02 3.68E?02 6.57E?02 3.76E?02 TRHDE NM_013381 9.76E?02 9.39E?02 1.14E?02 1.20E?02 DCST2 NM_144622 9.47E?02 3.29E?02 7.61E?02 1.49E?02 KCTD18 NM_152387 3.32E?02 3.66E?02 1.25E?01 2.41E?02 CAPG NM_001256139 5.11E?02 6.33E?02 9.26E?02 1.26E?02 FOXC1 NM_001453 7.38E?02 2.96E?02 8.31E?02 3.61E?02 ZSCAN26 NM_152736 1.66E?02 1.78E?02 9.68E?02 9.18E?02 TMX1 NM_030755 1.06E?03 8.06E?04 8.59E?02 1.36E?01 GMIP NM_001288998 3.65E?02 2.84E?02 4.01E?02 1.18E?01 FAM65C NM_080829 6.28E?03 2.62E?02 1.05E?01 8.63E?02 TEX11 NM_031276 1.03E?02 1.86E?02 1.10E?01 8.53E?02 WDR35 NM_020779 6.58E?02 7.19E?02 7.91E?03 8.03E?02 BCAR1 NM_001170719 5.94E?02 2.89E?02 5.87E?02 7.99E?02 ANKRD66 NM_001162435 4.25E?02 2.94E?02 7.04E?02 8.91E?02 NGLY1 NM_001145294 4.38E?02 3.28E?02 5.44E?02 1.02E?01 UBE2NL NM_001012989 2.08E?02 3.34E?02 4.93E?02 1.31E?01 CYP1A2 NM_000761 5.43E?02 1.26E?01 1.10E?02 4.42E?02 TAAR2 NM_014626 3.75E?02 1.62E?02 7.81E?02 1.04E?01 ZMYM4 NM_005095 5.95E?03 4.31E?03 6.38E?02 1.61E?01 RPS3A NM_001006 6.72E?03 1.46E?02 3.90E?02 1.77E?01 FKBP2 NM_004470 9.13E?02 4.84E?02 4.66E?02 5.09E?02 ARNT NM_001668 1.09E?01 1.25E?01 4.54E?03 3.73E?04 UGT2B15 NM_001076 3.73E?02 1.02E?01 1.53E?02 8.70E?02 KCNRG NM_199464 8.41E?02 4.65E?02 4.72E?02 6.37E?02 CXCL5 NM_002994 1.18E?02 3.26E?03 1.19E?01 1.08E?01 ZBTB25 NM_006977 1.31E?01 5.58E?02 2.26E?02 3.35E?02 ZNF281 NM_001281294 1.14E?02 9.46E?03 1.48E?01 7.41E?02 PCDHA12 NM_018903 4.78E?03 5.25E?03 1.04E?01 1.31E?01 CDO1 NM_001801 4.22E?02 1.03E?03 1.31E?01 7.15E?02 BIN3 NM_018688 8.58E?02 1.39E?01 1.70E?03 2.08E?02 RIN2 NM_001242581 5.01E?02 1.31E?01 2.22E?02 4.51E?02 STK4 NM_006282 1.02E?01 5.90E?02 5.53E?02 3.19E?02 MYOM1 NM_019856 5.36E?02 3.12E?02 7.01E?02 9.56E?02 SMAD4 NM_005359 1.16E?01 9.56E?02 7.10E?03 3.49E?02 BBS5 NM_152384 1.60E?02 2.11E?02 1.54E?01 6.34E?02 NACC1 NM_052876 1.63E?01 6.55E?02 4.54E?03 2.18E?02 MITD1 NM_138798 1.91E?02 3.05E?02 1.76E?01 2.91E?02 BTN3A2 NM_001197249 9.53E?02 1.21E?01 3.61E?02 3.31E?03 NMU NM_006681 3.72E?02 5.47E?02 1.28E?01 3.61E?02 GABARAPL2 NM_007285 6.80E?02 5.88E?02 1.08E?01 2.28E?02 OLIG1 NM_138983 7.40E?02 1.49E?01 1.51E?02 2.10E?02 TBX21 NM_013351 1.05E?01 2.54E?02 5.20E?02 7.78E?02 SATB2 NM_015265 4.86E?02 6.23E?02 9.44E?02 5.48E?02 FGR NM_001042747 9.96E?02 1.07E?01 3.48E?02 2.13E?02 DCTN4 NM_001135643 2.52E?02 8.57E?02 1.06E?01 4.70E?02 C1QTNF9B-AS1 NM_001014442 4.69E?02 6.80E?02 8.45E?02 6.60E?02 CYP2S1 NM_030622 2.39E?02 9.48E?03 1.73E?01 6.04E?02 SLC1A1 NM_004170 5.20E?02 1.44E?01 2.25E?02 4.97E?02 CCDC88A NM_018084 5.21E?02 2.04E?02 4.02E?02 1.56E?01 C2orf88 NM_001042521 3.74E?03 3.21E?03 8.03E?02 1.83E?01 IL34 NM_001172772 2.05E?02 2.31E?02 3.24E?02 1.95E?01 COL11A1 NM_001190709 4.14E?02 3.90E?02 1.69E?01 2.16E?02 TMEM87B NM_032824 3.66E?02 1.02E?01 6.13E?02 7.16E?02 EBPL NM_001278636 3.91E?02 1.34E?01 7.57E?02 2.22E?02 SEPTIN9 NM_001113495 7.89E?02 1.11E?01 4.30E?02 3.97E?02 TSPY1 NM_001197242 1.87E?01 3.84E?02 1.62E?02 3.40E?02 RREB1 NM_001003699 2.09E?02 6.98E?02 5.12E?02 1.34E?01 AMMECR1L NM_031445 3.07E?02 1.86E?01 4.65E?02 1.35E?02 C1orf228 NM_001145636 8.16E?02 3.45E?02 4.50E?02 1.16E?01 MYL4 NM_001002841 8.17E?02 1.02E?01 2.84E?02 6.50E?02 REL NM_002908 1.70E?01 5.86E?02 2.52E?02 2.48E?02 ZNF675 NM_138330 9.47E?02 6.40E?02 6.72E?02 5.50E?02 KLRC1 NM_002259 2.46E?03 9.19E?03 1.80E?01 9.05E?02 ANO3 NM_031418 6.47E?02 3.23E?02 2.54E?02 1.60E?01 ACOT6 NM_001037162 6.20E?02 2.20E?01 4.42E?04 1.55E?04 FLNA NM_001110556 6.08E?02 2.28E?02 7.12E?02 1.28E?01 C9orf50 NM_199350 7.60E?03 9.24E?03 1.09E?01 1.58E?01 NLGN4Y NM_001206850 2.64E?02 3.12E?02 1.33E?01 9.36E?02 RPLP1 NM_213725 1.04E?03 1.87E?03 5.50E?02 2.27E?01 TBC1D2 NM_001267572 1.25E?02 5.76E?02 5.68E?02 1.58E?01 PAMR1 NM_001001991 1.13E?01 1.15E?01 2.35E?02 3.33E?02 NOTCH1 NM_017617 4.13E?02 8.10E?02 3.00E?02 1.35E?01 MAGEA11 NM_005366 9.25E?02 8.37E?02 8.01E?02 3.28E?02 AMZ1 NM_001284355 7.75E?02 7.83E?02 2.41E?02 1.12E?01 GPHN NM_020806 3.04E?02 2.24E?02 5.78E?02 1.82E?01 SOCS2 NM_001270468 2.40E?03 3.16E?02 1.17E?01 1.42E?01 HIST1H2BM NM_003521 1.08E?01 6.06E?02 8.24E?03 1.17E?01 KRT31 NM_002277 1.67E?01 1.13E?01 8.49E?03 6.75E?03 SECISBP2 NM_001282690 1.53E?02 6.14E?02 1.89E?02 2.00E?01 SMPDL3B NM_001009568 2.73E?02 1.92E?03 3.43E?02 2.32E?01 ARHGAP27 NM_001282290 7.66E?03 2.57E?02 1.44E?01 1.18E?01 PM20D2 NM_001010853 1.36E?03 6.28E?02 4.19E?02 1.90E?01 ZFP62 NM_152283 8.20E?02 1.48E?01 2.31E?02 4.35E?02 BAMBI NM_012342 3.97E?02 1.97E?02 1.33E?01 1.05E?01 CSTF1 NM_001033522 3.02E?02 6.93E?02 1.52E?01 4.72E?02 TRAF3 NM_001199427 9.13E?02 9.01E?02 5.21E?02 6.54E?02 ZNF385B NM_001113398 1.55E?01 1.20E?01 8.72E?03 1.64E?02 FAM64A NM_001195228 1.08E?01 1.22E?01 4.43E?02 2.72E?02 NOL4 NM_001198549 6.84E?02 5.52E?02 1.31E?01 4.77E?02 PSMC1 NM_002802 3.06E?02 6.26E?02 6.19E?02 1.47E?01 FAM53C NM_001135647 5.38E?02 6.09E?02 4.52E?02 1.43E?01 CSTB NM_000100 1.98E?01 5.98E?02 3.53E?02 1.06E?02 AKNA NM_030767 7.16E?03 1.23E?02 1.76E?01 1.09E?01 NGFR NM_002507 6.21E?02 9.96E?02 1.92E?02 1.23E?01 FAM175A NM_139076 2.68E?02 1.24E?02 5.43E?02 2.11E?01 DNMT3B NM_175850 3.17E?02 6.16E?02 1.07E?01 1.06E?01 P2RX5 NM_001204519 1.23E?01 1.77E?01 1.11E?03 6.18E?03 KCNQ5 NM_001160130 7.71E?02 7.18E?02 9.38E?02 6.44E?02 FRAT2 NM_012083 1.78E?03 7.13E?04 1.06E?01 1.99E?01 KRTAP21-2 NM_181617 1.24E?01 1.09E?01 3.33E?02 4.25E?02 PDC NM_022576 8.59E?03 3.56E?02 2.14E?02 2.44E?01 UBAC2 NM_001144072 5.37E?02 3.48E?02 1.29E?01 9.47E?02 ZNF548 NM_001172773 4.05E?02 1.12E?02 1.06E?01 1.55E?01 SPARCL1 NM_001128310 6.02E?03 3.15E?02 1.60E?01 1.16E?01 TTC38 NM_017931 6.77E?02 9.54E?02 6.70E?02 8.38E?02 TBX20 NM_001077653 7.80E?02 2.97E?02 5.74E?02 1.49E?01 CLEC19A NM_001256720 1.24E?02 8.38E?03 2.34E?02 2.70E?01 RBFOX1 NM_001142333 1.01E?01 5.64E?02 9.43E?02 6.27E?02 PCGF5 NM_032373 5.17E?02 1.35E?01 3.99E?02 8.77E?02 STEAP2 NM_001040666 4.54E?03 2.75E?02 8.22E?02 2.00E?01 OTOP1 NM_177998 1.75E?01 4.05E?02 1.55E?02 8.40E?02 DPP6 NM_001039350 2.70E?02 9.94E?03 2.29E?02 2.56E?01 FADD NM_003824 1.13E?01 2.91E?02 7.55E?02 9.79E?02 MOBP NM_182935 9.97E?03 1.30E?02 8.45E?02 2.08E?01 RPS27A NM_001135592 1.90E?01 1.17E?01 4.65E?03 3.94E?03 MAFF NM_001161573 4.37E?02 9.33E?02 8.31E?02 9.60E?02 CLCA2 NM_006536 1.00E?01 1.11E?01 1.84E?02 8.71E?02 CHMP1A NM_001083314 8.71E?04 2.15E?02 1.53E?01 1.42E?01 CLIC6 NM_053277 2.15E?02 1.08E?01 1.75E?01 1.38E?02 PHF1 NM_002636 3.68E?02 8.08E?02 8.58E?02 1.16E?01 ORAI3 NM_152288 3.11E?02 3.95E?02 1.71E?01 7.84E?02 CDKN1A NM_001220778 5.97E?02 4.70E?02 5.95E?02 1.54E?01 LSMEM2 NM_153215 1.45E?01 7.51E?02 6.55E?02 3.44E?02 CBL NM_005188 7.66E?02 1.78E?01 3.08E?02 3.53E?02 KCNK6 NM_004823 4.21E?02 2.12E?02 9.08E?02 1.67E?01 BCL6 NM_001706 8.26E?02 6.28E?02 1.15E?02 1.64E?01 KRTAP10-2 NM_198693 4.34E?02 8.20E?02 4.48E?02 1.53E?01 MAP2K5 NM_001206804 1.28E?02 8.59E?02 7.37E?02 1.53E?01 SEPP1 NM_005410 2.75E?02 4.19E?02 1.67E?01 8.92E?02 CHCHD4 NM_001098502 3.44E?02 6.38E?03 1.00E?01 1.85E?01 SRBD1 NM_018079 3.65E?02 1.23E?01 1.26E?01 4.03E?02 CNTNAP3B NM_001201380 1.36E?01 2.13E?02 3.77E?02 1.31E?01 CIZ1 NM_001131015 1.55E?01 9.64E?02 4.40E?02 3.15E?02 COX7C NM_001867 8.18E?02 2.46E?02 9.23E?02 1.28E?01 PDF NM_022341 8.26E?02 3.11E?02 3.78E?02 1.76E?01 TECPR1 NM_015395 8.29E?02 4.70E?02 9.81E?02 9.99E?02 IGJ NM_144646 5.75E?02 1.14E?01 5.57E?02 1.01E?01 CCDC30 NM_001080850 7.21E?02 1.87E?01 2.08E?02 4.87E?02 ABCA2 NM_212533 2.20E?02 4.81E?02 8.89E?02 1.70E?01 AKR7A2 NM_003689 1.13E?01 8.73E?02 1.24E?01 4.59E?03 KLK1 NM_002257 3.97E?02 9.12E?03 1.59E?01 1.21E?01 ALS2CL NM_001190707 6.30E?02 1.41E?01 2.78E?02 9.85E?02 PRIM2 NM_001282488 1.97E?01 8.87E?02 4.26E?02 1.98E?03 PPIC NM_000943 3.16E?02 4.53E?02 1.37E?01 1.19E?01 EGR3 NM_004430 1.39E?01 1.02E?01 1.98E?02 7.24E?02 ANKRD35 NM_001280799 1.57E?02 1.80E?02 1.58E?01 1.41E?01 OR5K4 NM_001005517 3.36E?02 1.86E?02 7.78E?02 2.04E?01 DNAH14 NM_144989 7.77E?02 5.69E?02 5.16E?02 1.48E?01 ATF7IP NM_018179 7.14E?02 8.19E?02 7.56E?02 1.07E?01 ESRRB NM_004452 9.83E?02 1.10E?01 5.54E?02 7.24E?02 GNPDA2 NM_138335 1.79E?01 1.73E?02 1.32E?01 8.34E?03 DEFB127 NM_139074 2.34E?01 1.03E?01 6.82E?05 1.21E?04 ATAD3B NM_031921 1.57E?02 3.27E?02 1.50E?01 1.38E?01 MEIS2 NM_172315 5.25E?03 3.35E?03 2.72E?01 5.71E?02 STX1B NM_052874 1.03E?01 1.14E?01 1.01E?01 2.06E?02 CHD1L NM_001256336 6.88E?02 1.76E?01 5.45E?02 3.93E?02 SEBOX NM_001080837 3.02E?02 4.55E?02 2.61E?01 2.63E?03 ERMP1 NM_024896 2.34E?02 1.23E?01 1.17E?01 7.78E?02 MSH6 NM_001281494 2.05E?02 4.91E?02 2.33E?01 3.88E?02 BTBD7 NM_001289133 1.07E?01 1.30E?01 2.28E?02 8.30E?02 PPP1R1B NM_032192 6.45E?03 1.66E?02 2.64E?01 5.55E?02 CELF2 NM_001083591 4.41E?02 1.38E?01 5.05E?02 1.10E?01 TMEM213 NM_001085429 8.18E?02 1.08E?01 7.33E?02 7.98E?02 USP5 NM_003481 4.39E?02 6.29E?02 6.39E?02 1.73E?01 HLA-DMA NM_006120 3.72E?03 2.57E?02 1.83E?01 1.31E?01 SNX20 NM_001144972 6.43E?02 1.30E?01 5.19E?02 9.82E?02 ZNF395 NM_018660 1.58E?01 1.25E?02 1.69E?01 3.83E?03 CENPE NM_001813 2.94E?02 8.34E?02 1.64E?01 6.80E?02 C18orf8 NM_001276342 1.91E?01 7.06E?02 5.00E?02 3.39E?02 HOXC13 NM_017410 2.64E?02 2.07E?02 9.91E?02 2.01E?01 ASB2 NM_001202429 7.13E?02 4.24E?02 1.71E?01 6.29E?02 SEPTIN1 NM_052838 3.86E?02 1.90E?01 9.99E?02 1.94E?02 WDR74 NM_018093 3.46E?02 4.60E?02 7.92E?02 1.88E?01 ZNF573 NM_152360 5.01E?02 2.72E?02 1.01E?01 1.71E?01 SLC25A24 NM_013386 1.47E?01 1.45E?01 1.85E?02 3.80E?02 LTA4H NM_001256643 1.41E?01 7.55E?02 8.67E?02 4.64E?02 DIRAS2 NM_017594 1.30E?01 3.25E?02 2.22E?02 1.67E?01 GJB6 NM_006783 2.66E?02 2.67E?02 2.06E?01 9.15E?02 EMP1 NM_001423 6.28E?02 7.40E?02 1.26E?02 2.02E?01 TES NM_152829 1.60E?01 9.27E?02 1.65E?02 8.19E?02 CPXCR1 NM_033048 4.21E?02 5.08E?02 5.12E?02 2.09E?01 C6orf58 NM_001010905 2.04E?02 2.77E?02 2.51E?01 5.35E?02 HDAC9 NM_178425 4.46E?02 9.25E?02 4.93E?02 1.68E?01 TRAPPC11 NM_021942 3.67E?02 8.02E?03 1.58E?01 1.52E?01 RNLS NM_018363 2.78E?03 2.11E?03 3.26E?01 2.45E?02 MS4A2 NM_001256916 1.89E?01 1.16E?01 2.20E?02 3.02E?02 COL9A3 NM_001853 1.69E?01 1.31E?01 1.10E?02 4.72E?02 HTR6 NM_000871 9.08E?02 1.08E?01 1.02E?01 5.72E?02 CATSPERB NM_024764 1.42E?01 1.60E?01 3.62E?02 1.97E?02 HYAL4 NM_012269 5.77E?02 5.48E?02 5.79E?02 1.88E?01 MTHFD2 NM_006636 3.49E?02 1.89E?01 3.58E?02 9.94E?02 NLRC4 NM_021209 6.56E?02 1.54E?01 8.21E?02 5.82E?02 ANXA8 NM_001271702 1.27E?01 2.18E?01 1.10E?02 4.69E?03 SPATS2L NM_001282735 1.73E?03 3.54E?02 8.06E?02 2.43E?01 MAP3K13 NM_001242317 6.32E?02 1.19E?01 9.16E?02 8.74E?02 SFMBT2 NM_001018039 1.33E?01 2.11E?01 1.21E?02 5.29E?03 LHX9 NM_020204 7.80E?02 5.45E?02 1.15E?01 1.14E?01 RSLID1 NM_015659 1.11E?02 1.84E?02 1.54E?01 1.80E?01 FBLIM1 NM_001024216 3.68E?02 1.26E?01 6.47E?02 1.36E?01 KRTAP13-2 NM_181621 5.59E?02 1.71E?01 5.81E?02 7.85E?02 NUS1 NM_138459 1.40E?01 1.20E?01 3.62E?02 6.81E?02 PRICKLE1 NM_153026 9.74E?02 1.15E?01 1.14E?01 3.95E?02 TEX33 NM_001163857 1.39E?01 1.76E?02 1.32E?01 7.69E?02 TMEM255B NM_182614 1.23E?01 1.49E?01 4.74E?02 4.75E?02 DEGS1 NM_003676 1.76E?01 5.71E?02 8.08E?02 5.50E?02 WDR33 NM_018383 1.24E?01 1.83E?01 6.06E?02 1.37E?03 RHOG NM_001665 1.94E?01 1.39E?01 3.51E?02 2.52E?03 LIN54 NM_001115007 1.34E?01 6.20E?02 1.25E?01 4.87E?02 STAM NM_003473 1.35E?01 9.36E?02 8.32E?02 5.90E?02 SPIN2B NM_001006683 1.75E?02 1.56E?01 7.62E?02 1.21E?01 RAD54B NM_012415 1.24E?01 2.13E?01 1.20E?02 2.28E?02 SDR39U1 NM_001290292 1.93E?01 8.77E?02 8.97E?02 1.55E?03 TAPT1 NM_153365 3.71E?02 4.29E?02 6.67E?02 2.26E?01 APC NM_001127510 9.95E?02 1.62E?01 8.73E?03 1.03E?01 RORC NM_005060 2.20E?02 2.85E?01 3.50E?02 3.21E?02 HMCES NM_020187 1.46E?01 4.71E?02 1.06E?01 7.44E?02 TCEAL2 NM_080390 1.00E?01 1.32E?02 1.35E?01 1.26E?01 AP5S1 NM_018347 4.79E?02 8.25E?02 1.21E?01 1.22E?01 SERINC1 NM_020755 8.45E?02 1.34E?01 1.36E?02 1.43E?01 LHX3 NM_014564 1.52E?02 1.12E?02 2.54E?01 9.51E?02 TMEM25 NM_032780 7.76E?03 5.26E?03 2.73E?01 9.04E?02 C8orf76 NM_032847 2.31E?01 1.45E?01 7.51E?05 1.45E?04 PIGS NM_033198 7.00E?02 5.23E?02 1.13E?01 1.42E?01 CHST8 NM_001127895 1.50E?01 5.15E?02 1.19E?01 5.67E?02 CHERP NM_006387 9.40E?02 2.94E?02 1.12E?01 1.43E?01 TMEM234 NM_019118 6.45E?02 7.52E?02 1.43E?01 9.63E?02 CYP3A43 NM_057096 2.83E?02 2.00E?01 1.76E?02 1.35E?01 CORO1B NM_020441 2.14E?01 1.38E?01 7.96E?03 2.15E?02 WBSCR16 NM_148842 1.26E?01 1.74E?01 5.39E?02 2.78E?02 PTPRCAP NM_005608 6.01E?02 6.64E?02 1.03E?01 1.54E?01 FHDC1 NM_033393 3.93E?02 7.92E?02 1.18E?01 1.47E?01 PILRA NM_178273 1.87E?01 1.20E?01 1.99E?02 5.83E?02 ZNF583 NM_152478 2.40E?01 1.17E?01 1.37E?02 1.45E?02 IFT81 NM_014055 6.10E?02 3.00E?01 1.66E?02 7.87E?03 TCTE3 NM_174910 4.91E?02 2.92E?01 1.96E?02 2.44E?02 ACADVL NM_001270447 1.76E?01 1.85E?01 9.63E?03 1.59E?02 OSGIN2 NM_004337 9.50E?02 2.11E?01 5.95E?02 2.04E?02 SMC4 NM_001288753 8.17E?03 1.42E?02 1.40E?01 2.23E?01 PRELID2 NM_138492 1.36E?01 1.98E?01 3.70E?02 1.62E?02 KRT20 NM_019010 2.61E?02 2.93E?02 1.32E?01 2.00E?01 SRSF9 NM_003769 2.57E?01 1.17E?01 1.08E?02 4.78E?03 ITFG2 NM_018463 1.18E?01 1.48E?01 1.07E?01 1.65E?02 CASC1 NM_001204102 8.71E?02 1.64E?01 7.65E?02 6.14E?02 NKX2-1 NM_001079668 3.04E?02 6.60E?02 1.86E?03 2.91E?01 CD72 NM_001782 6.36E?02 4.50E?02 8.90E?02 1.92E?01 DDX3Y NM_001122665 1.81E?01 1.03E?01 3.28E?02 7.30E?02 SLC16A11 NM_153357 1.83E?01 1.74E?01 1.31E?02 1.90E?02 ACYP1 NM_001107 7.38E?02 4.30E?02 1.65E?01 1.07E?01 KRTCAP2 NM_173852 6.96E?02 2.69E?02 1.00E?01 1.93E?01 CNPY3 NM_006586 1.86E?01 8.36E?02 3.65E?02 8.40E?02 CABYR NM_153770 4.97E?02 3.87E?02 1.64E?01 1.37E?01 PREPL NM_006036 1.04E?01 1.49E?01 8.63E?02 5.13E?02 IQCJ-SCHIP1 NM_001197113 6.57E?03 2.70E?02 8.32E?02 2.73E?01 C6orf211 NM_001286562 3.50E?02 8.65E?02 9.20E?02 1.78E?01 LOC100129520 NM_001195272 1.19E?01 8.83E?02 5.22E?02 1.32E?01 SREK1IP1 NM_173829 3.15E?02 5.42E?02 2.07E?01 1.00E?01 NAV3 NM_014903 3.69E?03 1.27E?02 8.54E?02 2.91E?01 ARID1B NM_020732 1.01E?01 1.56E?01 7.77E?02 5.74E?02 PRDM10 NM_199439 9.82E?02 1.28E?01 9.79E?02 6.88E?02 TOR1A NM_000113 8.78E?02 3.41E?02 1.16E?01 1.56E?01 HES1 NM_005524 3.95E?03 7.82E?03 8.38E?02 2.99E?01 CHID1 NM_001142675 7.52E?02 2.26E?01 6.35E?02 2.96E?02 COX14 NM_001257134 7.25E?04 1.26E?03 2.00E?01 1.93E?01 F8 NM_000132 1.93E?01 1.05E?01 8.60E?02 1.12E?02 PQBP1 NM_001167990 1.79E?01 1.81E?01 3.09E?02 5.08E?03 TK2 NM_001271934 2.35E?02 3.56E?02 1.46E?01 1.92E?01 COMTD1 NM_144589 4.83E?02 8.43E?02 5.92E?02 2.08E?01 ALKBH8 NM_138775 1.06E?01 4.79E?02 1.84E?01 6.22E?02 XRCC6BP1 NM_033276 3.81E?02 6.76E?02 2.41E?01 5.32E?02 DEFA6 NM_001926 5.30E?02 1.34E?02 1.31E?01 2.03E?01 ETV3L NM_001004341 1.44E?01 1.62E?01 5.06E?02 4.35E?02 LNX2 NM_153371 1.49E?01 6.34E?02 5.76E?02 1.31E?01 MNAT1 NM_002431 9.82E?02 1.02E?01 2.27E?02 1.78E?01 CREM NM_182724 1.19E?01 2.27E?01 1.01E?02 4.56E?02 DTNA NM_001198944 1.16E?01 1.05E?01 1.41E?01 3.88E?02 GPR149 NM_001038705 2.31E?01 1.43E?01 9.84E?03 1.77E?02 GALK2 NM_001001556 8.10E?03 2.79E?02 1.85E?01 1.81E?01 COQ2 NM_015697 5.74E?02 6.34E?02 1.52E?01 1.30E?01 STAP2 NM_017720 2.73E?02 2.58E?01 4.63E?02 7.20E?02 CALHM1 NM_001001412 1.11E?01 5.00E?02 8.20E?02 1.61E?01 RXRB NM_021976 5.92E?02 7.73E?02 1.62E?01 1.06E?01 HIST1H4F NM_003540 1.62E?01 2.23E?01 7.68E?03 1.27E?02 PRDM13 NM_021620 1.51E?02 6.09E?03 2.09E?01 1.77E?01 PELO NM_015946 5.39E?03 1.93E?02 1.52E?01 2.31E?01 WIBG NM_001143853 8.40E?02 1.36E?01 1.20E?01 6.84E?02 UBE2J1 NM_016021 1.60E?01 2.40E?01 5.92E?03 4.04E?03 SDHB NM_003000 1.31E?01 2.44E?01 3.14E?02 2.81E?03 EIF1AD NM_001242484 7.31E?02 1.38E?01 1.50E?01 5.04E?02 DGCR6L NM_033257 4.14E?02 1.09E?01 2.11E?01 5.07E?02 SLC7A5 NM_003486 1.88E?01 1.64E?01 4.73E?02 1.35E?02 MYADM NM_001020818 8.89E?02 5.87E?02 1.28E?01 1.37E?01 CAMKK2 NM_172226 8.65E?02 6.69E?02 2.53E?01 6.54E?03 ZNF667 NM_022103 1.77E?01 3.65E?02 1.46E?01 5.46E?02 TRIM64C NM_001206631 1.55E?01 7.12E?02 5.37E?02 1.34E?01 ACP6 NM_016361 1.77E?01 1.63E?01 6.70E?02 7.58E?03 YOD1 NM_018566 1.08E?01 7.92E?02 1.36E?01 9.10E?02 TSHZ1 NM_005786 2.32E?02 8.95E?02 1.10E?01 1.92E?01 IDH2 NM_001289910 3.37E?02 8.92E?02 1.63E?01 1.30E?01 AKR1C1 NM_001353 5.19E?02 3.96E?02 2.33E?01 9.34E?02 MAML1 NM_014757 1.12E?01 1.52E?02 1.60E?01 1.32E?01 KRTAP26-1 NM_203405 4.75E?03 1.85E?02 2.09E?01 1.86E?01 IFT80 NM_001190241 1.38E?01 1.89E?01 5.02E?02 4.16E?02 MLPH NM_001281473 1.13E?02 1.28E?02 3.12E?01 8.29E?02 SEMA4G NM_001203244 1.69E?02 9.93E?02 1.68E?01 1.35E?01 VAT1L NM_020927 2.09E?02 2.15E?02 2.66E?01 1.12E?01 RAB41 NM_001032726 1.20E?01 1.05E?01 1.21E?01 7.53E?02 CELA2B NM_015849 2.13E?04 1.57E?04 4.24E?02 3.79E?01 H2AFY2 NM_018649 8.86E?02 1.13E?01 1.74E?01 4.58E?02 TMED2 NM_006815 9.94E?02 9.17E?02 8.26E?02 1.49E?01 PPFIBP2 NM_003621 3.36E?02 4.55E?02 8.97E?02 2.54E?01 ARHGAP29 NM_004815 6.11E?02 1.15E?02 7.58E?02 2.75E?01 MAGEE1 NM_020932 1.54E?02 7.41E?02 1.96E?01 1.39E?01 KDELC1 NM_024089 8.49E?02 1.37E?01 1.68E?01 3.41E?02 RING1 NM_002931 2.89E?01 6.33E?02 1.86E?02 5.45E?02 TMEM116 NM_001193453 2.93E?01 7.19E?02 1.67E?02 4.43E?02 MARVELD3 NM_052858 2.98E?01 6.11E?02 4.37E?02 2.35E?02 OR9K2 NM_001005243 1.21E?01 1.14E?01 1.41E?01 5.11E?02 TSEN34 NM_001282333 2.61E?01 5.68E?02 8.67E?02 2.19E?02 HAPLN4 NM_023002 2.29E?01 9.75E?03 1.20E?01 6.79E?02 HRASLS5 NM_054108 1.20E?01 1.65E?01 4.46E?02 9.77E?02 COX4I2 NM_032609 1.86E?01 1.86E?01 1.30E?02 4.22E?02 SLC45A3 NM_033102 9.38E?02 6.36E?02 8.78E?02 1.83E?01 AATF NM_012138 7.46E?02 7.42E?02 9.78E?02 1.82E?01 SMIM12 NM_138428 5.62E?02 1.54E?01 1.73E?01 4.71E?02 LPPR5 NM_001037317 2.04E?01 1.52E?01 4.91E?02 2.53E?02 SMIM13 NM_001135575 9.51E?02 6.75E?02 5.76E?02 2.10E?01 SLC39A1 NM_001271958 1.67E?01 1.73E?01 2.02E?02 7.08E?02 ELAC2 NM_001165962 2.14E?01 1.32E?01 1.76E?02 6.90E?02 LOC100131303 NM_001282442 2.76E?03 2.52E?03 3.94E?02 3.89E?01 SETD1A NM_014712 6.80E?02 1.49E?01 1.65E?01 5.16E?02 MASP2 NM_006610 1.61E?01 9.03E?02 1.02E?01 8.00E?02 BAHD1 NM_014952 1.64E?01 1.25E?01 8.64E?02 5.91E?02 CDK19 NM_015076 1.71E?03 1.07E?03 3.24E?01 1.08E?01 SLCO1B3 NM_019844 1.54E?01 1.82E?01 2.38E?02 7.51E?02 ITPRIPL2 NM_001034841 1.25E?01 1.42E?01 1.41E?01 2.71E?02 GATA1 NM_002049 9.91E?02 1.94E?01 6.17E?02 8.06E?02 FUT4 NM_002033 3.13E?02 3.14E?02 1.98E?01 1.75E?01 FAM156B NM_001099684 1.81E?01 2.15E?01 1.71E?02 2.40E?02 OR5H6 NM_001005479 9.15E?03 3.04E?02 1.46E?01 2.52E?01 MAGEC3 NM_138702 5.90E?02 8.05E?02 1.75E?01 1.23E?01 MAP3K3 NM_203351 1.66E?01 2.40E?01 2.97E?03 2.93E?02 IMP3 NM_018285 1.57E?01 4.68E?02 9.37E?02 1.41E?01 LMOD1 NM_012134 1.97E?01 1.76E?01 2.55E?02 3.99E?02 ARHGAP18 NM_033515 8.10E?03 1.57E?02 2.63E?01 1.54E?01 KCNIP4 NM_001035004 3.44E?02 7.57E?02 1.10E?01 2.21E?01 SKA1 NM_145060 1.21E?01 1.89E?01 1.62E?02 1.15E?01 METRN NM_024042 2.12E?02 3.02E?03 3.50E?01 6.74E?02 CEACAM1 NM_001024912 5.36E?02 2.55E?02 9.43E?02 2.68E?01 PKD2L2 NM_001258449 1.14E?01 1.92E?01 5.68E?02 7.91E?02 PUM2 NM_001282791 6.90E?02 1.77E?01 2.95E?02 1.68E?01 REPS1 NM_001128617 5.53E?02 1.49E?01 1.53E?01 8.74E?02 HIST1H4J NM_021968 8.29E?02 6.05E?02 2.37E?01 6.51E?02 LRRC29 NM_001004055 2.15E?01 1.83E?01 1.39E?02 3.40E?02 SMIM5 NM_001162995 6.71E?02 7.41E?02 7.88E?02 2.26E?01 STAT3 NM_213662 7.42E?02 1.81E?01 6.86E?03 1.84E?01 PBRM1 NM_018313 1.66E?01 8.39E?02 2.56E?02 1.72E?01 ISLR2 NM_001130136 1.86E?01 5.17E?02 1.54E?01 5.58E?02 PLEKHF1 NM_024310 1.68E?01 3.23E?02 8.59E?02 1.61E?01 C2orf50 NM_182500 1.55E?01 1.28E?01 6.36E?02 1.01E?01 INPP5A NM_005539 4.07E?02 1.50E?01 2.90E?02 2.29E?01 ELP5 NM_015362 1.21E?01 1.72E?01 1.18E?01 3.77E?02 DLK2 NM_023932 1.29E?01 1.03E?01 8.37E?02 1.33E?01 MTA2 NM_004739 1.52E?01 7.42E?02 1.82E?01 4.19E?02 SPTBN1 NM_003128 6.26E?02 4.67E?03 2.77E?01 1.07E?01 DEDD NM_001039712 2.50E?01 1.32E?01 4.30E?02 2.79E?02 PFKFB2 NM_006212 2.41E?01 7.34E?02 1.08E?01 3.07E?02 CPNE8 NM_153634 1.96E?01 1.88E?01 4.78E?02 2.24E?02 PRR35 NM_145270 1.33E?01 2.08E?01 9.34E?02 1.86E?02 PHF21A NM_016621 2.13E?01 5.21E?02 7.38E?02 1.14E?01 RANBP10 NM_020850 1.86E?02 5.53E?02 1.40E?01 2.41E?01 CCDC22 NM_014008 1.47E?01 1.71E?01 7.13E?02 6.53E?02 ISLR2 NM_001130137 9.77E?02 4.76E?02 1.32E?01 1.78E?01 STPG1 NM_001199012 1.01E?01 2.51E?01 2.50E?02 7.85E?02 TAL1 NM_003189 8.62E?02 7.89E?02 1.24E?01 1.67E?01 LINC01272 NM_001278655 3.63E?02 3.98E?02 2.80E?01 9.98E?02 N4BP2L2 NM_014887 1.64E?02 3.59E?03 1.67E?01 2.70E?01 BCAT1 NM_001178093 1.62E?01 1.08E?01 1.80E?01 7.29E?03 CNGB1 NM_001297 4.32E?02 1.73E?01 7.47E?02 1.67E?01 USP9X NM_001039590 1.42E?01 1.20E?01 8.49E?02 1.12E?01 VSTM2B NM_001146339 5.85E?02 1.37E?01 1.06E?01 1.59E?01 ABCC8 NM_001287174 1.18E?03 1.06E?03 2.38E?01 2.19E?01 OR2AG2 NM_001004490 3.95E?02 7.97E?02 1.55E?01 1.86E?01 COMMD1 NM_152516 2.65E?02 1.92E?02 2.60E?01 1.55E?01 TMCO2 NM_001008740 3.68E?02 6.02E?02 2.21E?01 1.43E?01 HOXA4 NM_002141 1.29E?01 1.33E?01 7.57E?02 1.24E?01 G0S2 NM_015714 1.03E?01 2.93E?02 2.41E?01 8.80E?02 KLF7 NM_001270942 5.39E?02 1.87E?02 3.23E?01 6.61E?02 PRAF2 NM_007213 1.38E?01 1.92E?01 2.73E?02 1.04E?01 TPP1 NM_000391 2.22E?02 2.32E?02 9.17E?02 3.25E?01 PIRT NM_001101387 2.09E?01 1.53E?01 6.55E?02 3.58E?02 CXCL1 NM_001511 2.05E?01 1.96E?01 3.82E?02 2.47E?02 PRSS1 NM_002769 9.53E?02 1.49E?01 2.13E?01 7.41E?03 ZFP28 NM_020828 9.52E?03 5.37E?03 2.58E?01 1.92E?01 CEP83 NM_001042399 4.08E?02 6.87E?02 1.31E?01 2.24E?01 NGDN NM_015514 2.07E?01 5.99E?02 7.47E?02 1.23E?01 SSX7 NM_173358 1.27E?01 3.27E?01 2.77E?03 8.41E?03 APBB1IP NM_019043 1.41E?02 1.19E?02 1.53E?01 2.87E?01 OR52D1 NM_001005163 1.30E?01 3.01E?02 1.10E?01 1.96E?01 GTF2F1 NM_002096 6.08E?02 9.78E?02 6.81E?02 2.40E?01 RPS27A NM_001177413 1.63E?01 3.66E?02 2.27E?02 2.45E?01 HSD17B1 NM_000413 1.05E?01 1.31E?01 1.76E?01 5.69E?02 TCF23 NM_175769 2.78E?02 3.09E?02 3.99E?01 1.05E?02 DHX33 NM_001199699 1.72E?01 1.45E?01 1.14E?01 3.86E?02 MARCO NM_006770 8.32E?02 1.24E?01 1.99E?01 6.27E?02 TAL2 NM_005421 1.39E?02 1.10E?01 2.73E?01 7.28E?02 SNN NM_003498 1.13E?01 2.09E?01 9.52E?02 5.20E?02 IMMP1L NM_144981 1.18E?01 6.45E?02 3.00E?02 2.58E?01 TDRD10 NM_182499 2.01E?01 2.20E?01 2.94E?02 1.92E?02 TBL1X NM_001139467 4.08E?02 9.20E?02 2.07E?01 1.31E?01 MGAT5B NM_001199172 2.30E?01 2.30E?01 8.37E?03 2.40E?03 MAFA NM_201589 1.57E?01 1.74E?01 1.31E?02 1.26E?01 PDXDC1 NM_015027 3.77E?02 1.14E?01 1.28E?01 1.92E?01 TBC1D4 NM_014832 1.88E?01 8.43E?02 8.30E?02 1.17E?01 ZBTB7B NM_001252406 1.64E?01 1.31E?01 1.18E?01 5.90E?02 FIGN NM_018086 1.31E?01 1.13E?01 9.22E?02 1.36E?01 LIPT1 NM_145198 6.15E?02 8.32E?02 2.70E?01 5.81E?02 TMC5 NM_001261841 4.80E?02 4.18E?02 3.34E?02 3.50E?01 FBXO42 NM_018994 1.91E?01 1.94E?01 4.41E?02 4.43E?02 ASZ1 NM_130768 2.19E?02 4.94E?03 1.78E?01 2.69E?01 HERPUD2 NM_022373 2.72E?01 9.80E?02 9.97E?02 4.54E?03 LGALS9C NM_001040078 2.32E?02 4.06E?02 1.81E?01 2.30E?01 SPTBN1 NM_178313 3.12E?01 1.60E?01 2.07E?03 8.67E?04 SLC35C1 NM_018389 4.24E?02 6.17E?02 2.91E?01 8.15E?02 UBASH3B NM_032873 6.59E?02 2.48E?01 9.47E?02 6.84E?02 CHST5 NM_024533 8.46E?02 6.11E?02 2.45E?01 8.65E?02 RNF121 NM_018320 8.03E?02 3.64E?01 6.97E?03 2.54E?02 IPO4 NM_024658 1.83E?01 2.21E?01 5.25E?02 2.00E?02 KLK7 NM_005046 3.64E?01 9.49E?02 1.32E?02 5.39E?03 VSX2 NM_182894 1.53E?02 4.84E?03 2.91E?01 1.67E?01 MDM2 NM_002392 2.87E?02 6.55E?02 3.19E?02 3.54E?01 GBP4 NM_052941 2.78E?02 2.25E?02 2.93E?01 1.37E?01 AMPD1 NM_000036 6.89E?02 1.01E?01 1.54E?01 1.57E?01 OR4C11 NM_001004700 2.80E?01 1.60E?01 1.29E?02 2.82E?02 CCDC104 NM_001282761 7.44E?02 1.00E?01 2.80E?01 2.73E?02 HTR2A NM_001165947 1.77E?02 3.09E?01 6.41E?02 9.08E?02 TDRD3 NM_001146070 9.01E?02 3.09E?01 1.28E?02 7.04E?02 SAMD3 NM_001258275 4.95E?03 7.24E?03 5.48E?02 4.16E?01 LIN7A NM_004664 1.97E?01 6.13E?02 1.16E?01 1.09E?01 C16orf74 NM_206967 1.23E?01 3.19E?02 2.90E?01 3.78E?02 UQCRHL NM_001089591 6.74E?02 9.98E?02 1.44E?01 1.72E?01 ACADVL NM_000018 2.57E?02 6.48E?02 3.15E?01 7.76E?02 GUCY1A3 NM_001130684 1.47E?02 4.65E?02 2.14E?01 2.09E?01 GLB1 NM_001135602 1.43E?01 8.76E?02 1.34E?01 1.21E?01 MAST3 NM_015016 8.28E?02 2.04E?02 2.60E?01 1.22E?01 ARMCX3 NM_016607 7.74E?02 7.56E?02 1.43E?01 1.90E?01 C1orf85 NM_001256608 1.45E?01 3.13E?02 8.43E?02 2.25E?01 MYO1B NM_001161819 1.85E?02 3.80E?02 1.18E?01 3.11E?01 CCDC7 NM_145023 4.53E?02 3.60E?02 1.77E?01 2.27E?01 DLG4 NM_001365 1.57E?01 1.20E?01 6.42E?02 1.45E?01 ATP6V1C1 NM_001695 2.14E?01 2.37E?01 2.43E?02 1.02E?02 FAM78A NM_033387 2.25E?01 3.56E?02 1.11E?01 1.15E?01 FOXN1 NM_003593 1.34E?01 2.71E?01 4.32E?02 3.81E?02 CDKN2A NM_000077 2.72E?01 2.03E?01 8.10E?03 4.37E?03 ELL2 NM_012081 9.65E?02 2.12E?01 1.41E?01 3.71E?02 RIIAD1 NM_001144956 3.37E?01 1.47E?01 2.05E?03 1.92E?03 PRKAG3 NM_017431 7.90E?02 5.65E?02 1.82E?01 1.70E?01 HPSE2 NM_001166244 1.60E?01 2.51E?01 1.32E?02 6.30E?02 OR51I1 NM_001005288 2.22E?01 1.90E?01 7.70E?03 6.87E?02 XRCC2 NM_005431 2.33E?02 6.25E?02 1.98E?01 2.05E?01 PPP2R2C NM_001206996 8.06E?02 1.79E?01 7.40E?02 1.55E?01 ATF6 NM_007348 1.69E?01 2.66E?01 2.71E?02 2.67E?02 ETV6 NM_001987 9.22E?02 6.90E?02 9.05E?02 2.37E?01 NAIP NM_004536 1.54E?02 1.09E?01 2.35E?01 1.30E?01 XAGE1E NM_001097604 8.23E?02 2.00E?01 1.38E?01 6.86E?02 IPP NM_001145349 2.24E?01 2.38E?01 1.45E?02 1.30E?02 DYRK1A NM_001396 4.39E?02 5.43E?02 1.08E?01 2.84E?01 DYRK4 NM_003845 1.11E?01 1.15E?01 2.08E?01 5.58E?02 SIN3A NM_015477 2.53E?02 7.65E?02 1.22E?01 2.67E?01 C10orf71 NM_001135196 9.59E?02 2.66E?01 1.77E?02 1.11E?01 MAP2K2 NM_030662 1.88E?01 3.21E?02 1.69E?01 1.02E?01 BMPR1B NM_001256793 8.80E?02 1.11E?01 2.12E?01 8.10E?02 BCL7B NM_001707 9.86E?03 3.05E?02 9.44E?02 3.57E?01 LMF1 NM_022773 3.65E?03 1.15E?02 2.12E?01 2.65E?01 DOCK8 NM_203447 2.27E?01 2.53E?01 1.92E?03 1.03E?02 ODF3L2 NM_182577 1.12E?01 1.29E?01 1.62E?01 8.92E?02 TRUB2 NM_015679 1.80E?01 1.21E?01 6.26E?02 1.30E?01 ACSL6 NM_001205251 1.15E?01 2.69E?01 3.73E?02 7.29E?02 PDE1B NM_001165975 2.21E?01 1.55E?01 5.60E?02 6.23E?02 SRPR NM_001177842 4.94E?02 1.92E?01 9.23E?02 1.61E?01 HIPK1 NM_198269 1.52E?01 7.91E?02 2.12E?01 5.09E?02 OR5D16 NM_001005496 1.27E?01 4.56E?02 1.65E?01 1.58E?01 BFSP1 NM_001195 4.43E?02 6.44E?02 2.74E?01 1.13E?01 MAPK10 NM_002753 7.05E?02 1.58E?01 1.46E?01 1.21E?01 CLEC12A NM_201623 1.93E?02 7.76E?02 2.34E?01 1.66E?01 DYNLRB1 NM_014183 1.78E?01 1.63E?01 6.30E?02 9.34E?02 COPZ1 NM_001271735 9.47E?02 8.42E?02 1.88E?01 1.30E?01 CTBP2 NM_001083914 1.13E?02 3.18E?02 3.16E?01 1.38E?01 GSG1 NM_001206843 1.36E?01 1.42E?01 1.54E?01 6.58E?02 SLC4A2 NM_001199692 3.18E?01 1.64E?01 6.15E?03 8.35E?03 HIST1H3A NM_003529 1.38E?01 1.42E?01 7.20E?02 1.46E?01 SLC7A1 NM_003045 3.64E?02 1.45E?02 1.15E?01 3.33E?01 MORC1 NM_014429 7.29E?02 1.56E?01 1.55E?01 1.17E?01 TLE3 NM_020908 1.47E?01 7.60E?02 1.50E?02 2.62E?01 LAMTOR2 NM_001145264 4.50E?02 6.94E?02 1.46E?01 2.40E?01 EIF3H NM_003756 7.23E?02 7.78E?02 2.06E?01 1.45E?01 SCD5 NM_001037582 6.32E?02 7.72E?02 1.23E?01 2.38E?01 ITPKA NM_002220 6.38E?02 1.56E?01 1.33E?01 1.50E?01 LIPH NM_139248 4.89E?02 1.44E?01 1.98E?01 1.11E?01 WDR18 NM_024100 1.78E?01 1.30E?01 1.50E?01 4.54E?02 WDR55 NM_017706 1.92E?02 1.77E?02 2.72E?01 1.95E?01 ALDH8A1 NM_022568 1.28E?01 1.27E?01 4.81E?02 2.02E?01 TMEM256 NM_152766 1.92E?01 2.64E?01 3.55E?02 1.29E?02 MYH10 NM_001256095 1.64E?01 2.47E?01 5.18E?02 4.23E?02 TERF2IP NM_018975 8.64E?03 2.40E?03 4.29E?01 6.47E?02 UBE2V2 NM_003350 1.37E?01 1.12E?01 5.47E?02 2.02E?01 SLC39A13 NM_001128225 5.56E?02 5.96E?02 1.17E?01 2.73E?01 MUC22 NM_001198815 2.24E?02 1.47E?01 9.82E?02 2.38E?01 SLC35F2 NM_017515 1.42E?01 8.06E?02 2.33E?01 5.27E?02 PHLPP2 NM_001289003 5.70E?02 7.01E?02 1.05E?01 2.76E?01 LTA NM_001159740 9.85E?02 2.21E?01 1.12E?01 7.82E?02 MATR3 NM_001194954 4.23E?02 2.21E?02 3.12E?01 1.33E?01 DDRGK1 NM_023935 2.23E?02 1.30E?01 1.02E?01 2.55E?01 THBD NM_000361 6.09E?02 1.59E?01 2.77E?01 1.33E?02 MYO15A NM_016239 2.34E?01 5.88E?02 1.34E?02 2.04E?01 MRPL55 NM_181456 1.21E?01 1.65E?01 1.27E?01 9.69E?02 OR5R1 NM_001004744 7.03E?02 3.82E?01 1.37E?02 4.42E?02 FBXL14 NM_152441 8.95E?02 1.27E?01 2.16E?01 7.80E?02 JAZF1 NM_175061 3.84E?02 8.26E?02 1.73E?01 2.16E?01 TRAPPC3 NM_001270895 1.50E?01 5.39E?02 2.01E?01 1.06E?01 MAPT NM_005910 1.43E?01 1.61E?01 1.43E?01 6.30E?02 FBXO32 NM_148177 1.24E?01 2.97E?01 6.82E?02 2.20E?02 FAIM NM_001033032 2.14E?02 4.96E?02 3.17E?01 1.23E?01 TMEM31 NM_182541 4.30E?01 6.73E?02 1.41E?02 5.85E?04 OR5AN1 NM_001004729 6.30E?03 6.88E?03 3.90E?01 1.09E?01 C1orf21 NM_030806 2.99E?01 1.87E?01 2.55E?02 2.16E?03 CKMT1A NM_001015001 5.30E?02 1.47E?01 1.71E?01 1.43E?01 TMEM11 NM_003876 1.19E?01 4.73E?02 2.42E?01 1.06E?01 TBX18 NM_001080508 3.17E?02 9.74E?03 1.47E?01 3.26E?01 THSD1 NM_199263 2.56E?02 7.46E?03 2.42E?01 2.42E?01 ZBTB18 NM_001278196 2.58E?01 2.40E?01 6.35E?03 1.22E?02 ANKRD26 NM_014915 7.58E?02 3.80E?01 9.36E?03 5.30E?02 TMED5 NM_001167830 1.66E?01 2.37E?01 4.97E?02 6.60E?02 PAIP2B NM_020459 6.06E?02 2.20E?02 3.50E?01 8.73E?02 CEP112 NM_001037325 4.29E?02 1.45E?02 2.35E?01 2.27E?01 MRPL23 NM_021134 3.81E?02 2.99E?02 2.96E?01 1.56E?01 UBA5 NM_198329 1.96E?01 3.07E?01 5.97E?03 1.14E?02 DYNLT3 NM_006520 7.26E?02 7.41E?02 2.02E?01 1.72E?01 PLG NM_000301 3.43E?03 1.86E?02 3.39E?01 1.61E?01 SLC12A6 NM_001042497 7.80E?03 6.65E?03 2.11E?01 2.98E?01 LPAR6 NM_001162497 1.17E?01 1.40E?01 1.59E?01 1.07E?01 OSR1 NM_145260 1.02E?01 8.56E?02 6.14E?02 2.75E?01 CLEC4E NM_014358 1.90E?01 1.32E?01 5.64E?02 1.46E?01 MED14 NM_004229 1.55E?01 9.15E?02 2.53E?01 2.63E?02 SLCO1B7 NM_001009562 1.36E?01 1.19E?01 1.28E?01 1.43E?01 MARCHF1 NM_017923 3.11E?01 1.52E?01 5.65E?03 5.68E?02 DAPK1 NM_001288731 7.43E?02 7.38E?02 2.12E?01 1.66E?01 CDK20 NM_001039803 1.69E?01 2.36E?01 1.01E?01 2.03E?02 ITM2C NM_030926 1.60E?02 7.28E?03 2.00E?01 3.04E?01 XAGE2 NM_130777 1.90E?01 1.99E?01 9.83E?02 4.06E?02 ROS1 NM_002944 6.20E?02 5.57E?02 4.25E?02 3.68E?01 IPO7 NM_006391 8.25E?03 5.60E?03 3.39E?01 1.76E?01 C20orf197 NM_173644 1.76E?01 5.01E?02 1.24E?01 1.79E?01 OPN5 NM_181744 1.12E?01 1.20E?01 1.52E?01 1.48E?01 SMAD1 NM_005900 1.93E?01 1.79E?01 1.20E?01 3.91E?02 PAK3 NM_001128168 3.83E?02 6.82E?02 1.64E?01 2.61E?01 CTRL NM_001907 1.70E?01 2.02E?01 8.99E?02 6.85E?02 PITX2 NM_001204398 6.92E?02 3.39E?01 6.76E?02 5.58E?02 MEF2C NM_001193349 4.35E?02 5.50E?02 2.62E?02 4.07E?01 G3BP1 NM_198395 1.02E?01 2.06E?01 9.98E?02 1.25E?01 SLC35A2 NM_005660 3.60E?01 1.12E?01 1.31E?02 4.85E?02 SPCS3 NM_021928 1.98E?01 2.67E?02 1.16E?01 1.92E?01 CCSER2 NM_001284242 2.05E?01 3.18E?01 8.88E?03 1.44E?03 SOS1 NM_005633 5.78E?02 1.14E?01 7.40E?02 2.88E?01 EIF2AK2 NM_001135652 2.04E?02 4.42E?02 2.84E?01 1.85E?01 SRP68 NM_001260503 3.10E?02 2.06E?02 2.46E?01 2.37E?01 TRIM68 NM_018073 5.16E?02 1.29E?01 6.06E?02 2.93E?01 GSTK1 NM_001143680 2.39E?01 1.24E?01 1.43E?01 2.92E?02 AKAP14 NM_178813 2.21E?01 1.86E?01 2.92E?02 9.95E?02 DNAH8 NM_001206927 8.41E?02 2.81E?01 1.87E?02 1.52E?01 CCDC88B NM_032251 1.40E?01 1.36E?01 1.43E?01 1.18E?01 PTPRR NM_001207016 6.90E?02 5.20E?02 1.68E?01 2.48E?01 SLC35F3 NM_173508 4.47E?03 5.67E?03 3.27E?01 1.99E?01 CD44 NM_001202557 1.84E?01 5.87E?02 2.77E?01 1.73E?02 LRRC36 NM_001161575 2.97E?01 2.16E?01 2.06E?02 3.38E?03 C1orf27 NM_001164246 1.42E?02 3.07E?02 4.08E?01 8.49E?02 ALKBH6 NM_032878 7.27E?02 1.19E?01 3.44E?01 2.13E?03 TLR10 NM_030956 2.43E?01 2.38E?01 2.35E?02 3.36E?02 C6orf47 NM_021184 1.35E?01 1.19E?01 1.08E?01 1.76E?01 SLFNL1 NM_144990 3.31E?02 1.24E?01 1.26E?01 2.55E?01 RASSF1 NM_001206957 1.71E?01 5.61E?02 2.25E?01 8.72E?02 BUB1B NM_001211 1.90E?01 2.03E?01 1.03E?01 4.32E?02 ADK NM_001202449 1.30E?01 2.76E?02 1.88E?01 1.93E?01 PSMD10 NM_002814 1.05E?01 4.54E?02 1.54E?01 2.36E?01 PSMB4 NM_002796 2.83E?02 2.72E?02 1.95E?01 2.90E?01 PWP1 NM_007062 1.93E?04 4.42E?04 1.59E?01 3.81E?01 EFCAB3 NM_001144933 3.99E?02 2.98E?02 3.66E?01 1.06E?01 AKT1 NM_005163 1.76E?01 1.38E?01 8.49E?02 1.42E?01 OR12D2 NM_013936 1.41E?01 2.12E?01 2.48E?02 1.65E?01 NAPSA NM_004851 1.50E?01 2.87E?01 4.75E?02 5.79E?02 TRAK1 NM_001265609 2.45E?01 2.21E?01 4.50E?02 3.25E?02 USP33 NM_015017 2.57E?01 2.40E?01 1.20E?02 3.50E?02 POU5F1 NM_203289 1.72E?01 3.28E?01 1.22E?02 3.16E?02 KRTAP19-8 NM_001099219 4.64E?02 3.26E?02 1.31E?01 3.35E?01 PLEKHG5 NM_001042665 1.64E?02 9.96E?03 3.27E?01 1.92E?01 SMPDL3A NM_006714 1.92E?01 2.19E?01 6.63E?02 6.94E?02 HIF3A NM_ 152794 3.75E?03 1.12E?02 2.96E?01 2.35E?01 RAB3IP NM_022456 1.54E?01 2.27E?01 3.67E?02 1.30E?01 HIST1H2BH NM_003524 2.46E?02 4.05E?02 3.79E?01 1.04E?01 FIGF NM_004469 1.02E?01 1.91E?01 2.39E?01 1.58E?02 CHD7 NM_017780 1.68E?01 1.75E?01 7.75E?02 1.28E?01 ZNF664-FAM101A NM_001204299 3.10E?01 5.49E?02 1.65E?01 1.91E?02 AASDHPPT NM_015423 7.56E?02 7.13E?02 1.68E?01 2.34E?01 AQP2 NM_000486 2.60E?01 2.28E?01 5.97E?02 7.44E?04 ZNF808 NM_001039886 4.43E?02 3.79E?02 1.39E?01 3.28E?01 VCX NM_013452 1.04E?01 1.61E?01 2.35E?01 4.96E?02 SLC4A8 NM_001258403 2.28E?03 9.86E?03 3.26E?01 2.12E?01 USP44 NM_032147 1.36E?01 1.87E?01 1.22E?01 1.05E?01 ACSS1 NM_001252676 3.25E?02 2.20E?02 2.05E?01 2.92E?01 AIFM2 NM_032797 4.79E?02 3.78E?02 2.18E?01 2.48E?01 KHDC1L NM_001126063 4.45E?02 4.77E?02 4.11E?01 4.90E?02 VN1R5 NM_173858 1.18E?01 3.55E?02 1.68E?01 2.31E?01 DNAJA4 NM_001130183 3.57E?01 8.72E?02 9.57E?02 1.24E?02 MID1 NM_001193277 1.84E?01 1.56E?01 8.78E?02 1.25E?01 PARP9 NM_001146104 8.81E?02 4.84E?02 2.82E?01 1.35E?01 DHTKD1 NM_018706 9.40E?02 9.62E?02 6.68E?02 2.96E?01 PIK3C2A NM_002645 1.79E?01 1.69E?01 1.89E?01 1.62E?02 RHPN2 NM_033103 9.29E?02 2.99E?02 1.56E?01 2.75E?01 FOCAD NM_017794 1.08E?01 1.27E?01 2.62E?01 5.59E?02 LRP10 NM_014045 1.99E?01 2.20E?01 6.49E?02 6.94E?02 FSD1 NM_024333 2.50E?01 2.33E?01 6.58E?02 5.10E?03 TRAP1 NM_016292 2.02E?01 2.37E?01 3.23E?03 1.12E?01 CD209 NM_001144897 1.84E?01 4.68E?02 6.21E?02 2.62E?01 RICTOR NM_152756 2.03E?01 2.11E?01 9.07E?02 4.93E?02 MDH1 NM_001199112 2.89E?02 2.24E?02 4.47E?01 5.64E?02 ZNF763 NM_001012753 1.54E?01 1.66E?01 3.22E?02 2.03E?01 PTGR2 NM_152444 1.20E?01 1.31E?01 9.56E?02 2.09E?01 MINPP1 NM_001178118 2.61E?01 2.81E?01 7.58E?03 6.18E?03 AQP8 NM_001169 2.06E?01 3.48E?01 6.86E?04 1.80E?03 STX3 NM_004177 1.38E?01 4.66E?02 2.21E?01 1.50E?01 MCAM NM_006500 3.28E?02 1.17E?01 3.62E?01 4.41E?02 PSG6 NM_001031850 2.41E?01 1.36E?01 8.61E?02 9.40E?02 SLC35G4 NM_001282300 8.00E?02 8.48E?02 2.04E?01 1.89E?01 FRMPD3 NM_032428 1.06E?02 1.05E?02 2.23E?01 3.12E?01 SELENOF NM_004261 1.78E?01 1.45E?01 4.84E?02 1.85E?01 CTNNA2 NM_001282599 1.30E?01 1.38E?01 2.35E?01 5.43E?02 COL19A1 NM_001858 2.21E?01 1.14E?01 1.62E?01 6.14E?02 OPRK1 NM_000912 8.70E?02 1.90E?01 1.92E?01 8.89E?02 SLC2A6 NM_001145099 2.03E?01 4.87E?02 4.76E?02 2.60E?01 GFRA2 NM_001165038 2.00E?01 2.90E?01 4.04E?02 2.93E?02 UNKL NM_001276414 1.98E?01 1.72E?01 1.22E?02 1.78E?01 JADE3 NM_014735 1.56E?01 1.46E?01 9.25E?02 1.65E?01 ZAR1 NM_175619 2.02E?01 3.83E?02 1.81E?01 1.39E?01 STAG3 NM_012447 1.64E?01 1.41E?01 6.67E?02 1.88E?01 SNX27 NM_030918 2.55E?01 9.55E?02 7.40E?03 2.03E?01 SERPINB12 NM_080474 1.40E?01 2.79E?01 6.47E?02 7.65E?02 NXPE3 NM_001134456 3.55E?01 1.05E?01 9.96E?03 9.11E?02 SEMA4B NM_020210 1.01E?01 4.39E?01 1.51E?02 6.46E?03 LHFPL1 NM_178175 2.15E?01 1.13E?01 1.80E?01 5.40E?02 ZNF92 NM_152626 2.60E?01 2.36E?01 5.01E?02 1.57E?02 CNR2 NM_001841 2.02E?01 4.62E?02 4.08E?02 2.73E?01 PRDM8 NM_020226 2.95E?01 1.33E?01 2.00E?02 1.15E?01 KLB NM_175737 1.87E?01 2.00E?01 4.19E?02 1.34E?01 FAM115A NM_001206938 8.83E?02 6.13E?02 2.36E?01 1.77E?01 TMEM95 NM_198154 3.53E?01 1.90E?01 8.22E?03 1.18E?02 SPG21 NM_001127889 1.33E?01 1.72E?01 6.90E?02 1.90E?01 SLC35E2 NM_001199787 1.92E?01 1.75E?01 5.25E?03 1.91E?01 ETFB NM_001985 1.91E?01 3.52E?01 1.01E?02 1.11E?02 HPR NM_020995 4.31E?03 4.36E?02 3.30E?01 1.87E?01 OR2T1 NM_030904 1.40E?02 5.06E?02 2.44E?01 2.56E?01 ARPP21 NM_001267617 3.59E?01 1.50E?01 6.58E?03 4.83E?02 OR9Q1 NM_001005212 2.22E?01 2.19E?01 1.02E?01 2.21E?02 ATXN1L NM_001137675 2.66E?01 9.37E?02 7.65E?02 1.29E?01 AP3B2 NM_001278511 2.59E?02 4.75E?03 2.83E?01 2.52E?01 IVL NM_005547 1.13E?01 1.04E?01 3.03E?01 4.73E?02 SCARF1 NM_145350 1.15E?01 8.88E?02 1.46E?01 2.18E?01 GPX1 NM_000581 1.11E?01 2.68E?03 1.53E?01 3.00E?01 NABP2 NM_024068 1.72E?02 5.31E?02 3.30E?01 1.67E?01 BCKDHB NM_000056 2.09E?01 1.11E?01 8.21E?02 1.65E?01 MRPL30 NM_145212 1.02E?01 1.46E?01 2.06E?01 1.14E?01 FIBP NM_004214 4.81E?02 3.55E?02 4.01E?01 8.42E?02 BCAS1 NM_003657 4.71E?02 6.33E?02 3.81E?01 7.77E?02 BMP2K NM_198892 1.27E?01 6.69E?02 1.41E?01 2.34E?01 SLC25A36 NM_018155 5.59E?02 2.27E?01 1.63E?01 1.23E?01 MACROD2 NM_080676 2.84E?01 2.71E?01 5.68E?03 8.70E?03 KDELR1 NM_006801 1.93E?01 3.20E?01 5.21E?02 5.09E?03 C3orf18 NM_001171741 9.85E?02 1.11E?01 2.65E?02 3.34E?01 CDK2AP1 NM_001270434 1.08E?02 1.65E?02 3.10E?01 2.33E?01 FCGRT NM_001136019 1.97E?01 9.06E?02 2.65E?01 1.93E?02 TNIP1 NM_001258454 8.72E?02 6.11E?02 1.44E?01 2.80E?01 SRM NM_003132 1.53E?02 7.28E?02 2.82E?01 2.03E?01 COMMD10 NM_016144 2.02E?02 2.40E?02 2.88E?01 2.40E?01 ARL4A NM_001195396 1.52E?01 1.54E?01 2.27E?01 4.09E?02 CPSF2 NM_017437 9.47E?02 1.51E?01 2.04E?01 1.23E?01 KCNN2 NM_170775 2.82E?01 1.15E?01 1.07E?01 6.86E?02 HEY2 NM_012259 2.22E?01 1.38E?01 6.49E?02 1.49E?01 PIP5K1C NM_012398 1.76E?01 7.82E?02 1.41E?01 1.78E?01 PASK NM_001252122 1.28E?01 1.30E?01 5.12E?02 2.64E?01 TBC1D10C NM_198517 9.11E?02 1.36E?01 3.10E?01 3.66E?02 DGCR6 NM_005675 2.40E?01 1.19E?01 1.51E?01 6.43E?02 CHST6 NM_021615 2.52E?01 2.86E?01 1.86E?02 1.91E?02 SCML4 NM_001286409 8.26E?02 1.14E?01 2.53E?01 1.26E?01 HOOK2 NM_001100176 2.98E?01 2.52E?01 9.64E?03 1.66E?02 MLC1 NM_015166 1.96E?01 2.33E?01 9.23E?02 5.52E?02 SMC5 NM_015110 1.94E?01 1.36E?01 1.05E?01 1.42E?01 MARCHF5 NM_017824 2.68E?01 1.36E?01 1.59E?01 1.45E?02 WNT5B NM_030775 1.29E?01 3.56E?01 2.84E?02 6.40E?02 CSNK1G2 NM_001319 9.37E?02 1.03E?01 1.57E?01 2.24E?01 C6orf223 NM_153246 4.82E?02 9.72E?02 8.35E?02 3.49E?01 HNRNPL NM_001533 1.42E?01 1.60E?01 1.48E?01 1.29E?01 CMTM4 NM_181521 2.27E?01 6.97E?02 1.36E?01 1.46E?01 NOTCH2 NM_024408 2.03E?01 2.87E?01 4.97E?02 4.02E?02 EPPIN-WFDC6 NM_001198986 1.01E?02 5.12E?02 2.34E?01 2.85E?01 NOP16 NM_001256539 2.82E?01 2.60E?01 2.76E?02 1.16E?02 SPAM1 NM_001174045 7.89E?02 3.57E?01 5.63E?02 8.93E?02 ATP6V1H NM_213620 1.18E?01 8.14E?02 2.10E?01 1.72E?01 NFS1 NM_001198989 1.80E?01 7.23E?02 8.66E?02 2.43E?01 CBFA2T3 NM_005187 1.08E?02 1.37E?02 1.62E?01 3.96E?01 HS3ST4 NM_006040 5.64E?02 6.40E?02 1.31E?01 3.31E?01 C18orf21 NM_001201476 2.25E?02 8.46E?03 4.52E?01 9.95E?02 APOLD1 NM_030817 1.25E?01 1.07E?01 2.87E?01 6.31E?02 KLHL22 NM_032775 1.69E?01 7.74E?02 1.48E?01 1.88E?01 CCDC136 NM_001201372 5.97E?02 4.65E?02 1.89E?01 2.88E?01 KIAA1024 NM_015206 2.83E?01 1.26E?01 7.02E?02 1.03E?01 NKG7 NM_005601 3.78E?02 3.03E?02 3.88E?01 1.27E?01 TTC7A NM_020458 2.58E?01 1.53E?01 2.59E?02 1.47E?01 ATP1A3 NM_001256214 2.08E?01 2.42E?01 3.13E?02 1.03E?01 BATF2 NM_138456 2.07E?01 3.04E?01 6.63E?02 6.99E?03 SPANXA1 NM_013453 1.63E?01 1.16E?01 8.14E?02 2.24E?01 ID1 NM_181353 1.32E?01 3.91E?01 2.57E?02 3.55E?02 QTRTD1 NM_024638 2.00E?02 1.31E?01 2.94E?01 1.39E?01 AIMP1 NM_001142415 2.25E?01 2.18E?01 7.84E?02 6.35E?02 RASGRF2 NM_006909 1.21E?01 1.56E?01 5.19E?02 2.56E?01 KHDRBS1 NM_006559 2.88E?01 1.30E?01 7.89E?02 8.78E?02 LCMT2 NM_014793 1.81E?01 2.82E?01 5.22E?02 6.98E?02 EXOC6 NM_019053 8.91E?02 1.87E?01 1.75E?01 1.34E?01 NIF3L1 NM_021824 3.36E?02 9.66E?03 3.23E?01 2.19E?01 PSMB1 NM_002793 6.99E?02 1.30E?01 5.97E?02 3.26E?01 DOC2A NM_003586 1.46E?01 4.81E?02 2.35E?01 1.56E?01 NUDT10 NM_153183 1.93E?01 2.48E?01 7.28E?02 7.19E?02 RAC3 NM_005052 7.91E?02 1.11E?02 1.39E?01 3.57E?01 SDHA NM_004168 4.13E?02 2.82E?02 2.35E?01 2.83E?01 GPBAR1 NM_170699 2.71E?01 4.64E?02 1.55E?01 1.15E?01 AIFM3 NM_001146288 1.76E?01 3.09E?01 8.29E?02 1.90E?02 CCDC94 NM_018074 1.04E?01 1.36E?01 1.61E?01 1.86E?01 NFKBIE NM_004556 3.59E?02 5.07E?01 8.56E?03 3.69E?02 HDLBP NM_203346 1.32E?01 2.03E?01 2.26E?01 2.65E?02 KCNQ3 NM_004519 7.52E?02 1.96E?02 2.31E?01 2.63E?01 SLURP1 NM_020427 1.80E?01 6.85E?02 1.74E?01 1.66E?01 PTPRB NM_001206971 1.42E?01 2.21E?01 4.33E?02 1.83E?01 NR1H4 NM_001206993 6.83E?02 5.66E?03 1.83E?01 3.32E?01 CXorf23 NM_198279 1.91E?01 2.81E?01 9.98E?02 1.79E?02 HOXB13 NM_006361 2.52E?02 1.59E?02 3.16E?01 2.33E?01 FCAR NM_133278 3.50E?01 1.19E?01 2.21E?02 9.90E?02 GPT NM_005309 3.63E?03 1.99E?02 2.88E?01 2.80E?01 GLIPR1 NM_006851 9.36E?02 1.29E?01 2.47E?01 1.22E?01 PP2D1 NM_001252657 7.97E?02 7.64E?02 2.14E?01 2.21E?01 FUT6 NM_000150 2.69E?01 3.20E?01 1.51E?03 8.09E?04 IFT140 NM_014714 3.23E?02 3.77E?01 1.24E?01 5.79E?02 SIN3B NM_015260 8.64E?02 1.73E?01 1.71E?01 1.61E?01 UXS1 NM_001253875 1.63E?01 4.04E?01 1.90E?02 6.29E?03 SLC6A12 NM_001206931 1.38E?01 1.07E?01 2.15E?01 1.32E?01 SYT11 NM_152280 1.24E?01 1.22E?01 1.81E?01 1.67E?01 MRPS10 NM_018141 2.42E?02 6.26E?02 2.25E?01 2.82E?01 TMC2 NM_080751 1.72E?01 3.25E?01 2.59E?02 7.20E?02 IP6K3 NM_054111 1.02E?01 2.76E?01 1.28E?01 8.93E?02 NCAPD2 NM_014865 8.87E?02 1.56E?01 2.42E?01 1.09E?01 C15orf41 NM_001130010 8.93E?02 8.09E?02 2.20E?01 2.04E?01 ZNF200 NM_003454 6.11E?02 6.08E?02 2.69E?01 2.04E?01 ACADL NM_001608 1.72E?01 6.28E?02 2.14E?01 1.47E?01 GP1BB NM_000407 3.17E?01 1.64E?01 1.10E?01 5.79E?03 TTLL11 NM_001139442 4.77E?02 2.58E?02 3.52E?01 1.71E?01 PRR5 NM_001017528 1.49E?01 3.72E?01 2.55E?02 5.02E?02 BMPR2 NM_001204 8.93E?02 3.74E?01 8.66E?03 1.24E?01 PTGES3 NM_006601 1.78E?01 1.37E?01 1.22E?01 1.60E?01 BDKRB1 NM_000710 8.75E?02 5.02E?02 2.07E?01 2.54E?01 NXF1 NM_001081491 1.13E?01 7.40E?02 1.14E?01 2.97E?01 HAND2 NM_021973 1.96E?01 1.82E?01 4.20E?02 1.78E?01 GRID2 NM_001286838 3.77E?01 6.98E?02 8.10E?02 7.16E?02 KLHL30 NM_198582 9.96E?02 1.62E?01 2.29E?01 1.09E?01 CCR6 NM_004367 3.74E?02 7.64E?02 1.08E?01 3.77E?01 KIAA0368 NM_001080398 1.20E?01 1.68E?01 7.28E?02 2.39E?01 PRPF38A NM_032864 1.05E?01 1.10E?01 1.38E?01 2.46E?01 MAP3K13 NM_004721 2.60E?01 3.02E?01 9.79E?03 2.79E?02 CORO6 NM_032854 3.60E?01 1.92E?01 2.78E?02 2.05E?02 ARHGEF25 NM_001111270 2.64E?01 1.63E?01 7.49E?02 9.78E?02 AMOTL2 NM_001278683 2.56E?01 2.33E?01 7.09E?02 4.02E?02 TRMT5 NM_020810 3.31E?02 1.59E?01 5.95E?02 3.50E?01 ARSF NM_001201538 4.17E?01 8.71E?02 5.06E?02 4.65E?02 PACS2 NM_001100913 1.64E?01 9.48E?02 1.86E?01 1.56E?01 LSM7 NM_016199 8.05E?02 1.88E?01 1.59E?01 1.74E?01 MMP11 NM_005940 2.87E?02 1.95E?02 4.01E?01 1.52E?01 SLC25A37 NM_016612 3.33E?02 2.85E?01 1.41E?01 1.43E?01 KRT14 NM_000526 1.31E?03 6.86E?04 2.96E?01 3.04E?01 ANKRD37 NM_181726 6.98E?02 3.64E?02 2.50E?01 2.47E?01 EPHA7 NM_001288629 3.13E?02 9.11E?02 2.54E?01 2.28E?01 CSTF1 NM_001033521 8.49E?03 4.90E?03 2.01E?01 3.90E?01 SPATA13 NM_153023 3.45E?02 1.05E?01 1.65E?01 3.01E?01 HN1 NM_016185 2.11E?01 1.44E?01 2.05E?01 4.55E?02 PARD6G NM_032510 3.63E?01 1.57E?01 5.02E?02 3.56E?02 GAPDHS NM_014364 1.67E?01 3.86E?01 3.87E?02 1.32E?02 SYNCRIP NM_001159673 2.39E?01 4.78E?02 6.42E?02 2.55E?01 MXI1 NM_130439 3.71E?01 2.25E?01 2.06E?03 7.74E?03 DMPK NM_001081563 2.70E?01 6.36E?02 1.52E?01 1.20E?01 IPO5 NM_002271 3.00E?01 9.77E?02 8.80E?02 1.21E?01 ATP10B NM_025153 4.20E?01 1.35E?01 7.80E?03 4.36E?02 RPL17-C18orf32 NM_001199355 2.48E?01 1.66E?01 7.95E?02 1.13E?01 TRIM42 NM_152616 1.60E?01 1.51E?01 2.75E?02 2.69E?01 CDC20 NM_001255 3.47E?01 2.53E?01 2.75E?03 4.93E?03 ATF3 NM_001030287 1.39E?01 2.04E?01 1.80E?01 8.59E?02 FARS2 NM_006567 1.93E?01 1.84E?01 2.05E?01 2.65E?02 MYO1C NM_033375 6.64E?03 1.74E?02 2.74E?01 3.10E?01 POLR1D NM_001206559 2.42E?01 2.22E?01 9.06E?02 5.47E?02 LUC7L2 NM_001270643 5.69E?02 9.42E?02 2.52E?01 2.07E?01 RASAL1 NM_001193520 1.59E?01 1.49E?01 1.69E?01 1.33E?01 DNAJC25-GNG10 NM_004125 9.52E?02 2.01E?01 1.91E?01 1.23E?01 MAGEB1 NM_002363 1.51E?01 2.86E?01 1.65E?01 8.56E?03 TJP2 NM_001170414 2.68E?01 1.78E?01 4.08E?02 1.24E?01 ATP1A1 NM_001160233 4.31E?02 6.71E?02 4.31E?01 6.93E?02 RRM2 NM_001165931 9.44E?02 1.94E?02 2.97E?01 2.00E?01 CCDC50 NM_178335 1.77E?02 5.74E?03 3.82E?01 2.06E?01 CTDSP1 NM_001206878 6.09E?02 1.89E?01 1.06E?01 2.56E?01 TMEM89 NM_001008269 6.32E?02 1.46E?01 1.53E?01 2.50E?01 BICD2 NM_015250 1.57E?01 2.77E?01 1.57E?01 2.20E?02 KLHL25 NM_022480 2.31E?01 3.78E?02 2.73E?01 7.20E?02 CCDC33 NM_025055 1.51E?01 2.59E?01 1.06E?01 9.79E?02 SNX32 NM_152760 3.54E?01 1.39E?01 2.66E?02 9.35E?02 MATR3 NM_018834 2.70E?01 8.08E?02 3.01E?02 2.34E?01 SLC46A3 NM_001135919 2.38E?01 1.43E?01 9.04E?02 1.43E?01 NLRC4 NM_001199139 1.69E?01 8.32E?02 3.03E?01 5.84E?02 PSMF1 NM_178578 4.61E?02 1.38E?01 3.41E?04 4.30E?01 CPNE9 NM_153635 2.83E?02 9.97E?03 2.88E?01 2.89E?01 KLF11 NM_001177716 2.12E?01 8.38E?02 1.35E?01 1.85E?01 CSN3 NM_005212 1.39E?01 1.09E?01 1.87E?01 1.82E?01 TRIM39 NM_021253 2.79E?01 3.26E?01 7.46E?03 4.01E?03 YY1AP1 NM_001198903 1.37E?01 1.13E?01 3.06E?01 6.13E?02 BTN2A1 NM_001197234 3.01E?02 5.61E?02 2.67E?01 2.64E?01 SMARCAD1 NM_001254949 1.80E?03 3.11E?03 1.15E?01 4.98E?01 PHYHIPL NM_001143774 1.77E?02 2.24E?02 1.32E?01 4.45E?01 PHACTR4 NM_023923 1.07E?02 1.71E?03 2.45E?01 3.62E?01 LTA4H NM_000895 5.58E?02 5.70E?02 1.02E?01 4.05E?01 TMEM30B NM_001017970 1.72E?01 1.99E?01 1.26E?01 1.22E?01 CCDC9 NM_015603 1.39E?01 1.01E?01 1.74E?01 2.05E?01 NOV NM_002514 3.30E?01 1.38E?01 8.11E?02 7.08E?02 NDUFB5 NM_002492 2.83E?01 2.98E?02 1.27E?01 1.80E?01 ARHGEF33 NM_001145451 2.43E?01 2.49E?01 4.59E?02 8.27E?02 ALG1 NM_019109 1.40E?01 2.63E?01 1.73E?01 4.46E?02 MAP4K4 NM_001242559 2.72E?01 8.06E?02 3.90E?02 2.28E?01 KCTD8 NM_198353 2.39E?01 1.20E?01 2.08E?01 5.38E?02 PDE4D NM_001197219 2.14E?01 1.52E?01 1.27E?01 1.29E?01 PCDHGA4 NM_018917 7.76E?02 5.51E?02 4.20E?01 6.89E?02 OPN1SW NM_001708 7.01E?02 1.83E?02 3.88E?01 1.45E?01 YBEY NM_058181 8.97E?02 1.22E?01 2.15E?01 1.95E?01 ASRGL1 NM_001083926 7.12E?02 2.39E?02 2.65E?01 2.62E?01 NDUFAB1 NM_005003 3.69E?01 2.24E?01 1.71E?02 1.22E?02 GGTLC1 NM_178312 1.20E?01 2.53E?01 1.75E?01 7.48E?02 FIZ1 NM_032836 2.69E?01 3.23E?01 6.53E?03 2.55E?02 LMNA NM_001282625 9.67E?02 5.60E?02 1.12E?01 3.60E?01 NUBP1 NM_002484 2.10E?01 2.63E?01 1.38E?01 1.27E?02 ATF2 NM_001256093 3.71E?01 1.97E?01 2.08E?02 3.55E?02 GNRH2 NM_001501 1.37E?01 3.57E?01 1.89E?02 1.13E?01 TPM3 NM_153649 1.48E?01 2.84E?01 1.23E?01 7.10E?02 NRROS NM_198565 3.68E?02 8.08E?02 1.66E?01 3.42E?01 OVGP1 NM_002557 6.05E?02 3.66E?02 2.17E?01 3.11E?01 ATP2A1 NM_173201 2.44E?01 2.28E?01 4.08E?02 1.13E?01 SERF2 NM_001199878 4.81E?04 1.95E?04 4.01E?01 2.25E?01 TRIB1 NM_001282985 2.62E?01 2.47E?01 3.59E?02 8.09E?02 CCDC61 NM_001267723 3.35E?03 1.36E?02 2.06E?01 4.04E?01 WDR1 NM_017491 1.42E?01 3.80E?01 5.61E?03 9.90E?02 FBXO9 NM_033481 2.29E?01 3.40E?01 1.05E?02 4.71E?02 VWA5A NM_014622 9.29E?02 4.16E?02 3.30E?01 1.63E?01 C1orf146 NM_001012425 3.37E?01 2.82E?01 8.78E?05 8.25E?03 ZAN NM_003386 3.39E?01 2.04E?01 3.23E?02 5.40E?02 PLA2G4C NM_001159323 4.19E?01 1.17E?01 1.45E?02 7.86E?02 SHFM1 NM_006304 9.60E?02 1.51E?01 2.02E?01 1.81E?01 ANAPC11 NM_001002245 2.86E?02 8.95E?03 2.06E?01 3.86E?01 APOA1BP NM_144772 1.11E?01 2.44E?01 1.60E?01 1.15E?01 SUPT4H1 NM_003168 2.24E?01 2.68E?01 1.07E?01 3.11E?02 KLHL13 NM_001168299 4.34E?02 1.60E?01 3.36E?01 9.02E?02 DCX NM_000555 1.83E?01 1.88E?01 1.14E?01 1.45E?01 CLDN10 NM_001160100 3.74E?01 2.16E?01 8.37E?03 3.14E?02 SMIM2 NM_024058 6.56E?02 4.02E?01 9.11E?02 7.11E?02 EBF2 NM_022659 1.73E?02 1.06E?01 2.30E?01 2.77E?01 TRPM3 NM_001007471 1.76E?01 1.71E?01 8.24E?02 2.00E?01 HBZ NM_005332 3.11E?03 2.87E?03 3.48E?01 2.77E?01 TRADD NM_003789 7.20E?02 7.47E?02 2.96E?02 4.55E?01 GNAI2 NM_002070 1.14E?01 2.08E?01 1.82E?01 1.28E?01 KIF12 NM_138424 2.30E?01 2.04E?01 1.21E?01 7.68E?02 OR5AC2 NM_054106 1.23E?01 1.19E?01 2.19E?01 1.71E?01 SCTR NM_002980 1.19E?01 9.75E?02 1.55E?01 2.60E?01 LRRC27 NM_001143757 1.08E?01 3.65E?02 2.98E?01 1.90E?01 ZNF410 NM_001242924 1.73E?01 4.07E?01 3.29E?02 2.00E?02 CLECL1 NM_001253750 1.27E?01 4.62E?02 3.86E?01 7.36E?02 NPHS2 NM_014625 9.01E?02 1.08E?01 3.02E?01 1.33E?01 C16orf13 NM_032366 2.34E?01 2.32E?01 6.54E?02 1.03E?01 CDKN1A NM_078467 7.18E?02 4.84E?02 1.60E?01 3.54E?01 APOF NM_001638 1.34E?01 4.23E?01 2.77E?02 4.99E?02 BSCL2 NM_032667 3.29E?01 9.02E?02 1.00E?01 1.16E?01 BIRC5 NM_001168 1.37E?01 1.27E?02 2.11E?01 2.74E?01 PRKACB NM_182948 8.76E?02 1.49E?01 2.13E?01 1.86E?01 ALAS2 NM_001037968 9.40E?02 4.09E?02 3.39E?01 1.61E?01 COL10A1 NM_000493 3.45E?01 2.82E?01 8.68E?03 1.36E?04 SLC2A5 NM_003039 4.39E?02 3.04E?02 2.04E?01 3.57E?01 ELAVL4 NM_001144775 1.93E?01 3.22E?01 1.43E?02 1.07E?01 LIMS1 NM_004987 3.17E?01 3.00E?01 1.17E?02 7.80E?03 PKHD1 NM_138694 2.99E?02 5.26E?03 1.78E?01 4.23E?01 NUP188 NM_015354 1.10E?01 1.36E?02 1.99E?01 3.14E?01 OR4C15 NM_001001920 2.04E?01 9.00E?02 1.10E?01 2.33E?01 PABPC4L NM_001114734 6.25E?02 4.84E?02 1.33E?01 3.93E?01 TM7SF2 NM_001277233 2.67E?01 2.55E?01 7.00E?02 4.53E?02 POC5 NM_001099271 1.62E?01 1.29E?01 2.76E?01 7.11E?02 C1orf86 NM_182533 3.00E?01 2.63E?01 6.42E?02 1.22E?02 SBSN NM_001166034 2.93E?01 3.02E?01 2.91E?03 4.14E?02 DEF8 NM_001242821 3.38E?01 2.16E?01 2.35E?02 6.21E?02 APLP1 NM_005166 1.02E?01 5.84E?02 3.34E?01 1.45E?01 DCK NM_000788 1.60E?01 4.12E?01 5.54E?03 6.24E?02 CLDN24 NM_001185149 2.46E?01 1.37E?01 1.37E?01 1.20E?01 CETN2 NM_004344 2.12E?01 2.36E?01 1.29E?01 6.43E?02 CTSA NM_001127695 3.13E?02 5.49E?03 2.78E?01 3.27E?01

    TABLE-US-00003 TABLE 1B MAGeCK analysis results of the CRISPRa screen for resistance to T cell cytotoxicity in the chronic screen. Gene targets are in ranked order. Gene names, RefSeq IDs,and MAGeCK P-values for each of the top 1000 screening bioreps are listed. Chronic Chronic Chronic Chronic Chronic Chronic Round 1 Round 1 Round 2 Round 2 Round3 Round 3 Gene id biorep 1 biorep 2 biorep 1 biorep 2 biorep 1 biorep 2 JUNB NM_002229 2.28E?03 4.31E?03 2.05E?03 1.97E?04 2.25E?03 3.57E?03 B3GNT2 NM_006577 1.24E?02 2.28E?04 7.91E?03 5.20E?05 2.64E?03 1.29E?04 INO80 NM_017553 3.59E?03 9.27E?03 3.23E?03 5.03E?04 1.06E?02 1.55E?03 KRBA1 NM_001290187 4.50E?04 4.23E?02 1.61E?03 4.58E?03 3.97E?03 2.85E?03 ADAMTS12 NM_030955 3.65E?02 8.21E?04 6.75E?03 7.50E?03 2.00E?03 1.14E?02 RBPMS2 NM_194272 3.53E?02 4.52E?02 3.57E?03 6.45E?03 2.23E?03 2.15E?02 WDR76 NM_001167941 1.45E?02 9.20E?02 2.01E?04 3.06E?03 1.55E?03 3.71E?02 STK40 NM_032017 8.27E?02 5.61E?03 1.03E?02 2.58E?02 1.41E?02 9.75E?03 GABBR1 NM_021904 2.11E?02 1.20E?01 3.46E?03 5.41E?03 1.40E?03 2.27E?02 C2orf88 NM_001042520 9.24E?03 2.04E?02 3.87E?02 2.40E?02 6.17E?02 2.11E?02 GPR26 NM_153442 7.08E?02 4.32E?02 2.89E?02 1.24E?02 1.20E?02 1.21E?02 KCNF1 NM_002236 3.67E?02 1.06E?01 3.11E?03 4.65E?03 1.52E?02 1.64E?02 HHATL NM_020707 2.40E?03 3.15E?03 3.95E?02 3.67E?02 1.80E?02 9.34E?02 ATP2A2 NM_170665 1.95E?03 1.41E?01 2.16E?02 5.44E?03 1.35E?02 1.09E?02 EFNA1 NM_004428 8.43E?02 3.64E?02 1.07E?02 5.77E?02 7.46E?03 1.17E?03 CIDEC NM_001199623 1.24E?01 3.89E?03 6.36E?02 1.56E?03 7.17E?03 7.74E?05 DKK2 NM_014421 2.60E?02 8.08E?02 3.96E?06 3.52E?02 2.30E?06 5.89E?02 ZNF497 NM_001207009 4.06E?03 2.00E?03 1.98E?02 8.65E?02 2.90E?02 6.50E?02 TNS3 NM_022748 1.62E?01 1.34E?03 1.84E?02 1.17E?02 9.65E?03 5.70E?03 KCNH7 NM_033272 5.14E?02 6.60E?02 3.03E?02 2.61E?02 1.32E?02 2.55E?02 CLDN4 NM_001305 3.25E?02 5.24E?02 6.73E?03 5.57E?02 1.68E?02 6.25E?02 AP3M1 NM_207012 1.59E?01 2.00E?02 4.78E?03 3.71E?02 2.48E?03 7.11E?03 NME2 NM_001018139 4.11E?02 1.73E?02 1.93E?04 1.84E?02 6.93E?04 1.55E?01 RBBP8 NM_002894 4.58E?02 2.61E?02 4.78E?02 1.12E?03 1.12E?01 1.54E?03 NIPAL1 NM_207330 2.04E?02 2.82E?02 4.89E?02 2.23E?02 8.06E?02 4.06E?02 IQSEC3 NM_015232 4.36E?02 1.76E?02 3.18E?02 9.93E?02 2.16E?02 2.73E?02 FEZ2 NM_005102 6.68E?02 1.07E?01 7.59E?03 2.21E?02 1.76E?02 2.56E?02 ERMN NM_001009959 1.31E?02 9.99E?02 1.16E?02 2.89E?02 1.60E?02 7.95E?02 NYNRIN NM_025081 4.67E?02 6.86E?02 1.73E?02 3.81E?02 1.58E?02 6.40E?02 ACTG1 NM_001199954 1.37E?01 2.70E?02 2.64E?02 2.45E?02 6.31E?03 3.26E?02 NELFA NM_005663 2.23E?02 2.89E?02 2.75E?02 1.02E?01 2.52E?02 4.85E?02 ACTA1 NM_001100 5.13E?02 1.72E?02 9.57E?02 1.71E?02 5.12E?02 2.63E?02 MAGEA4 NM_001011549 5.60E?03 1.51E?01 1.18E?03 2.96E?02 4.93E?03 6.64E?02 ESRRG NM_001134285 1.35E?01 4.08E?02 2.07E?02 2.23E?03 5.84E?02 4.79E?03 ITLN1 NM_017625 8.31E?02 2.37E?02 8.43E?03 4.69E?02 5.74E?03 9.54E?02 ECHDC1 NM_018479 1.85E?02 2.07E?03 5.00E?02 1.56E?01 4.40E?02 2.18E?03 RALGDS NM_001271774 1.43E?01 3.31E?02 3.50E?02 4.91E?03 5.59E?02 6.87E?03 LGALS14 NM_203471 1.73E?02 6.99E?03 1.55E?01 1.75E?02 6.06E?02 2.34E?02 SGPP2 NM_152386 1.71E?02 7.69E?02 1.92E?02 7.45E?02 3.20E?02 6.46E?02 CCDC66 NM_001141947 1.08E?01 1.09E?02 4.28E?02 6.26E?04 1.24E?01 1.34E?03 ZNF576 NM_024327 1.13E?01 1.19E?01 1.96E?02 2.82E?02 4.27E?03 6.06E?03 MACROD2 NM_001033087 2.70E?02 7.67E?02 7.80E?02 7.41E?02 1.83E?02 1.59E?02 HMGB2 NM_001130689 3.64E?02 1.03E?01 4.11E?02 4.10E?03 1.04E?01 2.64E?03 JUN NM_002228 2.84E?02 1.12E?02 3.59E?02 9.50E?02 8.28E?02 5.26E?02 PPP2R2C NM_001206995 1.56E?02 1.14E?02 1.07E?01 4.14E?02 1.13E?01 2.15E?02 RCAN2 NM_001251974 2.02E?02 1.20E?01 3.70E?03 4.13E?02 8.05E?03 1.22E?01 SATB1 NM_001195470 9.02E?03 9.09E?02 3.55E?03 1.35E?01 2.81E?02 4.92E?02 F8A2 NM_001007523 6.75E?02 4.82E?02 3.37E?02 6.40E?02 3.24E?02 7.14E?02 MCRS1 NM_006337 8.90E?02 4.55E?02 3.75E?02 5.73E?02 3.25E?02 5.55E?02 CCDC160 NM_001101357 5.70E?02 2.94E?02 1.96E?02 7.44E?02 1.61E?02 1.22E?01 USP10 NM_001272075 6.17E?02 1.98E?02 4.55E?02 4.41E?02 6.08E?02 8.80E?02 LAD1 NM_005558 6.17E?02 8.25E?02 3.17E?02 6.39E?02 2.46E?02 5.90E?02 CCBL2 NM_001008661 3.42E?03 1.34E?01 2.68E?02 4.00E?02 9.51E?02 2.58E?02 FAM118A NM_017911 1.38E?03 2.79E?01 2.12E?03 9.03E?03 2.28E?02 1.14E?02 RINT1 NM_021930 1.25E?01 7.92E?04 8.66E?02 5.51E?02 5.91E?02 2.85E?03 SF3A2 NM_007165 6.61E?02 1.77E?01 2.10E?02 2.95E?02 5.49E?03 3.09E?02 ASXL3 NM_030632 9.94E?02 2.35E?02 1.95E?03 7.64E?02 2.54E?03 1.28E?01 PCDH7 NM_032457 9.21E?02 2.31E?02 3.66E?02 8.02E?02 1.59E?02 8.37E?02 HNRNPF NM_001098204 1.70E?02 4.06E?02 1.39E?01 4.74E?02 8.09E?02 1.35E?02 ZNF728 NM_001267716 7.66E?02 5.18E?02 7.22E?03 6.46E?02 4.60E?03 1.38E?01 CHRND NM_001256657 2.19E?01 7.80E?03 4.90E?02 1.01E?02 2.27E?02 3.81E?02 MEPE NM_001291183 9.15E?02 1.39E?02 5.30E?02 9.63E?02 1.95E?02 7.58E?02 REM1 NM_014012 1.64E?01 2.03E?02 3.23E?02 2.88E?02 1.16E?02 9.36E?02 RPUSD4 NM_032795 4.70E?03 3.67E?02 9.50E?03 1.02E?01 3.07E?02 1.67E?01 RPS11 NM_001015 8.68E?02 7.76E?03 1.05E?01 2.11E?02 9.78E?02 3.68E?02 VAMP2 NM_014232 4.60E?02 4.00E?02 1.89E?02 9.93E?02 2.01E?02 1.31E?01 DUSP10 NM_144728 1.37E?01 9.08E?02 6.90E?02 1.22E?02 1.38E?02 3.26E?02 NSG1 NM_001287763 4.81E?03 8.65E?02 2.21E?03 7.11E?02 1.58E?01 3.38E?02 CDKN2A NM_000077 2.52E?02 1.32E?02 3.08E?02 4.49E?02 2.29E?01 1.36E?02 MBD3L3 NM_001164425 3.71E?03 6.80E?02 1.18E?02 1.06E?01 7.68E?02 9.45E?02 CCDC109B NM_017918 1.24E?01 1.34E?01 1.59E?02 3.74E?02 5.98E?03 4.40E?02 CMTM4 NM_181521 9.98E?02 1.52E?02 1.90E?02 5.62E?02 5.71E?02 1.16E?01 PLA2G4B NM_001114633 2.10E?02 1.64E?01 4.71E?02 5.11E?02 4.40E?02 3.60E?02 SRC NM_198291 1.77E?01 8.69E?02 4.50E?03 3.67E?02 1.23E?03 5.80E?02 WBP1L NM_017787 3.36E?02 6.43E?02 1.27E?02 4.52E?02 1.99E?01 1.18E?02 SCN11A NM_014139 1.36E?01 1.80E?03 1.90E?02 1.03E?01 6.31E?02 5.15E?02 LHX2 NM_004789 2.05E?01 1.03E?02 6.41E?02 3.68E?02 5.06E?02 7.82E?03 DISP2 NM_033510 1.41E?02 2.22E?01 1.18E?02 4.27E?02 3.14E?03 8.52E?02 PLEC NM_201382 3.26E?02 1.45E?01 8.27E?02 3.35E?02 4.98E?02 4.09E?02 SHROOM3 NM_020859 6.29E?03 1.98E?01 4.42E?03 6.15E?02 5.90E?03 1.10E?01 TCF7L2 NM_001198529 6.63E?02 1.36E?01 2.37E?02 6.47E?02 7.49E?03 9.57E?02 TMPRSS5 NM_030770 7.17E?02 5.46E?02 7.16E?03 8.56E?02 8.48E?03 1.68E?01 ANKEF1 NM_198798 1.02E?01 2.43E?01 3.83E?03 1.26E?02 6.62E?03 3.36E?02 CALD1 NM_033140 1.40E?02 3.43E?02 4.35E?02 1.58E?01 4.24E?02 1.11E?01 NKX2-2 NM_002509 1.10E?01 1.18E?01 2.65E?02 2.82E?02 1.57E?02 1.05E?01 RPL15 NM_001253384 1.25E?01 1.25E?02 6.18E?02 3.54E?03 2.03E?01 2.28E?03 TMEM55B NM_144568 7.24E?02 1.81E?02 8.17E?02 6.26E?02 8.91E?02 8.51E?02 STYX NM_001130701 3.87E?02 5.08E?03 1.18E?01 7.94E?02 1.02E?01 6.72E?02 EIF2B2 NM_014239 9.31E?02 1.06E?01 3.73E?02 6.70E?02 4.50E?02 6.27E?02 GOLGA8M NM_001282468 1.35E?01 8.66E?02 1.20E?01 1.50E?02 5.17E?02 7.57E?03 SMIM12 NM_001164825 8.83E?02 1.60E?01 6.06E?02 6.55E?03 7.98E?02 1.98E?02 CYB5R3 NM_001171661 1.15E?01 7.58E?02 4.22E?02 6.28E?02 6.98E?02 5.15E?02 POP1 NM_015029 1.52E?01 3.10E?02 6.56E?02 3.57E?02 9.83E?02 3.48E?02 PRAC1 NM_032391 2.44E?02 5.20E?02 6.53E?02 3.57E?02 1.73E?01 7.05E?02 LTN1 NM_015565 6.29E?02 9.84E?02 6.78E?02 8.46E?02 2.92E?02 8.14E?02 ABCA4 NM_000350 2.42E?02 2.82E?02 1.59E?01 1.04E?01 7.19E?02 4.14E?02 DAO NM_001917 5.74E?02 1.51E?01 3.70E?02 3.59E?02 4.52E?02 1.04E?01 FAM47A NM_203408 4.28E?02 2.43E?01 3.07E?02 3.38E?02 3.07E?02 5.05E?02 TMTC2 NM_152588 6.66E?02 6.90E?02 1.07E?01 5.70E?02 8.13E?02 5.11E?02 ALAS1 NM_199166 1.04E?01 2.47E?02 1.28E?01 3.73E?02 1.22E?01 1.78E?02 LIN7C NM_018362 1.84E?01 3.79E?02 9.41E?02 2.21E?02 4.86E?02 4.60E?02 C3orf80 NM_001168214 9.04E?02 4.85E?02 4.06E?02 1.08E?01 4.02E?02 1.06E?01 TRIM50 NM_001281451 1.13E?02 8.34E?02 3.13E?02 3.80E?02 1.86E?01 8.65E?02 CMTM3 NM_144601 1.87E?01 1.93E?02 8.37E?02 5.90E?02 8.67E?02 1.08E?03 LEMD2 NM_181336 2.30E?01 3.31E?02 1.66E?02 3.94E?02 3.39E?03 1.15E?01 DPM3 NM_153741 1.77E?01 1.67E?02 1.34E?01 2.83E?03 1.13E?01 2.55E?03 TRIM7 NM_203293 1.07E?01 3.00E?03 9.13E?02 7.56E?03 2.16E?01 2.01E?02 YY1AP1 NM_001198902 2.57E?01 5.07E?03 1.02E?01 1.87E?02 4.21E?02 2.13E?02 KCNV1 NM_014379 7.28E?02 1.64E?02 1.54E?01 3.94E?02 6.25E?02 1.02E?01 NDRG4 NM_022910 1.93E?02 2.33E?01 5.20E?02 4.00E?02 2.72E?02 7.61E?02 SH3TC1 NM_018986 6.37E?02 1.80E?01 8.64E?03 1.89E?02 8.74E?03 1.68E?01 LITAF NM_004862 1.26E?02 3.03E?02 8.15E?02 3.83E?02 2.38E?01 4.82E?02 CD109 NM_001159587 1.74E?01 5.71E?03 1.27E?01 1.55E?02 1.12E?01 1.52E?02 ATG16L2 NM_033388 1.20E?01 2.26E?02 3.82E?02 1.08E?01 9.74E?02 6.42E?02 FAM151B NM_205548 2.39E?02 1.21E?01 7.67E?02 8.04E?02 6.46E?02 8.65E?02 ANK1 NM_020475 1.93E?01 2.30E?02 7.85E?02 5.01E?03 4.64E?02 1.08E?01 ATF7IP NM_018179 2.47E?02 6.73E?02 5.40E?02 7.62E?02 4.26E?02 1.90E?01 PLAA NM_001031689 8.70E?03 2.32E?01 2.74E?02 8.10E?02 1.94E?02 8.80E?02 FCER1A NM_002001 1.55E?02 1.44E?01 7.49E?02 8.75E?02 3.79E?02 9.79E?02 HGC6.3 NM_001129895 2.18E?01 3.68E?02 4.06E?02 3.08E?02 9.85E?03 1.24E?01 EXOC4 NM_021807 9.51E?02 1.02E?01 2.05E?02 1.50E?01 7.55E?02 2.08E?02 CHD3 NM_001005271 9.99E?02 6.73E?02 7.89E?02 4.29E?02 2.81E?02 1.50E?01 LZTR1 NM_006767 2.06E?01 9.78E?02 4.92E?02 3.29E?02 2.07E?02 6.06E?02 ZIC5 NM_033132 2.39E?02 1.78E?01 7.86E?03 9.17E?02 1.18E?01 5.18E?02 EFCAB1 NM_001142857 3.24E?02 8.53E?02 1.31E?01 5.16E?02 1.06E?01 6.63E?02 TPRN NM_001128228 1.65E?01 2.14E?02 1.46E?01 4.09E?03 1.20E?01 1.67E?02 LRFN1 NM_020862 7.98E?02 8.76E?02 4.17E?02 9.53E?02 1.60E?01 8.76E?03 NSL1 NM_015471 1.45E?02 2.09E?01 2.80E?02 1.55E?01 1.54E?02 5.16E?02 CELF2 NM_006561 3.83E?03 2.23E?01 1.73E?02 9.70E?02 4.68E?02 8.65E?02 GHRHR NM_000823 6.90E?02 2.00E?02 4.26E?02 1.38E?01 8.03E?02 1.25E?01 FZR1 NM_016263 5.21E?02 5.89E?02 3.08E?01 8.41E?04 3.50E?02 2.13E?02 SERF2 NM_001199877 1.57E?02 1.00E?01 1.11E?03 1.41E?01 9.08E?02 1.28E?01 ZEB1 NM_001174096 1.84E?01 1.58E?02 5.26E?02 7.88E?02 2.30E?02 1.25E?01 PPP3R2 NM_147180 3.10E?01 2.97E?02 8.74E?02 2.91E?03 3.88E?02 1.07E?02 CST4 NM_001899 1.62E?01 1.76E?03 1.94E?01 8.45E?04 1.23E?01 2.74E?03 PCYT2 NM_001184917 1.44E?02 4.53E?02 1.12E?02 2.14E?01 2.10E?02 1.79E?01 DCN NM_001920 2.37E?01 4.42E?04 1.33E?01 7.49E?03 9.65E?02 1.11E?02 KRAS NM_004985 7.54E?02 8.06E?04 1.98E?01 3.86E?03 1.97E?01 1.05E?02 KCNMA1 NM_001271518 2.86E?01 3.07E?02 1.03E?01 4.89E?03 4.76E?02 1.37E?02 SMARCA2 NM_001289397 3.79E?02 3.06E?02 1.32E?02 9.24E?02 3.23E?02 2.81E?01 SSX4B NM_001034832 6.97E?02 1.54E?01 6.85E?02 7.26E?02 6.16E?02 6.11E?02 LDLRAD3 NM_174902 2.10E?01 4.20E?03 2.40E?02 5.47E?02 1.10E?01 8.58E?02 RPL6 NM_000970 1.13E?01 2.30E?03 1.98E?01 4.85E?03 1.66E?01 5.56E?03 FLI1 NM_001167681 2.22E?01 1.82E?02 2.78E?02 8.26E?02 1.72E?02 1.22E?01 KCNQ4 NM_004700 7.37E?02 6.00E?02 1.11E?01 3.55E?02 8.71E?02 1.25E?01 BCL11B NM_138576 2.55E?02 9.14E?02 1.21E?01 8.58E?02 7.69E?02 9.32E?02 ATP7A NM_000052 1.30E?01 5.79E?02 5.93E?02 1.51E?01 6.61E?02 3.04E?02 CACNA1B NM_001243812 1.12E?01 8.87E?02 1.22E?01 3.13E?02 1.16E?01 2.54E?02 COL11A1 NM_001190709 1.35E?01 9.37E?02 3.62E?02 7.31E?02 1.77E?02 1.40E?01 SSH3 NM_017857 8.47E?02 5.71E?02 3.34E?02 7.82E?02 5.77E?02 1.85E?01 LOC113230 NM_001291291 1.28E?01 3.69E?02 7.80E?02 4.71E?02 2.07E?01 1.49E?03 PLA2G7 NM_001168357 1.64E?01 1.40E?01 3.91E?02 1.81E?02 2.75E?02 1.11E?01 CACNA2D2 NM_001174051 3.02E?02 9.41E?02 4.65E?02 4.29E?02 1.74E?01 1.12E?01 UBE2T NM_014176 1.29E?01 1.08E?02 5.16E?02 3.87E?02 2.38E?01 3.45E?02 SPTBN2 NM_006946 9.07E?02 1.73E?01 4.18E?02 8.61E?02 4.38E?02 6.83E?02 SERPINB8 NM_001276490 1.02E?01 2.00E?03 1.25E?01 4.86E?02 1.99E?01 2.81E?02 TMEM182 NM_144632 7.59E?02 6.12E?02 1.61E?01 4.61E?02 1.06E?01 5.43E?02 EFHC1 NM_001172420 6.57E?02 3.72E?03 1.07E?01 1.54E?02 3.00E?01 1.36E?02 KIF13A NM_001105568 2.01E?01 2.33E?02 2.90E?02 1.23E?01 7.24E?02 5.99E?02 SOCS2 NM_001270467 2.34E?01 7.11E?02 5.05E?02 5.28E?02 3.15E?02 6.87E?02 GCNT2 NM_145649 1.26E?02 1.45E?01 2.15E?02 9.20E?02 1.66E?01 7.30E?02 PHKB NM_000293 7.41E?02 1.70E?01 6.83E?02 6.07E?02 4.97E?02 8.87E?02 ABI1 NM_001178116 4.80E?02 6.97E?02 1.09E?01 6.43E?02 1.20E?01 1.06E?01 OCLN NM_001205255 2.53E?02 1.32E?01 6.92E?02 1.02E?01 2.89E?02 1.59E?01 TRIM5 NM_033092 1.08E?01 1.85E?02 1.62E?01 4.66E?02 1.32E?01 5.00E?02 NFE2 NM_001136023 3.94E?03 1.43E?01 2.47E?02 1.89E?01 2.19E?02 1.36E?01 PHKA1 NM_001172436 6.59E?02 1.26E?01 3.35E?03 7.69E?02 2.69E?02 2.23E?01 OR2C3 NM_198074 3.05E?02 2.33E?01 1.11E?02 1.25E?01 1.26E?03 1.20E?01 LTBR NM_002342 1.64E?01 1.68E?03 2.38E?01 1.38E?02 8.74E?02 1.67E?02 TACR3 NM_001059 8.28E?02 7.57E?04 1.81E?01 2.05E?02 2.18E?01 1.98E?02 PRKRA NM_001139518 2.64E?01 9.51E?02 3.10E?02 1.43E?02 8.61E?02 3.62E?02 PKIG NM_001281444 9.46E?03 9.63E?02 3.36E?02 2.61E?01 6.60E?02 6.18E?02 YPEL5 NM_001127400 8.93E?02 4.32E?02 6.79E?02 8.25E?02 1.44E?01 1.02E?01 TGFBR1 NM_001130916 1.80E?01 1.12E?02 3.55E?02 4.01E?02 1.37E?01 1.27E?01 UBXN7 NM_015562 4.72E?02 3.11E?02 1.98E?01 2.77E?02 1.66E?01 6.13E?02 PRDX1 NM_001202431 1.29E?04 1.67E?01 3.00E?03 1.74E?01 9.57E?03 1.81E?01 KBTBD7 NM_032138 5.53E?02 8.49E?02 1.41E?01 6.99E?02 9.21E?02 9.24E?02 SHE NM_001010846 8.72E?02 1.51E?03 6.85E?02 7.96E?03 3.46E?01 2.45E?02 ZNF486 NM_052852 1.45E?01 6.22E?02 1.98E?01 4.14E?04 1.29E?01 1.81E?03 TTLL10 NM_001130045 1.92E?01 5.51E?02 3.50E?02 7.47E?02 9.89E?02 8.36E?02 BACE1 NM_138971 1.35E?01 1.71E?01 6.95E?02 3.17E?02 9.50E?02 3.74E?02 GNG11 NM_004126 1.09E?01 6.39E?03 2.02E?01 1.51E?01 4.93E?02 2.20E?02 HUS1B NM_148959 9.86E?02 7.86E?02 1.79E?01 1.46E?02 1.47E?01 2.16E?02 ART1 NM_004314 1.99E?01 8.50E?03 9.16E?02 5.54E?02 4.90E?02 1.36E?01 MTRR NM_024010 3.98E?02 2.86E?02 1.40E?02 2.38E?01 4.06E?02 1.79E?01 TLE3 NM_020908 1.53E?01 9.97E?03 1.71E?01 2.87E?03 2.01E?01 2.80E?03 WARS2 NM_015836 1.80E?03 9.17E?02 4.42E?04 1.22E?01 2.17E?03 3.23E?01 ADCYAP1 NM_001099733 9.29E?02 1.72E?01 2.27E?02 5.93E?02 1.26E?01 6.91E?02 FAM155A NM_001080396 2.82E?02 9.06E?02 8.35E?02 1.33E?01 3.65E?02 1.70E?01 CD151 NM_139030 1.42E?01 1.14E?01 2.90E?02 2.36E?02 1.70E?01 6.38E?02 KIF3A NM_007054 1.23E?01 4.11E?02 7.51E?02 4.36E?02 1.51E?01 1.11E?01 CCDC84 NM_198489 1.58E?01 4.66E?03 1.14E?01 5.92E?02 1.95E?01 1.66E?02 OR4C11 NM_001004700 9.85E?02 4.21E?02 4.58E?02 1.43E?01 1.84E?01 3.54E?02 ZNF274 NM_133502 1.32E?01 2.30E?02 1.35E?01 3.64E?02 1.82E?01 4.12E?02 GNG7 NM_052847 7.90E?02 1.85E?01 6.29E?02 6.92E?02 3.46E?02 1.19E?01 TTC37 NM_014639 5.04E?04 9.77E?02 4.33E?03 7.50E?02 8.13E?03 3.64E?01 DNPEP NM_012100 1.94E?02 7.68E?02 3.59E?03 1.72E?01 5.66E?03 2.76E?01 GPRASP2 NM_001184876 2.72E?02 9.80E?02 1.43E?01 2.92E?03 2.78E?01 4.28E?03 C9orf92 NM_001271829 1.46E?01 1.20E?02 1.80E?01 3.54E?02 1.18E?01 6.39E?02 MIER1 NM_001146112 1.03E?01 1.04E?01 7.82E?02 8.82E?02 7.85E?02 1.04E?01 SMIM24 NM_001136503 4.64E?02 1.83E?01 3.56E?02 1.02E?01 8.56E?02 1.09E?01 CYB5D2 NM_144611 8.35E?02 1.55E?01 6.73E?02 9.37E?02 1.82E?02 1.45E?01 ABHD8 NM_024527 5.25E?03 1.76E?01 3.47E?03 1.75E?01 1.93E?03 2.01E?01 MX1 NM_001178046 1.78E?02 1.09E?01 6.08E?02 1.26E?01 8.53E?02 1.64E?01 TNFAIP8L2- NM_001204848 1.88E?01 8.00E?02 4.19E?02 5.15E?02 1.32E?01 7.12E?02 SCNM1 BEX2 NM_001168401 4.71E?02 1.25E?01 5.16E?02 1.03E?01 8.09E?02 1.58E?01 SLC25A1 NM_005984 8.58E?02 1.29E?01 8.31E?02 8.38E?02 3.18E?02 1.53E?01 GPS2 NM_004489 9.06E?02 2.14E?01 6.41E?02 6.10E?02 2.57E?02 1.11E?01 CORO1C NM_001105237 1.01E?01 1.62E?02 1.60E?01 9.07E?02 1.63E?01 3.69E?02 FMO3 NM_006894 6.90E?02 9.04E?02 1.77E?01 1.59E?02 1.98E?01 1.75E?02 THOC7 NM_025075 2.68E?01 1.10E?01 5.04E?02 6.45E?02 1.03E?02 6.48E?02 ENY2 NM_001193557 2.36E?02 1.56E?02 9.24E?02 8.29E?02 2.23E?01 1.32E?01 LARP6 NM_001286679 1.92E?01 1.73E?01 3.80E?02 1.57E?02 1.25E?01 2.77E?02 AP1S1 NM_001283 6.46E?02 5.32E?02 1.00E?01 8.52E?02 1.13E?01 1.58E?01 HAUS4 NM_001166269 3.90E?01 4.63E?03 6.60E?02 3.56E?02 8.14E?03 6.98E?02 SHD NM_020209 1.43E?03 2.01E?01 2.16E?03 2.02E?01 2.72E?03 1.64E?01 ADRA2A NM_000681 1.25E?01 1.15E?01 1.09E?01 3.08E?02 1.06E?01 8.83E?02 NCDN NM_001014839 1.06E?02 1.42E?01 1.12E?01 1.27E?01 8.19E?02 1.01E?01 ZNF764 NM_001172679 1.92E?01 1.02E?02 1.68E?01 2.09E?02 1.34E?01 5.48E?02 KIAA0247 NM_014734 1.72E?01 3.48E?02 2.17E?01 2.15E?02 1.12E?01 2.37E?02 ZNF283 NM_181845 1.23E?01 1.18E?01 1.52E?01 3.17E?02 6.05E?02 9.80E?02 LSP1 NM_001013253 2.08E?01 3.19E?04 1.82E?01 2.19E?02 1.26E?01 4.54E?02 ATG16L1 NM_017974 7.74E?02 1.33E?01 1.09E?01 5.09E?02 1.71E?01 4.31E?02 NOL12 NM_024313 5.42E?02 2.18E?02 5.00E?02 4.98E?02 2.72E?01 1.40E?01 TMEM132A NM_017870 9.46E?02 8.61E?02 6.09E?02 2.75E?02 2.84E?01 3.65E?02 MPP2 NM_001278375 1.26E?01 5.94E?02 2.07E?01 1.12E?02 1.71E?01 1.46E?02 ABCG4 NM_022169 3.61E?03 3.51E?02 1.27E?01 8.69E?02 2.02E?01 1.36E?01 GSDMD NM_001166237 2.44E?01 6.47E?02 4.38E?02 8.97E?02 1.19E?03 1.48E?01 OR2D3 NM_001004684 8.35E?02 1.53E?01 2.63E?02 5.89E?02 1.20E?01 1.54E?01 PLXDC2 NM_001282736 2.23E?01 1.47E?01 9.95E?02 1.44E?02 7.48E?02 3.84E?02 EGR1 NM_001964 3.63E?02 2.08E?01 4.68E?02 1.24E?01 2.54E?02 1.58E?01 IMPG2 NM_016247 1.54E?01 1.02E?01 7.34E?02 3.75E?02 2.15E?02 2.11E?01 C1orf100 NM_001276349 1.59E?01 1.29E?01 9.03E?02 7.89E?02 5.59E?02 8.74E?02 SLC25A35 NM_201520 3.23E?02 1.32E?02 1.48E?01 1.11E?01 2.08E?01 9.00E?02 NFIC NM_205843 1.46E?01 1.60E?03 3.96E?02 1.00E?01 4.97E?02 2.70E?01 HNRNPR NM_001102398 6.11E?02 3.86E?02 2.01E?01 3.20E?02 2.26E?01 4.78E?02 GALE NM_001127621 1.30E?01 2.21E?01 9.75E?03 5.83E?02 5.51E?02 1.34E?01 WNT2B NM_004185 1.60E?01 1.57E?02 5.04E?02 2.43E?01 1.13E?01 2.66E?02 RNF150 NM_020724 2.40E?01 1.19E?01 3.88E?02 1.51E?01 2.21E?02 3.90E?02 EXOC3L1 NM_178516 3.61E?02 4.84E?02 1.43E?01 1.47E?01 8.04E?02 1.56E?01 DAPL1 NM_001017920 9.96E?02 1.69E?01 1.09E?01 6.19E?02 1.56E?01 1.59E?02 MROH6 NM_001100878 1.48E?01 1.16E?01 6.59E?02 9.55E?02 1.17E?01 6.97E?02 TMEM147 NM_032635 2.50E?04 3.55E?01 6.74E?03 1.04E?01 1.27E?01 2.03E?02 SLC39A1 NM_001271960 1.09E?01 1.28E?01 4.71E?02 6.91E?02 1.53E?01 1.07E?01 POLD3 NM_006591 4.85E?03 1.46E?01 5.09E?03 2.75E?01 1.16E?01 6.60E?02 PHF19 NM_001286840 1.54E?01 5.19E?03 2.90E?02 9.01E?02 2.08E?01 1.28E?01 IL18RAP NM_003853 1.03E?01 2.03E?01 1.14E?02 1.64E?01 1.17E?02 1.21E?01 CLTCL1 NM_001835 8.96E?02 1.08E?01 9.33E?02 6.73E?02 4.49E?02 2.12E?01 NDUFA5 NM_001282419 8.61E?02 3.83E?01 1.42E?02 7.55E?02 3.25E?02 2.59E?02 RIMKLB NM_020734 2.48E?02 3.94E?03 2.75E?01 3.37E?03 3.04E?01 6.65E?03 NMT2 NM_004808 3.22E?02 2.51E?01 1.80E?02 1.90E?01 1.25E?02 1.15E?01 DEDD NM_001039711 3.94E?02 2.07E?01 2.74E?02 1.36E?01 7.45E?02 1.36E?01 RAI14 NM_001145520 8.76E?02 2.18E?01 4.79E?02 9.74E?02 5.23E?02 1.17E?01 HIST1H3G NM_003534 1.45E?01 1.09E?01 1.37E?01 3.76E?02 1.25E?01 6.51E?02 MANEA NM_024641 1.93E?04 1.86E?01 6.86E?04 1.85E?01 8.61E?04 2.47E?01 PLAG1 NM_001114635 5.82E?02 4.66E?01 1.02E?02 2.78E?02 1.06E?03 5.68E?02 LDB3 NM_001171610 5.32E?02 2.10E?01 1.17E?01 1.29E?01 3.67E?02 7.40E?02 DUPD1 NM_001003892 1.85E?01 5.19E?03 2.11E?01 6.19E?03 2.13E?01 1.23E?03 RHPN1 NM_052924 5.69E?02 6.23E?02 2.66E?02 1.66E?01 4.79E?02 2.62E?01 ARHGEF26 NM_001251963 2.11E?01 4.70E?02 1.84E?01 1.94E?02 1.45E?01 1.70E?02 LTF NM_001199149 3.88E?02 7.38E?02 2.01E?02 3.01E?01 1.19E?01 7.17E?02 C11orf83 NM_001085372 2.50E?01 3.42E?02 1.55E?01 4.56E?02 7.57E?02 6.49E?02 ITGB1BP2 NM_012278 4.47E?02 1.22E?01 7.88E?02 5.86E?02 2.26E?01 9.57E?02 RFPL2 NM_001098527 6.13E?02 3.42E?01 2.24E?02 1.16E?01 2.70E?02 5.68E?02 IQCF2 NM_203424 1.40E?01 1.92E?02 1.66E?01 6.33E?02 1.45E?01 9.42E?02 SRP54 NM_003136 1.73E?01 5.95E?02 8.64E?03 1.38E?01 7.09E?02 1.80E?01 SLURP1 NM_020427 1.19E?01 6.65E?03 6.83E?02 7.16E?02 2.51E?01 1.14E?01 TAF3 NM_031923 2.25E?01 1.51E?01 1.06E?02 1.08E?01 1.93E?04 1.36E?01 MFSD5 NM_001170790 2.44E?01 4.46E?02 7.85E?02 9.56E?03 2.28E?01 2.62E?02 TVP23B NM_016078 1.67E?02 7.55E?02 2.01E?02 2.38E?01 3.02E?02 2.51E?01 EEFSEC NM_021937 8.61E?02 7.49E?02 7.48E?02 5.21E?02 2.54E?01 8.99E?02 IFIT3 NM_001549 8.60E?02 1.56E?01 3.90E?02 1.05E?01 1.35E?01 1.12E?01 CCNT2 NM_058241 1.65E?01 1.09E?02 7.17E?02 2.22E?01 8.46E?02 7.89E?02 OBP2A NM_014582 3.17E?02 9.45E?02 1.71E?02 1.89E?01 1.22E?01 1.81E?01 ZBTB22 NM_001145338 2.41E?01 3.23E?03 1.89E?01 3.51E?02 1.14E?01 5.22E?02 LRP10 NM_014045 9.12E?02 2.85E?02 5.29E?02 9.29E?02 1.55E?01 2.18E?01 CSAG1 NM_153478 3.74E?02 2.10E?01 1.03E?01 1.59E?01 1.17E?01 1.21E?02 AICDA NM_020661 3.58E?02 1.17E?01 1.05E?01 2.41E?01 6.67E?02 7.50E?02 PDK2 NM_001199900 7.22E?03 2.42E?02 1.20E?01 1.05E?01 3.17E?01 6.70E?02 ASB8 NM_024095 6.92E?02 6.20E?02 1.45E?02 2.72E?02 4.28E?01 4.08E?02 ZNF277 NM_021994 1.89E?02 2.90E?01 1.64E?02 4.41E?02 1.94E?01 7.82E?02 RAB2A NM_002865 1.18E?01 1.39E?01 4.63E?02 1.30E?01 7.07E?02 1.38E?01 C10orf105 NM_001164375 9.48E?02 1.49E?01 1.69E?01 4.06E?02 6.47E?02 1.26E?01 CCDC169 NM_001144984 3.14E?02 1.04E?01 8.82E?02 5.74E?02 2.68E?01 9.39E?02 XPNPEP1 NM_001167604 4.03E?04 2.50E?01 2.68E?02 1.33E?01 1.77E?02 2.16E?01 MXRA8 NM_001282582 1.23E?01 5.65E?02 9.69E?02 2.76E?01 4.99E?02 4.23E?02 TOX2 NM_001098797 1.44E?01 1.04E?01 5.94E?02 2.71E?02 2.18E?01 9.15E?02 TEC NM_003215 2.85E?03 9.17E?02 1.48E?01 7.72E?02 3.00E?01 2.60E?02 SYNGR4 NM_012451 6.43E?02 2.85E?01 7.27E?02 8.27E?02 2.81E?02 1.14E?01 DYNC1I1 NM_001135556 2.69E?01 1.18E?01 7.84E?02 7.05E?02 2.40E?02 9.06E?02 DEXI NM_014015 1.35E?01 2.78E?02 7.55E?02 4.15E?02 3.01E?01 6.94E?02 PLAC1 NM_021796 1.03E?01 5.50E?02 1.70E?01 5.25E?02 2.26E?01 4.41E?02 PNOC NM_001284244 3.39E?02 5.90E?02 2.34E?02 3.35E?01 2.09E?03 1.99E?01 ZNF827 NM_178835 6.82E?03 5.15E?02 4.18E?01 7.71E?03 1.58E?01 1.06E?02 UIMC1 NM_001199297 3.72E?01 1.89E?01 5.10E?02 1.73E?02 1.24E?02 1.31E?02 TAAR8 NM_053278 9.58E?02 1.77E?02 9.83E?02 4.20E?02 3.51E?01 5.00E?02 HNRNPF NM_004966 1.83E?01 1.63E?02 1.86E?01 5.42E?02 9.01E?02 1.25E?01 NREP NM_001142483 2.19E?01 1.97E?01 1.27E?02 8.78E?02 9.52E?03 1.29E?01 ZNF605 NM_001164715 1.28E?02 2.53E?01 3.07E?02 1.10E?01 5.18E?02 1.98E?01 SHISA5 NM_001272066 7.00E?02 1.72E?01 1.15E?01 6.73E?02 1.25E?01 1.08E?01 MCL1 NM_021960 3.22E?04 1.45E?01 2.52E?02 2.21E?01 5.20E?02 2.14E?01 TRIM62 NM_018207 7.03E?02 1.71E?01 5.25E?02 1.19E?01 5.37E?02 1.91E?01 C9orf57 NM_001128618 5.67E?02 1.70E?01 7.74E?02 1.50E?01 9.52E?02 1.09E?01 RLTPR NM_001013838 1.18E?02 1.33E?01 8.16E?02 1.01E?01 7.14E?02 2.60E?01 RPL13 NM_001243130 2.08E?01 9.52E?02 6.92E?02 9.65E?02 6.13E?02 1.30E?01 RNF170 NM_001160224 3.02E?01 1.44E?01 7.99E?02 2.54E?02 2.84E?02 8.06E?02 TLX2 NM_016170 5.01E?02 1.38E?01 7.09E?02 2.27E?02 2.98E?01 8.31E?02 ZBTB49 NM_145291 1.87E?01 1.13E?01 3.84E?02 1.14E?01 7.81E?02 1.33E?01 MEX3A NM_001093725 1.50E?01 1.08E?01 6.88E?02 4.38E?02 2.06E?01 8.71E?02 TERF2 NM_005652 4.13E?01 6.27E?02 5.07E?02 1.33E?02 1.11E?01 1.60E?02 SLC8A2 NM_015063 1.98E?02 8.50E?02 1.28E?01 8.70E?02 2.19E?01 1.28E?01 FBXO33 NM_203301 7.15E?02 6.71E?02 7.87E?02 1.29E?01 2.90E?01 3.13E?02 NLGN4Y NM_014893 1.46E?01 2.06E?01 4.46E?02 1.86E?01 5.50E?02 2.95E?02 PRDM8 NM_020226 1.54E?02 3.56E?01 1.64E?02 4.11E?02 7.35E?02 1.65E?01 C9orf84 NM_173521 1.75E?02 1.73E?01 7.81E?02 1.59E?01 2.10E?01 3.21E?02 MRPS15 NM_031280 5.91E?02 2.43E?01 8.17E?02 1.06E?01 7.32E?02 1.08E?01 AHCYL1 NM_001242674 1.33E?01 1.86E?01 4.62E?02 1.21E?01 3.08E?02 1.56E?01 ZNF766 NM_001010851 2.49E?01 1.54E?02 2.04E?01 6.52E?03 1.89E?01 7.56E?03 LOXL1 NM_005576 7.10E?02 2.44E?01 1.36E?01 4.04E?02 1.17E?01 6.37E?02 PRMT7 NM_001290018 8.67E?02 3.01E?01 6.80E?02 1.18E?01 1.52E?03 9.86E?02 ELP3 NM_018091 7.87E?02 2.65E?01 3.11E?03 7.88E?02 1.40E?01 1.08E?01 CNN3 NM_001839 6.82E?02 5.83E?02 1.45E?01 1.24E?01 1.53E?01 1.25E?01 NPY5R NM_006174 2.34E?02 1.68E?02 3.39E?02 2.72E?01 2.33E?02 3.07E?01 SLITRK1 NM_052910 1.12E?01 1.92E?01 2.31E?01 6.37E?02 5.25E?02 2.79E?02 TEAD4 NM_003213 7.93E?03 3.42E?01 5.19E?03 1.26E?01 1.65E?03 1.98E?01 THOP1 NM_003249 2.46E?01 1.70E?01 1.78E?01 1.85E?02 4.93E?02 1.88E?02 GSN NM_001258030 1.96E?01 5.48E?02 1.34E?01 8.68E?02 9.13E?02 1.18E?01 APRT NM_000485 4.29E?02 1.67E?01 1.23E?01 9.02E?02 9.38E?02 1.65E?01 CORO6 NM_032854 1.15E?01 4.90E?02 5.24E?02 1.35E?01 5.12E?02 2.80E?01 COL9A3 NM_001853 2.43E?02 6.13E?02 9.70E?02 8.18E?02 2.97E?01 1.21E?01 MAGEB17 NM_001277307 7.71E?02 2.27E?01 9.85E?02 1.73E?01 8.19E?02 2.58E?02 CD97 NM_078481 2.31E?02 4.32E?03 1.27E?01 1.19E?01 2.20E?01 1.90E?01 PPM1G NM_177983 3.43E?02 2.16E?01 6.45E?02 1.53E?01 6.95E?02 1.46E?01 DVL3 NM_004423 7.26E?02 3.83E?02 2.28E?01 5.13E?02 2.55E?01 3.99E?02 CREG2 NM_153836 4.68E?01 4.04E?02 1.13E?01 3.78E?03 5.29E?02 7.79E?03 DMPK NM_001081563 8.29E?02 2.32E?02 9.12E?02 1.01E?01 6.48E?02 3.23E?01 EIF2B4 NM_172195 1.05E?01 2.72E?01 1.54E?01 2.38E?02 7.85E?02 5.25E?02 PRSS56 NM_001195129 2.61E?01 1.20E?01 1.35E?01 8.06E?02 6.25E?02 2.75E?02 UAP1L1 NM_207309 7.10E?02 1.03E?01 2.27E?02 1.45E?01 1.94E?02 3.26E?01 AKAP6 NM_004274 2.01E?01 1.44E?01 1.44E?01 7.78E?02 5.61E?02 6.41E?02 ZIC1 NM_003412 9.20E?02 4.21E?01 5.71E?03 4.98E?02 7.07E?02 4.94E?02 DDX43 NM_018665 8.34E?03 6.94E?03 1.75E?02 1.97E?01 2.41E?01 2.19E?01 NAE1 NM_003905 2.36E?01 6.32E?02 1.06E?01 3.52E?02 1.82E?01 6.76E?02 PLS1 NM_002670 5.05E?02 2.19E?01 1.36E?01 1.16E?01 1.13E?01 5.53E?02 TBP NM_001172085 6.20E?02 8.95E?02 5.81E?02 4.36E?02 3.23E?01 1.16E?01 FAM217A NM_173563 2.33E?01 1.59E?02 2.34E?01 1.09E?01 9.60E?02 4.64E?03 EXOC3L2 NM_138568 1.67E?01 7.14E?02 1.41E?01 2.83E?02 1.37E?01 1.49E?01 SOCS3 NM_003955 1.76E?01 1.90E?02 1.18E?01 2.05E?01 7.19E?02 1.04E?01 TRIM60 NM_001258025 3.66E?01 1.65E?02 8.02E?02 1.21E?02 1.96E?01 2.31E?02 SAMD8 NM_144660 1.34E?01 1.66E?02 6.35E?02 1.51E?01 3.10E?01 1.95E?02 SMPDL3B NM_001009568 5.65E?02 1.24E?01 1.52E?01 2.19E?01 1.04E?01 4.18E?02 FOXP1 NM_001244808 2.00E?02 2.82E?01 6.04E?02 1.55E?01 6.84E?02 1.12E?01 CHD4 NM_001273 4.63E?01 4.45E?02 4.18E?02 3.64E?02 6.41E?03 1.06E?01 ELMO1 NM_014800 2.26E?01 1.21E?01 5.50E?02 1.19E?01 3.64E?02 1.43E?01 PLEKHM3 NM_001080475 3.19E?01 1.66E?02 1.00E?01 3.82E?03 2.53E?01 8.42E?03 MOB4 NM_015387 2.57E?01 4.15E?02 1.28E?01 3.61E?02 2.29E?01 1.27E?02 C6orf15 NM_014070 6.86E?04 3.84E?01 4.91E?02 8.89E?02 1.03E?01 8.17E?02 RANBP1 NM_001278641 1.44E?01 2.90E?02 2.29E?01 9.21E?03 2.83E?01 1.39E?02 TDRD9 NM_153046 2.59E?01 7.23E?02 1.25E?01 7.99E?02 2.58E?02 1.48E?01 ATP6V0C NM_001694 5.73E?02 9.29E?03 2.55E?01 3.86E?02 2.55E?01 9.59E?02 TMPRSS9 NM_182973 6.13E?02 9.91E?02 1.34E?01 1.42E?01 1.49E?01 1.26E?01 ZNF408 NM_001184751 4.00E?02 9.87E?02 3.82E?02 2.17E?01 1.50E?01 1.67E?01 ZNF648 NM_001009992 8.06E?02 1.82E?01 6.02E?02 2.18E?01 2.95E?02 1.42E?01 USP22 NM_015276 4.08E?01 1.42E?01 7.96E?02 2.13E?02 1.97E?02 4.32E?02 PCDP1 NM_001271049 2.22E?01 1.65E?01 1.18E?01 2.85E?02 8.44E?02 9.60E?02 PROC NM_000312 1.72E?01 1.83E?01 7.71E?02 1.47E?01 7.76E?02 5.72E?02 COQ6 NM_182480 3.81E?01 4.03E?02 1.58E?01 5.25E?03 1.14E?01 1.57E?02 C12orf29 NM_001009894 5.99E?03 1.85E?01 4.59E?03 3.25E?01 1.96E?02 1.74E?01 CDC27 NM_001114091 1.37E?01 7.52E?02 1.39E?01 7.15E?02 2.11E?01 8.09E?02 PCDHGB1 NM_018922 1.67E?01 9.02E?02 1.19E?01 9.76E?02 1.47E?01 9.43E?02 SS18L1 NM_198935 1.03E?01 7.24E?02 6.72E?02 1.89E?01 6.04E?02 2.27E?01 KLK10 NM_002776 8.38E?02 1.29E?01 8.89E?02 2.30E?01 4.47E?02 1.44E?01 GJB3 NM_001005752 2.85E?01 8.08E?03 6.98E?02 1.41E?01 4.54E?02 1.71E?01 TXLNA NM_175852 2.04E?01 2.15E?02 2.18E?01 1.61E?02 2.53E?01 8.78E?03 YWHAZ NM_001135699 7.49E?02 2.61E?01 1.84E?02 1.81E?01 2.04E?02 1.66E?01 C10orf82 NM_144661 2.17E?01 3.85E?02 1.58E?01 1.18E?01 3.70E?02 1.54E?01 FOXI1 NM_012188 2.99E?03 3.05E?01 1.83E?02 9.67E?02 9.48E?02 2.07E?01 RTN2 NM_206900 3.76E?01 1.25E?01 9.13E?02 5.30E?02 6.07E?02 2.00E?02 LSP1 NM_001289005 5.40E?03 2.27E?01 1.45E?03 2.33E?01 1.28E?01 1.32E?01 PAAF1 NM_001267803 2.01E?02 1.43E?02 3.93E?02 2.74E?01 9.32E?02 2.87E?01 HAVCR1 NM_001173393 6.13E?02 7.73E?02 1.91E?01 9.59E?02 1.90E?01 1.13E?01 MGMT NM_002412 2.47E?01 2.40E?03 1.86E?01 2.56E?02 2.16E?01 5.21E?02 MBNL3 NM_133486 5.50E?02 1.42E?01 1.46E?01 1.52E?01 9.86E?02 1.36E?01 SPTBN4 NM_025213 1.77E?02 4.02E?01 4.14E?02 1.70E?01 7.42E?02 2.69E?02 AMER1 NM_152424 8.45E?05 1.95E?01 2.42E?03 2.13E?01 1.09E?01 2.14E?01 TMEM235 NM_001204212 1.19E?01 1.59E?01 4.81E?02 2.02E?01 3.98E?02 1.65E?01 IL20RB NM_144717 9.20E?02 4.85E?02 2.31E?01 1.08E?02 3.23E?01 2.77E?02 SULT2B1 NM_177973 6.77E?02 4.09E?02 4.07E?01 6.11E?03 2.09E?01 3.02E?03 SPAG8 NM_172312 2.30E?02 1.72E?01 1.26E?02 2.24E?01 4.26E?03 2.98E?01 FLYWCH2 NM_001142499 1.21E?01 4.01E?02 5.71E?02 2.76E?01 8.82E?03 2.32E?01 CPEB1 NM_030594 5.19E?02 5.07E?02 1.46E?02 2.21E?01 1.10E?01 2.87E?01 SYNE3 NM_152592 4.09E?01 9.90E?02 1.12E?01 2.76E?02 3.96E?02 4.89E?02 PTDSS2 NM_030783 5.90E?02 2.15E?01 2.93E?02 1.79E?01 3.32E?02 2.21E?01 NPB NM_148896 2.12E?01 1.49E?01 1.34E?01 2.91E?02 1.39E?01 7.29E?02 P2RX1 NM_002558 8.81E?02 1.92E?01 6.84E?02 6.24E?02 2.16E?01 1.12E?01 TESPA1 NM_001136030 1.22E?01 1.33E?01 7.90E?02 8.87E?02 1.71E?01 1.46E?01 SMO NM_005631 1.78E?01 7.10E?04 1.66E?01 4.47E?02 3.15E?01 3.53E?02 SMARCA2 NM_001289396 9.67E?02 4.03E?01 1.41E?02 1.37E?01 2.65E?03 8.74E?02 RAPGEF6 NM_016340 3.70E?02 2.74E?03 1.41E?01 2.15E?02 5.18E?01 2.00E?02 DDX47 NM_016355 2.51E?01 2.76E?02 2.31E?01 7.40E?03 2.03E?01 2.17E?02 TMEM52 NM_178545 3.04E?01 1.20E?01 8.43E?02 5.79E?02 6.72E?02 1.09E?01 POU4F1 NM_006237 1.93E?01 1.70E?01 1.49E?01 3.43E?02 1.73E?01 2.32E?02 LMX1B NM_001174147 2.40E?01 3.09E?03 3.04E?01 1.16E?03 1.91E?01 3.92E?03 NSUN3 NM_022072 2.98E?02 5.35E?02 4.29E?02 2.26E?01 8.43E?02 3.07E?01 ZNF135 NM_001289401 1.89E?01 3.27E?01 4.94E?02 5.85E?02 6.53E?02 5.50E?02 RNF24 NM_001134338 9.63E?02 1.40E?03 1.45E?01 6.55E?02 3.55E?01 8.04E?02 ZNF81 NM_007137 3.00E?03 4.61E?01 3.35E?03 9.80E?02 1.16E?02 1.68E?01 SHCBP1L NM_030933 7.70E?02 9.54E?02 1.32E?01 9.51E?02 2.26E?01 1.19E?01 DEFB127 NM_139074 8.77E?02 3.14E?01 5.64E?02 1.02E?01 3.22E?02 1.53E?01 TAF7L NM_024885 6.33E?02 1.52E?01 7.41E?02 7.73E?02 3.25E?01 5.45E?02 EIF4EBP1 NM_004095 1.87E?01 4.34E?02 1.89E?01 7.00E?02 8.93E?02 1.68E?01 YTHDF1 NM_017798 1.75E?02 3.32E?01 1.10E?01 7.49E?02 1.16E?01 9.62E?02 AWAT2 NM_001002254 6.28E?02 1.04E?01 2.32E?01 2.08E?02 2.93E?01 3.42E?02 KRT18 NM_199187 2.08E?01 2.76E?01 1.19E?01 2.52E?02 9.78E?02 2.22E?02 TACR2 NM_001057 2.75E?02 1.37E?01 1.03E?01 1.50E?01 1.49E?01 1.82E?01 NTRK3 NM_002530 2.02E?01 2.99E?01 1.25E?01 2.29E?02 8.98E?02 1.15E?02 KRT83 NM_002282 2.14E?01 2.53E?01 1.22E?01 3.15E?02 8.92E?02 4.15E?02 MAPK9 NM_139070 5.17E?02 6.80E?02 1.27E?02 2.52E?01 1.27E?01 2.40E?01 UBL4B NM_203412 1.77E?01 1.29E?01 1.80E?01 3.23E?02 1.85E?01 4.77E?02 PMM1 NM_002676 2.05E?02 2.84E?02 8.20E?02 1.64E?01 3.29E?01 1.27E?01 FAM124B NM_024785 1.73E?01 5.84E?02 1.07E?01 1.05E?01 1.48E?01 1.61E?01 PPAT NM_002703 4.15E?01 3.40E?02 1.10E?01 2.16E?02 1.43E?01 2.89E?02 DAZAP2 NM_001136269 1.89E?01 3.21E?01 4.01E?02 8.32E?02 7.23E?02 4.67E?02 TTLL3 NM_001025930 1.69E?01 1.98E?01 6.23E?02 1.57E?01 1.31E?02 1.54E?01 OR1N1 NM_012363 1.19E?02 1.35E?01 1.20E?01 2.09E?01 2.06E?01 7.10E?02 GATC NM_176818 7.38E?02 2.95E?01 1.66E?01 9.20E?02 6.18E?02 6.47E?02 DCP1A NM_001290204 2.05E?03 2.96E?01 6.54E?03 2.04E?01 7.25E?03 2.39E?01 ZMYM3 NM_001171162 3.26E?01 1.61E?01 7.14E?02 5.64E?02 4.31E?02 9.63E?02 FGF14 NM_004115 2.33E?01 1.60E?02 2.13E?01 1.99E?03 2.85E?01 5.88E?03 FBXO6 NM_018438 1.87E?01 1.11E?01 1.47E?01 9.25E?02 1.02E?01 1.18E?01 C8orf33 NM_023080 3.40E?03 2.00E?01 6.78E?05 2.53E?01 2.90E?05 3.05E?01 CTBP1 NM_001012614 2.25E?01 1.60E?02 3.60E?01 6.68E?04 1.57E?01 3.12E?03 ZDHHC8 NM_013373 1.46E?01 2.47E?01 1.22E?01 9.91E?02 3.31E?02 1.15E?01 DMXL1 NM_005509 1.94E?01 9.10E?02 1.74E?01 4.84E?02 1.32E?01 1.23E?01 TUSC3 NM_006765 1.63E?01 9.84E?02 1.68E?01 1.90E?01 1.30E?01 1.30E?02 SPATA31A5 NM_001113541 4.35E?03 1.01E?02 1.45E?01 1.48E?01 3.57E?01 9.89E?02 C17orf67 NM_001085430 6.47E?02 2.12E?01 2.18E?01 5.30E?02 1.10E?01 1.06E?01 MYL6B NM_002475 2.04E?01 3.09E?02 1.38E?01 2.39E?01 7.25E?02 8.01E?02 CAPN1 NM_005186 1.28E?01 1.41E?02 2.18E?01 1.87E?01 1.96E?01 2.21E?02 PGM5 NM_021965 2.36E?01 2.67E?01 1.69E?01 1.82E?03 6.92E?02 2.42E?02 HSD17B1 NM_000413 1.43E?01 6.21E?02 3.25E?01 7.40E?02 6.78E?02 9.61E?02 DSEL NM_032160 5.13E?03 3.53E?01 5.49E?03 2.09E?01 1.01E?02 1.86E?01 OSTF1 NM_012383 1.36E?01 3.59E?02 7.06E?02 1.65E?01 1.33E?01 2.30E?01 KDM2A NM_001256405 8.49E?02 3.04E?01 2.90E?01 5.12E?02 3.45E?02 1.09E?02 SP100 NM_001206704 3.54E?01 4.40E?02 1.62E?01 3.99E?02 7.42E?02 1.03E?01 DNAH5 NM_001369 5.09E?02 2.60E?02 2.76E?01 6.36E?02 2.74E?01 8.75E?02 GFPT2 NM_005110 2.46E?02 4.24E?02 9.78E?02 2.36E?01 2.99E?01 7.81E?02 EIF5A NM_001143760 3.36E?01 1.09E?01 9.11E?02 1.81E?01 1.73E?02 4.37E?02 REC8 NM_001048205 3.01E?02 3.95E?01 1.81E?02 6.51E?02 2.12E?02 2.50E?01 ZFAND6 NM_001242917 1.13E?01 2.79E?01 8.42E?02 1.30E?01 4.75E?02 1.26E?01 PACRG NM_001080378 1.42E?02 2.51E?01 9.76E?02 1.46E?01 1.44E?01 1.28E?01 TNFAIP2 NM_006291 4.83E?02 2.31E?01 5.86E?02 1.06E?01 1.83E?01 1.55E?01 KIAA1377 NM_020802 1.18E?01 7.46E?02 2.29E?01 7.60E?02 2.43E?01 4.11E?02 ZNF354A NM_005649 1.44E?01 2.14E?01 1.91E?01 2.85E?02 1.54E?01 4.99E?02 OPRL1 NM_000913 1.82E?02 1.50E?01 1.11E?02 2.47E?01 3.71E?02 3.20E?01 KLHL32 NM_001286252 6.15E?02 1.08E?01 1.94E?01 6.93E?02 2.24E?01 1.27E?01 MOSPD1 NM_019556 7.55E?02 3.80E?02 3.21E?02 2.31E?01 1.64E?01 2.44E?01 SARDH NM_007101 7.40E?02 1.57E?01 1.21E?01 1.67E?01 8.48E?02 1.81E?01 NPFF NM_003717 8.05E?02 5.05E?02 1.86E?02 3.15E?01 1.02E?01 2.18E?01 ATP8B3 NM_138813 4.19E?02 4.81E?01 3.14E?02 7.02E?02 1.74E?02 1.44E?01 PDIA6 NM_001282705 2.20E?01 2.11E?01 5.28E?02 1.46E?01 2.75E?02 1.29E?01 RRP1 NM_003683 3.29E?01 7.85E?03 2.40E?01 4.30E?02 1.17E?01 5.04E?02 ALG1 NM_019109 9.22E?02 1.22E?01 1.32E?01 7.05E?02 2.94E?01 7.70E?02 TMEM135 NM_001168724 3.23E?02 4.18E?01 1.25E?02 1.05E?01 5.69E?02 1.67E?01 OR2B2 NM_033057 5.65E?01 8.25E?03 1.07E?01 2.69E?02 2.74E?02 5.72E?02 MEFV NM_001198536 3.73E?01 2.43E?01 1.49E?01 6.10E?03 1.51E?02 5.38E?03 C6orf48 NM_001287484 1.43E?01 3.65E?02 7.44E?02 8.42E?02 3.02E?01 1.52E?01 KIAA0020 NM_014878 1.81E?01 6.32E?02 1.34E?01 2.71E?01 8.78E?02 5.60E?02 MCF2L NM_001112732 4.01E?02 7.36E?03 1.03E?01 1.93E?01 1.58E?01 2.91E?01 HIST1H2BK NM_080593 7.42E?02 1.67E?01 5.51E?02 7.49E?02 3.09E?01 1.13E?01 PRR5 NM_001017528 1.61E?01 2.47E?01 1.64E?01 7.81E?02 1.04E?01 3.98E?02 IRGC NM_019612 3.19E?01 1.46E?01 1.67E?01 2.30E?02 8.43E?02 5.50E?02 ACOT7 NM_181864 6.73E?02 1.29E?01 1.58E?01 1.49E?01 7.53E?02 2.16E?01 RPS15A NM_001019 3.87E?01 5.00E?02 4.77E?02 8.60E?02 1.24E?02 2.12E?01 GDA NM_001242506 5.56E?03 4.29E?01 1.27E?02 6.82E?02 1.86E?01 9.64E?02 PCDH1 NM_001278613 1.01E?01 1.00E?01 1.46E?01 3.05E?02 3.89E?01 3.13E?02 TNNT1 NM_003283 4.64E?01 3.71E?02 7.21E?02 2.68E?02 1.96E?01 2.28E?03 ACKR1 NM_001122951 4.98E?02 2.06E?02 1.13E?01 3.03E?01 7.27E?02 2.40E?01 CDC42SE2 NM_001038702 8.72E?02 7.52E?02 1.76E?01 8.13E?02 1.72E?01 2.07E?01 SLC9A7 NM_032591 4.35E?02 4.52E?01 6.55E?02 7.77E?02 4.44E?02 1.17E?01 C7orf26 NM_024067 6.13E?02 2.33E?01 1.67E?01 1.56E?01 6.49E?02 1.19E?01 MBD6 NM_052897 1.25E?02 6.13E?01 2.55E?02 5.40E?02 5.78E?02 3.83E?02 LYPLA1 NM_001279356 1.10E?01 1.52E?01 2.07E?01 6.22E?02 2.23E?01 4.75E?02 PELP1 NM_014389 2.81E?01 2.03E?02 2.28E?01 4.33E?02 1.77E?01 5.18E?02 SLC2A8 NM_014580 2.31E?01 2.33E?01 1.95E?01 7.86E?03 1.29E?01 7.04E?03 ODF3L2 NM_182577 1.58E?01 2.00E?01 8.31E?04 2.48E?01 7.68E?03 1.88E?01 IFNA10 NM_002171 1.14E?01 3.20E?01 8.98E?02 8.77E?02 9.16E?02 1.01E?01 LY6E NM_002346 4.39E?01 1.14E?02 1.85E?01 4.67E?02 4.03E?02 8.12E?02 CHMP2B NM_014043 2.24E?02 3.77E?01 1.65E?02 1.27E?01 1.40E?01 1.19E?01 NINJ2 NM_016533 2.76E?01 1.25E?01 1.63E?01 3.84E?02 1.35E?01 6.71E?02 TM7SF3 NM_016551 2.07E?01 2.11E?01 9.42E?02 1.67E?02 2.41E?01 3.54E?02 ATP6V0D2 NM_152565 4.08E?02 3.79E?01 6.12E?02 9.44E?02 8.93E?02 1.39E?01 C1QTNF3 NM_181435 4.54E?03 1.83E?01 2.69E?02 3.09E?01 4.43E?02 2.38E?01 SLC26A8 NM_001193476 3.18E?01 4.65E?02 1.12E?01 1.51E?01 3.55E?02 1.43E?01 SPRR1B NM_003125 1.79E?01 6.23E?02 2.24E?01 8.70E?02 1.40E?01 1.15E?01 WNT8A NM_058244 2.49E?01 1.33E?01 2.39E?01 1.03E?02 1.64E?01 1.16E?02 EDARADD NM_080738 4.96E?02 1.07E?01 2.67E?01 6.86E?02 2.62E?01 5.44E?02 GSDMB NM_001042471 1.66E?01 2.98E?01 3.58E?02 7.79E?02 1.34E?01 9.66E?02 KCNK2 NM_001017424 1.43E?02 2.60E?01 1.37E?02 1.73E?01 1.86E?01 1.62E?01 IQCA1 NM_001270585 1.86E?02 3.76E?01 1.21E?02 1.07E?01 1.79E?01 1.19E?01 NKX2-1 NM_003317 8.42E?02 6.66E?02 3.26E?01 2.20E?02 2.81E?01 3.28E?02 ZNF627 NM_145295 5.29E?01 1.13E?02 1.09E?01 4.25E?02 3.36E?02 8.84E?02 SLC1A5 NM_001145145 1.13E?01 2.65E?01 8.71E?02 1.56E?01 1.44E?01 4.97E?02 SETDB2 NM_001160308 9.40E?03 2.84E?01 3.37E?02 2.81E?01 3.51E?02 1.73E?01 LRRC49 NM_017691 1.51E?02 1.03E?01 1.94E?02 2.21E?01 1.72E?01 2.86E?01 RCN2 NM_002902 1.01E?01 1.04E?01 6.42E?02 2.19E?01 1.39E?02 3.14E?01 FBXO7 NM_012179 1.04E?01 3.13E?01 2.51E?02 1.53E?01 6.47E?03 2.15E?01 PACRG NM_001080379 7.02E?02 1.02E?01 3.61E?02 2.89E?01 2.27E?02 2.97E?01 SEPTIN9 NM_001113496 1.32E?01 1.82E?02 4.08E?01 1.51E?02 2.08E?01 3.51E?02 LMO3 NM_001243610 1.30E?01 3.59E?02 1.47E?01 5.75E?02 3.35E?01 1.13E?01 LDHA NM_001165414 1.53E?01 1.20E?01 2.62E?01 3.60E?02 2.02E?01 4.57E?02 MSRB1 NM_016332 6.34E?02 3.34E?01 2.22E?01 6.51E?03 1.19E?01 7.64E?02 RCOR3 NM_001136223 1.53E?01 2.28E?01 1.89E?01 1.82E?02 1.87E?01 4.50E?02 ZNF165 NM_003447 1.06E?01 5.67E?02 2.11E?01 3.20E?02 3.54E?01 6.14E?02 ASNSD1 NM_019048 2.06E?01 2.11E?01 2.78E?01 1.09E?02 9.79E?02 1.80E?02 ARHGAP26 NM_015071 3.15E?01 1.06E?01 6.71E?02 1.86E?01 1.62E?02 1.33E?01 ZNF443 NM_005815 3.15E?01 1.73E?01 1.44E?01 2.66E?02 9.44E?02 7.09E?02 STC1 NM_003155 1.54E?01 6.08E?02 1.95E?01 2.74E?02 3.06E?01 8.18E?02 ASB4 NM_016116 1.87E?01 3.59E?02 2.36E?01 1.08E?01 2.01E?01 5.81E?02 ZNF93 NM_031218 1.76E?01 1.19E?01 1.58E?01 8.21E?02 1.55E?01 1.36E?01 GSTZ1 NM_145870 8.63E?02 1.86E?01 2.87E?01 2.12E?02 2.36E?01 9.08E?03 AASDH NM_181806 3.70E?02 1.87E?01 1.62E?01 8.94E?02 2.60E?01 9.19E?02 CDK2AP2 NM_001271849 5.14E?02 6.48E?02 3.47E?01 5.10E?03 3.52E?01 7.11E?03 CDKN2B NM_004936 9.45E?02 1.73E?01 1.64E?01 1.39E?01 2.05E?01 5.17E?02 QARS NM_005051 9.27E?04 4.77E?02 7.38E?02 2.39E?01 1.09E?01 3.57E?01 NUP50 NM_153645 1.35E?02 1.36E?01 8.99E?02 1.35E?01 2.17E?01 2.36E?01 SCNN1G NM_001039 8.01E?02 8.96E?02 2.92E?02 2.23E?01 1.74E?01 2.32E?01 PRDX6 NM_004905 3.35E?01 2.05E?03 1.95E?01 7.33E?03 2.77E?01 1.32E?02 MLEC NM_014730 3.61E?02 1.63E?01 4.52E?02 1.74E?01 1.00E?01 3.12E?01 HMMR NM_012484 4.55E?01 6.93E?03 2.34E?01 6.80E?03 1.26E?01 2.45E?03 ENAH NM_018212 1.34E?01 5.83E?02 2.70E?01 8.19E?02 2.63E?01 2.32E?02 CNGB3 NM_019098 2.46E?01 1.17E?01 8.16E?02 1.54E?01 4.79E?02 1.87E?01 ADCK3 NM_020247 1.12E?01 1.36E?01 2.76E?02 1.75E?02 4.51E?01 8.87E?02 SH2D4B NM_001145719 2.20E?02 1.32E?01 3.84E?02 1.84E?01 2.65E?01 1.92E?01 EEF1A1 NM_001402 1.87E?01 9.89E?02 1.95E?01 1.29E?01 2.11E?01 1.23E?02 GPATCH3 NM_022078 2.95E?01 1.00E?01 1.87E?01 8.01E?02 1.60E?01 1.23E?02 CBLC NM_012116 2.12E?01 1.09E?01 6.18E?03 3.00E?01 2.86E?02 1.80E?01 ATG4B NM_178326 3.21E?02 4.31E?01 3.08E?02 1.73E?01 3.28E?02 1.36E?01 TACR1 NM_001058 1.25E?01 2.05E?01 1.81E?01 1.59E?01 2.19E?02 1.44E?01 IGFBP4 NM_001552 1.11E?01 6.39E?02 4.95E?02 1.67E?01 1.78E?01 2.67E?01 CYP19A1 NM_031226 1.38E?01 1.78E?01 1.70E?01 2.30E?01 6.59E?02 5.73E?02 LHX6 NM_001242333 1.30E?01 3.07E?01 2.37E?02 2.15E?01 5.16E?03 1.58E?01 GPC5 NM_004466 3.99E?01 7.31E?02 1.79E?01 1.36E?02 1.44E?01 3.10E?02 TPTE2 NM_001271850 4.31E?03 3.84E?01 4.90E?03 1.79E?01 1.28E?02 2.56E?01 NBEAL2 NM_015175 7.45E?02 9.07E?02 8.19E?02 2.26E?01 5.51E?02 3.13E?01 AGPAT4 NM_020133 6.35E?02 1.67E?01 9.50E?02 1.60E?01 8.27E?02 2.72E?01 SERINC1 NM_020755 8.25E?03 2.60E?01 4.07E?02 2.59E?01 7.80E?02 1.96E?01 ALPPL2 NM_031313 1.79E?01 5.27E?02 2.64E?01 8.36E?02 1.46E?01 1.17E?01 DUSP22 NM_020185 2.19E?01 6.61E?02 5.14E?02 1.47E?01 9.90E?02 2.60E?01 NIPA1 NM_001142275 2.32E?01 2.54E?01 3.98E?02 1.06E?01 3.43E?02 1.78E?01 POU2F3 NM_014352 1.36E?01 1.07E?01 1.99E?01 6.14E?02 2.57E?01 8.41E?02 HTR5A NM_024012 1.37E?01 1.01E?02 2.53E?01 6.21E?02 2.29E?01 1.53E?01 TXNL1 NM_004786 2.63E?01 9.32E?03 2.77E?01 1.40E?02 2.63E?01 1.75E?02 RAPGEF4 NM_007023 1.81E?01 2.20E?01 1.66E?01 6.68E?02 1.99E?01 1.20E?02 HACE1 NM_020771 5.17E?02 5.25E?03 3.64E?01 2.14E?02 3.71E?01 3.13E?02 MSRB3 NM_001193460 5.76E?02 2.80E?01 1.40E?01 1.13E?01 1.49E?01 1.07E?01 PWWP2B NM_138499 1.08E?01 2.43E?01 5.49E?02 1.13E?01 5.33E?02 2.74E?01 SAYSD1 NM_018322 1.20E?01 5.17E?02 2.31E?01 7.42E?02 3.37E?01 3.18E?02 GPRC5C NM_022036 2.60E?01 1.15E?01 1.81E?01 7.25E?03 2.71E?01 1.31E?02 SPEG NM_001173476 1.95E?01 3.50E?01 1.43E?01 2.99E?03 1.54E?01 2.20E?03 GSTM4 NM_000850 1.67E?01 5.24E?02 2.20E?01 2.77E?02 3.18E?01 6.28E?02 CNTN1 NM_001256064 1.30E?01 6.72E?02 1.79E?01 1.43E?01 2.04E?01 1.27E?01 CTNND2 NM_001332 1.97E?01 2.28E?01 9.40E?02 1.67E?01 1.29E?01 3.47E?02 TANGO2 NM_001283199 2.36E?01 1.33E?01 1.95E?01 3.82E?02 2.39E?01 7.49E?03 TOMM34 NM_006809 2.89E?02 4.00E?01 1.13E?02 1.93E?01 1.08E?01 1.09E?01 FBXL12 NM_017703 2.45E?01 1.81E?01 2.55E?01 3.03E?02 5.69E?02 8.24E?02 ZNF692 NM_001136036 1.13E?01 1.49E?01 7.88E?02 1.54E?01 1.22E?01 2.36E?01 SOCS1 NM_003745 7.47E?02 8.82E?02 2.38E?01 9.95E?02 2.31E?01 1.22E?01 EPHA3 NM_182644 1.39E?02 1.44E?01 1.20E?01 2.12E?01 3.35E?02 3.29E?01 CTDNEP1 NM_001143775 8.39E?02 7.50E?02 1.09E?01 9.80E?02 2.99E?01 1.88E?01 VDAC1 NM_003374 2.07E?01 1.41E?01 2.28E?01 1.13E?02 2.40E?01 2.70E?02 CLDN19 NM_001185117 2.35E?01 1.24E?01 1.98E?01 3.95E?02 2.05E?01 5.29E?02 VSIG10L NM_001163922 1.19E?01 1.27E?02 2.15E?01 1.32E?01 1.58E?01 2.17E?01 VAC14 NM_018052 1.98E?01 7.82E?02 1.08E?01 2.18E?01 1.12E?01 1.40E?01 LTV1 NM_032860 1.22E?01 3.20E?02 3.74E?01 7.24E?02 1.97E?01 5.94E?02 SHCBP1 NM_024745 5.24E?02 7.06E?02 9.09E?02 1.92E?01 2.15E?01 2.37E?01 GAPVD1 NM_001282680 1.24E?01 8.29E?02 1.29E?01 5.25E?02 2.65E?01 2.04E?01 FBXO5 NM_012177 1.12E?01 7.51E?02 2.98E?01 9.13E?02 2.65E?01 1.78E?02 RASGRP1 NM_001128602 8.40E?02 2.15E?01 5.66E?02 2.50E?01 4.88E?02 2.04E?01 NSD1 NM_172349 4.93E?02 3.02E?01 3.42E?02 1.01E?01 2.72E?01 1.02E?01 TAP1 NM_000593 8.40E?02 7.65E?03 4.47E?02 2.37E?01 1.49E?01 3.39E?01 ZNF454 NM_182594 5.27E?02 6.16E?02 1.24E?01 8.61E?02 3.53E?01 1.85E?01 PHF21A NM_016621 3.65E?01 8.68E?02 3.77E?02 8.97E?02 2.43E?02 2.58E?01 PPP1R10 NM_002714 5.98E?02 2.47E?01 2.55E?02 2.44E?01 1.21E?01 1.65E?01 LRP1 NM_002332 6.82E?02 1.13E?01 1.49E?01 1.33E?01 2.49E?01 1.50E?01 SMARCA5 NM_003601 3.70E?01 1.42E?01 1.43E?01 2.62E?02 1.47E?01 3.64E?02 EDC3 NM_025083 9.89E?03 4.19E?01 1.36E?02 1.92E?01 1.51E?01 8.00E?02 BTK NM_000061 4.34E?02 4.81E?02 8.57E?02 3.10E?01 9.25E?02 2.86E?01 PAM16 NM_016069 1.67E?03 2.99E?01 9.04E?03 1.34E?01 1.42E?01 2.80E?01 NBR1 NM_001291571 2.52E?03 9.47E?02 5.09E?02 2.49E?01 8.70E?02 3.83E?01 C9orf139 NM_207511 4.14E?01 1.71E?01 9.26E?02 1.46E?01 2.05E?02 2.38E?02 EPC1 NM_001282391 2.29E?02 2.92E?01 8.69E?02 2.32E?01 1.56E?01 7.80E?02 WDR54 NM_032118 2.63E?02 1.22E?01 2.23E?02 2.24E?01 1.34E?01 3.40E?01 ZNF248 NM_001267606 1.82E?02 7.33E?02 1.30E?01 1.01E?01 4.87E?01 5.97E?02 ETS2 NM_005239 2.11E?01 7.38E?02 2.74E?01 9.61E?03 2.84E?01 1.67E?02 MBD2 NM_003927 2.84E?01 4.46E?01 5.64E?02 6.20E?02 1.21E?02 8.05E?03 CD81 NM_004356 1.64E?01 1.51E?01 1.15E?01 4.61E?02 3.47E?01 4.57E?02 ADAMTSL2 NM_014694 8.25E?02 1.97E?01 1.78E?01 1.45E?01 1.17E?01 1.52E?01 RARG NM_001243731 3.51E?02 2.72E?01 4.11E?02 2.87E?01 7.25E?02 1.63E?01 NRG3 NM_001165973 7.76E?03 3.90E?01 1.25E?01 1.01E?01 1.69E?01 7.67E?02 ADH5 NM_000671 5.01E?02 7.53E?02 1.04E?01 2.25E?01 1.69E?01 2.47E?01 NALCN NM_052867 1.00E?01 5.19E?01 2.08E?02 1.01E?01 1.23E?02 1.18E?01 SOSTDC1 NM_015464 1.80E?01 2.43E?02 2.64E?01 2.87E?02 2.93E?01 8.36E?02 MPI NM_002435 1.32E?01 1.55E?01 1.00E?01 1.58E?01 1.33E?01 1.96E?01 C20orf96 NM_153269 2.39E?01 2.14E?02 2.54E?01 6.21E?03 3.46E?01 6.20E?03 KRT79 NM_175834 4.05E?02 7.86E?02 2.74E?02 2.53E?01 1.02E?01 3.73E?01 CYBB NM_000397 7.27E?02 3.60E?01 1.27E?01 1.23E?01 6.50E?02 1.28E?01 PLA2G7 NM_005084 2.20E?01 1.60E?02 2.33E?01 5.68E?02 3.16E?01 3.43E?02 USP2 NM_001243759 1.30E?01 7.89E?02 2.06E?01 1.05E?01 2.02E?01 1.54E?01 FBXO15 NM_001142958 5.41E?01 1.48E?03 1.53E?01 1.17E?02 1.49E?01 2.02E?02 ROPN1 NM_017578 1.41E?02 3.47E?01 5.29E?03 2.22E?01 5.24E?02 2.36E?01 GZMM NM_001258351 1.77E?01 1.67E?01 9.81E?02 1.82E?01 8.79E?02 1.65E?01 H3F3C NM_001013699 3.09E?01 4.58E?02 1.15E?01 4.92E?02 2.52E?01 1.07E?01 ELP2 NM_001242875 6.28E?02 2.55E?01 1.48E?01 1.24E?01 1.42E?01 1.46E?01 PIWIL2 NM_001135721 2.15E?01 2.20E?01 1.57E?02 1.54E?01 9.67E?04 2.73E?01 EMC4 NM_001286420 2.92E?01 2.11E?01 1.55E?01 3.46E?02 1.43E?01 4.42E?02 CKAP5 NM_001008938 1.32E?01 2.15E?01 6.77E?02 7.09E?02 2.95E?01 9.93E?02 GSC NM_173849 3.90E?02 1.21E?01 8.01E?02 2.81E?01 1.46E?01 2.12E?01 AES NM_198969 1.48E?01 2.31E?01 1.01E?01 8.28E?02 2.31E?01 8.53E?02 SLCO5A1 NM_001146008 2.01E?02 1.33E?02 1.09E?01 2.80E?01 3.10E?01 1.49E?01 ARSH NM_001011719 2.69E?02 2.38E?01 5.60E?02 1.27E?01 3.01E?01 1.33E?01 WNK4 NM_032387 3.08E?02 3.67E?01 1.20E?01 1.36E?01 6.49E?02 1.62E?01 CPNE4 NM_153429 2.30E?01 1.48E?02 3.26E?01 7.09E?02 1.80E?01 5.94E?02 KIF25 NM_030615 2.03E?01 2.94E?01 1.16E?01 9.14E?02 1.08E?01 7.11E?02 LRIT1 NM_015613 3.27E?01 1.08E?01 1.24E?01 1.21E?01 1.04E?01 9.85E?02 CMTM1 NM_181296 2.07E?01 2.52E?02 2.65E?01 1.48E?02 3.40E?01 3.08E?02 ZNF687 NM_020832 4.28E?01 2.77E?02 1.10E?01 5.45E?02 1.70E?01 9.37E?02 TSSK3 NM_052841 5.57E?02 3.70E?03 3.67E?01 3.54E?02 3.06E?01 1.17E?01 CCDC155 NM_144688 5.41E?02 5.01E?01 5.19E?02 1.22E?01 4.24E?02 1.13E?01 KCNJ15 NM_170736 1.13E?01 1.98E?01 5.75E?02 2.33E?01 8.70E?02 1.96E?01 C2CD3 NM_001286577 2.21E?01 1.84E?01 1.61E?01 5.49E?02 1.89E?01 7.58E?02 KREMEN1 NM_032045 3.27E?01 2.11E?01 1.64E?01 4.73E?02 1.00E?01 3.66E?02 FOXP3 NM_014009 1.41E?01 3.23E?02 1.02E?01 1.98E?01 6.39E?02 3.48E?01 VASH2 NM_001136474 3.49E?01 2.99E?02 2.41E?01 1.79E?02 2.22E?01 2.54E?02 UBR5 NM_015902 3.63E?01 2.71E?02 7.43E?02 1.96E?01 1.74E?01 5.13E?02 OR2T33 NM_001004695 6.11E?02 2.60E?01 5.14E?02 2.69E?01 1.95E?01 4.97E?02 DZIP1L NM_173543 4.99E?01 7.58E?03 1.37E?01 7.26E?02 5.78E?02 1.12E?01 SMIM11 NM_058182 2.95E?01 2.37E?01 5.70E?02 5.77E?02 1.68E?01 7.25E?02 EBF1 NM_024007 1.74E?01 2.53E?01 9.39E?02 1.11E?01 2.99E?02 2.25E?01 HABP4 NM_014282 3.74E?01 1.23E?01 1.74E?01 4.53E?02 1.07E?01 6.54E?02 WDR61 NM_025234 5.12E?01 4.50E?02 1.98E?01 9.73E?03 1.08E?01 1.64E?02 VGLL3 NM_016206 1.98E?01 7.02E?02 1.79E?01 1.68E?01 2.27E?01 4.80E?02 CHST8 NM_001127896 4.89E?01 6.58E?03 2.03E?01 3.72E?02 9.60E?02 5.93E?02 CRISP3 NM_001190986 1.41E?01 2.13E?01 2.07E?02 2.48E?01 3.70E?02 2.32E?01 PPP1CA NM_206873 3.50E?01 1.12E?01 1.70E?01 1.87E?02 2.10E?01 3.20E?02 PIGZ NM_025163 4.06E?01 8.95E?03 2.72E?01 5.57E?03 1.95E?01 6.80E?03 TMEM255A NM_001104544 2.06E?01 6.49E?03 2.16E?01 1.26E?01 3.12E?01 2.88E?02 SPON1 NM_006108 2.65E?01 1.40E?02 2.32E?01 1.01E?02 3.30E?01 4.39E?02 SMARCB1 NM_003073 4.62E?03 4.06E?01 3.37E?02 2.03E?01 8.90E?02 1.59E?01 PTBP1 NM_031991 7.17E?03 4.44E?01 1.26E?01 1.17E?01 5.54E?02 1.48E?01 PPP1R27 NM_001007533 3.54E?01 1.11E?01 1.68E?01 2.26E?02 9.10E?02 1.50E?01 ATP2C1 NM_001199181 1.89E?01 5.57E?02 1.41E?01 3.35E?01 1.09E?01 6.71E?02 ADAM19 NM_033274 5.49E?03 2.59E?01 5.85E?02 1.62E?01 9.24E?02 3.20E?01 GKAP1 NM_001135953 2.95E?01 9.24E?02 2.05E?01 5.54E?02 2.02E?01 4.70E?02 NREP NM_001142482 2.04E?01 1.46E?01 2.96E?02 2.23E?01 2.04E?02 2.74E?01 SLC39A9 NM_001252152 1.03E?01 1.77E?01 2.66E?01 1.31E?01 8.97E?02 1.31E?01 NPC2 NM_006432 2.94E?01 8.17E?02 1.83E?01 5.71E?02 1.90E?01 9.26E?02 SYNJ1 NM_003895 3.28E?01 5.69E?02 2.49E?01 7.52E?02 1.13E?01 7.61E?02 ATP6V1G1 NM_004888 4.18E?01 1.43E?02 1.77E?01 8.51E?02 1.61E?01 4.29E?02 PITPNB NM_001284278 5.89E?01 2.06E?02 2.36E?01 4.14E?03 4.39E?02 5.12E?03 ZNF623 NM_001261843 7.61E?02 1.91E?01 1.73E?01 1.83E?01 1.41E?01 1.35E?01 DDX1 NM_004939 8.09E?02 1.06E?01 1.08E?01 1.04E?01 4.02E?01 9.99E?02 NUDT7 NM_001243661 3.68E?02 6.96E?01 5.35E?02 2.37E?02 3.59E?02 5.50E?02 S100A13 NM_005979 1.56E?01 1.24E?01 7.52E?02 2.02E?01 5.21E?02 2.91E?01 SEMA3C NM_006379 2.81E?01 1.02E?01 1.90E?01 2.48E?01 2.68E?02 5.37E?02 EOMES NM_005442 3.15E?02 6.20E?02 1.12E?01 1.49E?01 4.55E?01 9.20E?02 FBLN1 NM_006487 2.53E?02 2.50E?01 1.45E?01 1.18E?01 1.97E?01 1.67E?01 FAM131B NM_014690 8.98E?02 3.16E?01 1.49E?01 9.61E?02 1.27E?01 1.24E?01 MTARC2 NM_017898 3.23E?03 1.16E?01 3.09E?02 3.27E?01 7.30E?02 3.53E?01 TIFA NM_052864 2.22E?01 4.73E?01 8.84E?03 9.42E?02 2.98E?03 1.03E?01 RNF135 NM_197939 1.82E?01 1.54E?01 2.22E?01 8.67E?02 1.65E?01 9.42E?02 ALDH3B2 NM_001031615 4.89E?02 5.20E?01 1.46E?02 6.81E?02 1.30E?01 1.24E?01 COL8A1 NM_001850 3.82E?02 3.54E?01 1.93E?02 2.83E?01 1.14E?03 2.11E?01 CCT4 NM_001256721 2.04E?01 2.79E?01 1.59E?01 1.50E?02 1.70E?01 7.96E?02 QRICH1 NM_017730 1.79E?01 2.00E?01 1.13E?01 1.63E?01 1.09E?01 1.43E?01 RIOK2 NM_018343 3.74E?01 2.08E?01 7.12E?02 1.18E?01 5.92E?02 7.72E?02 EFHC1 NM_018100 5.94E?02 5.65E?01 1.84E?03 1.40E?01 1.70E?02 1.24E?01 AATK NM_001080395 1.16E?01 3.64E?01 1.06E?01 1.89E?01 6.16E?02 7.06E?02 FAM217B NM_001190826 2.35E?01 1.77E?01 6.12E?02 1.97E?01 5.06E?02 1.86E?01 CDK5RAP1 NM_016082 2.68E?01 1.24E?01 1.19E?01 1.01E?01 2.60E?01 3.84E?02 ITIH1 NM_001166434 2.50E?01 1.52E?01 2.59E?02 1.81E?01 1.69E?01 1.33E?01 FBXO34 NM_152231 1.60E?01 2.55E?01 1.62E?01 3.33E?02 2.17E?01 8.38E?02 ZFAT NM_001289394 4.19E?01 5.28E?03 1.27E?01 1.73E?01 3.94E?02 1.47E?01 RABGAP1L NM_001243764 5.43E?01 2.09E?02 1.72E?01 3.69E?03 1.59E?01 1.18E?02 KIF21B NM_001252100 1.28E?01 1.47E?01 8.34E?02 1.50E?01 4.74E?02 3.57E?01 GABARAP NM_007278 1.39E?01 8.44E?04 3.60E?01 1.47E?01 2.61E?01 4.99E?03 CLCN3 NM_001243374 5.27E?02 3.99E?01 1.46E?02 1.42E?01 2.38E?01 6.67E?02 RAD21 NM_006265 2.78E?01 7.78E?02 2.63E?01 1.47E?02 2.54E?01 2.67E?02 RNF165 NM_152470 6.96E?02 2.46E?01 1.18E?01 1.93E?01 6.26E?02 2.25E?01 EFCAB2 NM_032328 3.67E?01 1.32E?01 4.78E?02 1.68E?01 4.93E?02 1.51E?01 POTEH NM_001136213 9.86E?02 3.14E?01 4.11E?02 1.35E?01 1.66E?01 1.61E?01 TRIM73 NM_198924 2.03E?01 1.67E?01 8.85E?02 1.13E?01 2.03E?01 1.42E?01 LHFP NM_005780 2.14E?01 3.84E?02 3.81E?01 1.96E?02 2.14E?01 5.01E?02 PODN NM_001199081 7.89E?02 3.59E?01 2.97E?02 2.43E?01 5.66E?03 2.01E?01 SYT15 NM_181519 1.16E?01 6.81E?02 2.55E?01 1.65E?01 8.68E?02 2.27E?01 TNPO2 NM_001136195 3.83E?01 4.18E?03 3.57E?01 6.78E?05 1.73E?01 6.78E?05 KRT19 NM_002276 6.80E?02 1.82E?01 1.12E?01 4.50E?02 4.93E?01 1.98E?02 FAM178B NM_001172667 1.35E?01 1.04E?02 2.81E?01 9.92E?02 2.82E?01 1.13E?01 TBX1 NM_080646 3.30E?01 3.73E?02 2.51E?01 3.02E?02 2.53E?01 1.87E?02 MSL2 NM_001145417 5.74E?02 2.09E?01 2.46E?01 3.85E?02 2.05E?01 1.65E?01 ZNF30 NM_194325 4.96E?01 8.12E?02 1.58E?01 5.43E?03 1.78E?01 3.18E?03 C1orf158 NM_152290 2.32E?01 2.10E?01 2.42E?01 1.72E?02 1.81E?01 3.93E?02 HSPB7 NM_014424 1.35E?01 1.94E?01 1.41E?01 3.81E?02 3.89E?01 2.50E?02 MAG NM_001199216 3.59E?01 2.59E?03 2.31E?01 1.43E?01 1.50E?01 3.76E?02 LMO2 NM_001142316 3.09E?01 2.37E?01 1.01E?01 9.22E?02 9.74E?02 8.73E?02 PHYHIP NM_001099335 1.11E?01 1.07E?01 2.84E?01 7.12E?02 2.35E?01 1.15E?01 TIMM23B NM_001290117 5.16E?02 9.58E?02 8.26E?02 2.57E?01 1.74E?01 2.63E?01 PSMA5 NM_001199773 1.45E?02 4.35E?01 2.15E?02 3.63E?01 3.17E?02 5.83E?02 ATP11A NM_032189 1.47E?01 1.05E?01 2.26E?01 3.07E?02 3.99E?01 1.74E?02 C20orf78 NM_001242671 2.16E?03 3.80E?01 3.38E?03 4.52E?02 1.07E?01 3.88E?01 C20orf196 NM_152504 4.20E?01 2.46E?02 1.46E?01 1.22E?01 7.57E?02 1.37E?01 UHRF1BP1L NM_015054 1.24E?01 2.35E?01 1.54E?02 3.25E?01 6.62E?03 2.19E?01 PTCH1 NM_000264 8.92E?02 6.71E?02 9.68E?02 2.54E?01 3.70E?01 5.00E?02 RGS12 NM_198227 2.31E?01 1.66E?01 1.36E?01 1.67E?01 6.90E?02 1.57E?01 RCN3 NM_020650 2.16E?01 1.18E?01 1.73E?01 9.84E?02 1.98E?01 1.24E?01 NAT8L NM_178557 4.77E?01 6.75E?03 2.17E?01 1.08E?03 2.26E?01 6.87E?04 CCNI NM_006835 7.90E?02 1.71E?01 1.22E?01 2.61E?01 1.59E?01 1.35E?01 ECSCR NM_001077693 1.16E?02 1.04E?01 9.27E?02 7.47E?02 5.49E?01 9.65E?02 MTX3 NM_001167741 3.91E?02 1.22E?01 1.37E?01 1.99E?01 2.93E?01 1.38E?01 TENM3 NM_001080477 2.03E?02 2.37E?01 5.10E?02 1.21E?01 2.46E?01 2.54E?01 CTXN3 NM_001048252 6.56E?02 6.34E?02 2.07E?01 1.35E?01 4.17E?01 4.08E?02 ANAPC1 NM_022662 1.86E?01 2.82E?01 1.49E?01 1.57E?01 1.07E?01 4.90E?02 ZNF469 NM_001127464 1.73E?02 5.91E?02 1.27E?01 2.62E?01 2.73E?01 1.91E?01 FAM170A NM_182761 4.13E?01 4.63E?02 1.99E?01 1.64E?01 9.10E?02 1.61E?02 MBD3L2 NM_144614 3.30E?02 5.76E?02 2.33E?01 7.55E?02 3.11E?01 2.21E?01 PUSL1 NM_153339 1.91E?01 4.31E?03 2.43E?01 7.21E?02 2.22E?01 1.99E?01 DIS3L NM_001143688 3.56E?01 2.28E?03 2.44E?01 6.34E?02 1.74E?01 9.17E?02 AHCYL2 NM_001130722 3.96E?01 1.92E?02 2.18E?01 1.68E?01 1.00E?01 3.12E?02 HOXB4 NM_024015 6.36E?01 5.45E?02 1.65E?01 1.13E?02 2.25E?02 4.32E?02 YBEY NM_058181 1.59E?02 1.67E?01 3.01E?02 3.41E?01 4.13E?02 3.38E?01 DPH5 NM_015958 4.60E?01 5.74E?02 1.73E?01 3.92E?02 1.11E?01 9.25E?02 RREB1 NM_001003699 1.24E?01 2.02E?02 3.00E?01 1.78E?01 3.06E?01 4.82E?03 CNTNAP4 NM_033401 2.07E?01 2.88E?02 2.98E?01 3.13E?02 3.64E?01 4.17E?03 SIRT3 NM_012239 5.75E?01 4.46E?03 2.83E?02 3.95E?02 1.37E?01 1.49E?01 RHOB NM_004040 5.35E?01 8.98E?02 1.70E?01 3.50E?02 4.00E?02 6.46E?02 ZSWIM7 NM_001042698 1.67E?01 4.11E?02 2.45E?01 1.53E?01 2.82E?01 4.69E?02 CABP5 NM_019855 5.31E?01 7.16E?02 1.57E?01 3.14E?02 3.67E?02 1.07E?01 PPCS NM_001287506 2.44E?01 2.31E?02 1.48E?01 1.60E?01 2.08E?01 1.54E?01 MAMSTR NM_001130915 9.08E?02 3.15E?01 7.19E?02 1.85E?01 5.99E?02 2.15E?01 HEY1 NM_001282851 1.83E?01 6.44E?02 9.20E?02 9.94E?02 3.92E?01 1.07E?01 UBE2L3 NM_001256355 6.50E?02 1.95E?02 3.79E?02 2.44E?01 2.93E?01 2.79E?01 PPP1R37 NM_019121 1.29E?01 4.51E?01 6.21E?02 1.11E?01 4.86E?02 1.37E?01 CD3G NM_000073 7.98E?02 2.77E?01 9.59E?03 1.94E?01 1.41E?03 3.79E?01 GAR1 NM_032993 2.33E?01 3.41E?01 1.48E?01 6.79E?02 8.18E?02 6.85E?02 ZC3H15 NM_018471 1.74E?02 4.51E?02 2.42E?02 3.34E?01 2.18E?02 4.98E?01 F13B NM_001994 1.82E?01 5.14E?02 1.17E?01 2.08E?01 1.48E?01 2.35E?01 CACFD1 NM_017586 2.24E?01 2.05E?01 2.58E?02 2.79E?01 8.67E?03 1.99E?01 COX6B2 NM_144613 1.23E?01 6.88E?03 3.57E?01 1.77E?02 4.09E?01 2.76E?02 SPEN NM_015001 1.26E?02 1.07E?01 4.07E?02 3.24E?01 9.16E?02 3.67E?01 PHLDA3 NM_012396 1.53E?02 5.65E?01 4.37E?02 1.13E?01 8.51E?02 1.20E?01 IL1RL2 NM_003854 1.16E?01 4.70E?02 9.57E?02 2.88E?01 2.21E?01 1.76E?01 TMEM170A NM_145254 2.82E?01 9.87E?02 1.60E?01 1.49E?01 9.11E?02 1.63E?01 PBX3 NM_006195 3.56E?02 4.76E?01 2.32E?04 1.32E?01 8.33E?05 3.00E?01 ZNF718 NM_001039127 1.51E?01 3.13E?02 8.09E?02 2.60E?01 1.79E?01 2.41E?01 LYPD5 NM_001288763 3.52E?01 2.39E?01 1.83E?01 3.76E?02 7.68E?02 5.58E?02 TMEM51 NM_001136218 2.81E?01 1.90E?01 5.60E?02 1.36E?01 5.63E?02 2.25E?01 NFIA NM_001134673 2.32E?01 1.92E?01 5.89E?02 1.55E?01 1.52E?01 1.55E?01 ZNF711 NM_021998 3.69E?02 6.18E?01 8.73E?03 2.32E?01 1.56E?02 3.37E?02 UBE2E1 NM_001202476 2.71E?01 2.66E?02 1.35E?01 1.79E?01 2.98E?01 3.72E?02 VEGFA NM_001171630 2.08E?02 1.55E?01 1.63E?01 3.02E?01 9.27E?02 2.13E?01 GSTP1 NM_000852 2.50E?01 1.24E?01 1.96E?01 9.11E?02 2.75E?01 1.08E?02 KIAA1107 NM_015237 1.61E?01 1.02E?01 1.61E?01 1.06E?01 2.23E?01 1.93E?01 MXRA8 NM_032348 7.89E?02 8.08E?02 1.96E?02 4.19E?01 1.36E?02 3.36E?01 OSBPL1A NM_080597 2.52E?01 1.75E?01 1.97E?01 1.28E?01 8.63E?02 1.11E?01 VNN1 NM_004666 2.83E?01 2.82E?02 1.53E?01 1.57E?01 9.46E?02 2.34E?01 DEFB125 NM_153325 3.21E?01 5.96E?02 2.49E?01 4.76E?02 1.95E?01 7.75E?02 ZNF185 NM_001178113 3.62E?01 1.96E?01 2.75E?01 4.32E?02 6.71E?02 6.71E?03 GNGT2 NM_001198754 7.74E?03 1.84E?01 8.78E?02 2.44E?01 1.40E?01 2.88E?01 COG4 NM_015386 2.61E?01 1.05E?01 1.29E?01 9.30E?02 2.53E?01 1.10E?01 DIO3 NM_001362 2.18E?01 7.79E?02 1.68E?01 5.38E?03 2.57E?01 2.26E?01 SLC7A6 NM_001076785 9.12E?02 3.97E?03 2.87E?01 2.12E?01 1.76E?01 1.82E?01 GRIN3A NM_133445 2.20E?01 8.68E?02 1.52E?01 2.01E?01 1.14E?01 1.78E?01 SGCB NM_000232 7.94E?03 3.03E?01 1.99E?02 2.75E?01 5.34E?03 3.41E?01 TAF6 NM_139315 5.50E?01 1.49E?02 1.74E?01 4.08E?02 1.19E?01 5.56E?02 XRCC4 NM_022550 3.69E?01 2.33E?01 4.28E?02 1.32E?01 6.46E?02 1.13E?01 NAT8 NM_003960 2.27E?02 4.06E?02 3.53E?02 4.21E?01 2.90E?02 4.05E?01 HOXB13 NM_006361 2.37E?01 1.73E?01 1.72E?01 1.34E?01 1.20E?01 1.18E?01 FAM96B NM_016062 3.31E?01 8.86E?03 2.65E?01 6.40E?02 1.46E?01 1.40E?01 SLC16A3 NM_004207 1.79E?01 1.21E?01 2.23E?01 9.14E?02 2.41E?01 1.01E?01 NDUFA7 NM_005001 1.94E?01 9.65E?02 2.44E?01 1.21E?02 3.90E?01 1.92E?02 MYH4 NM_017533 5.05E?01 1.18E?01 1.75E?01 8.39E?02 5.15E?02 2.27E?02 FOXD4 NM_207305 2.24E?02 3.01E?01 4.98E?02 3.19E?01 6.03E?02 2.04E?01 PABPN1 NM_004643 1.11E?01 4.69E?02 5.17E?02 3.41E?01 1.68E?01 2.38E?01 TPCN1 NM_017901 1.40E?01 4.05E?01 5.13E?02 2.28E?01 5.16E?02 8.08E?02 PIANP NM_001244015 4.07E?02 1.67E?01 7.10E?03 2.92E?01 3.87E?03 4.46E?01 LTBP2 NM_000428 1.06E?01 4.25E?01 3.74E?02 1.26E?01 3.94E?02 2.24E?01 C17orf49 NM_001142798 3.70E?01 1.19E?02 2.45E?01 4.82E?02 1.84E?01 1.01E?01 SFT2D3 NM_032740 1.95E?01 9.26E?02 2.74E?01 4.12E?02 2.55E?01 1.02E?01 DTWD2 NM_173666 3.64E?01 7.79E?02 1.18E?01 1.67E?01 4.03E?02 1.92E?01 IHH NM_002181 7.48E?02 2.73E?01 6.19E?02 1.43E?01 3.03E?01 1.04E?01 NAA40 NM_024771 2.53E?02 4.14E?01 5.32E?02 1.98E?01 1.16E?01 1.54E?01 SPCS1 NM_014041 2.19E?01 1.74E?02 1.64E?01 1.48E?01 3.67E?01 4.45E?02 SEMA5A NM_003966 2.34E?01 4.67E?01 9.50E?02 3.16E?02 4.50E?02 8.89E?02 CA7 NM_005182 5.81E?02 2.32E?01 1.63E?03 2.84E?01 2.23E?03 3.84E?01 TNFRSF10A NM_003844 7.63E?02 8.80E?02 1.48E?01 1.73E?01 2.21E?01 2.56E?01 C2CD4C NM_001136263 1.59E?01 1.74E?01 2.28E?01 1.40E?01 6.01E?02 2.03E?01 CD72 NM_001782 6.19E?02 1.58E?01 1.97E?02 2.64E?01 2.88E?01 1.71E?01 VWA2 NM_001272046 1.44E?01 1.43E?01 1.73E?01 1.83E?01 1.61E?01 1.60E?01 DAOA NM_001161812 6.39E?02 4.12E?01 1.15E?01 5.33E?02 2.25E?01 9.47E?02 NKX3-2 NM_001189 3.98E?01 2.15E?01 2.67E?02 1.31E?01 3.87E?02 1.54E?01 IER3 NM_003897 6.26E?02 4.59E?02 5.14E?02 3.57E?01 1.71E?01 2.79E?01 OR51A7 NM_001004749 5.20E?01 2.02E?02 2.14E?01 4.59E?02 5.79E?02 1.10E?01 ARRDC3 NM_020801 4.08E?01 3.26E?02 2.11E?01 2.81E?02 2.44E?01 4.38E?02 C16orf59 NM_025108 5.31E?02 3.38E?01 2.64E?02 2.27E?01 7.21E?02 2.51E?01 CD274 NM_014143 7.10E?02 2.35E?03 3.25E?01 9.87E?02 4.60E?01 1.06E?02 EXOSC1 NM_016046 2.40E?01 3.42E?01 1.25E?01 7.33E?02 5.35E?02 1.35E?01 PELI1 NM_020651 2.09E?01 1.53E?01 1.88E?01 1.72E?01 1.18E?01 1.28E?01 ATG4A NM_178270 3.62E?01 2.51E?01 6.12E?02 5.89E?02 1.61E?01 7.55E?02 FAM228A NM_001040710 1.71E?01 1.56E?01 1.62E?01 1.36E?01 2.00E?01 1.45E?01 USP7 NM_003470 2.37E?01 2.23E?01 6.12E?02 6.27E?02 2.83E?01 1.02E?01 YOD1 NM_001276320 2.36E?02 3.72E?01 7.98E?02 1.59E?01 6.02E?02 2.75E?01 SLC52A2 NM_024531 3.01E?01 3.60E?01 8.46E?02 1.11E?01 2.28E?02 8.95E?02 PCDH11X NM_001168360 5.99E?03 8.37E?02 2.74E?03 3.79E?01 1.55E?01 3.43E?01 ASIC3 NM_004769 4.52E?02 3.44E?01 2.66E?01 4.13E?02 2.20E?01 5.35E?02 PLS1 NM_001145319 1.70E?01 3.91E?01 3.23E?02 1.56E?01 7.25E?02 1.49E?01 C17orf102 NM_207454 5.28E?02 2.39E?01 5.92E?03 2.24E?01 1.97E?03 4.49E?01 ARMC7 NM_024585 1.09E?01 4.52E?02 8.37E?02 2.37E?01 2.52E?01 2.47E?01 POU3F2 NM_005604 6.10E?02 2.63E?01 1.47E?01 1.03E?01 6.61E?02 3.34E?01 TFPI NM_006287 1.25E?01 1.40E?01 1.88E?01 1.87E?01 1.16E?01 2.19E?01 FAM83H NM_198488 4.00E?01 1.65E?01 1.83E?01 4.60E?02 1.25E?01 5.47E?02 ITGA7 NM_002206 1.50E?01 1.41E?01 2.38E?02 1.79E?01 2.41E?01 2.39E?01 B3GNT4 NM_030765 1.70E?01 2.14E?01 2.09E?01 1.91E?01 1.31E?01 5.98E?02 ARHGAP25 NM_001166277 1.77E?01 1.56E?01 1.04E?01 2.37E?01 5.70E?02 2.44E?01 LHX3 NM_178138 4.02E?02 3.90E?01 8.07E?02 1.91E?01 4.70E?02 2.27E?01 VHLL NM_001004319 2.89E?01 3.33E?02 7.30E?02 2.19E?01 7.94E?02 2.83E?01 KIAA1432 NM_020829 2.32E?01 1.50E?01 1.72E?01 8.12E?02 1.67E?01 1.74E?01 NGFRAP1 NM_014380 8.06E?02 4.34E?01 2.58E?02 1.24E?01 1.79E?01 1.34E?01 FXN NM_001161706 1.56E?01 8.46E?02 3.73E?02 2.79E?01 1.05E?01 3.15E?01 NTNG1 NM_001113228 2.10E?01 1.09E?01 5.60E?02 2.70E?01 2.26E?02 3.11E?01 PIK3R3 NM_003629 8.43E?02 7.09E?03 1.72E?01 1.80E?01 1.55E?01 3.81E?01 EVL NM_016337 2.67E?02 1.52E?01 7.92E?02 3.74E?01 7.28E?02 2.75E?01 LARS NM_020117 1.08E?01 6.87E?03 2.91E?01 2.01E?02 5.41E?01 1.21E?02 TOE1 NM_025077 7.67E?02 7.34E?03 3.42E?01 1.93E?01 1.52E?01 2.08E?01 KRT38 NM_006771 6.12E?02 2.24E?01 2.25E?01 7.84E?02 2.94E?01 9.80E?02 PRKD2 NM_001079882 1.61E?01 2.52E?01 1.16E?01 2.29E?01 6.50E?02 1.59E?01 FUNDC1 NM_173794 5.79E?02 1.57E?01 9.02E?02 2.59E?01 1.56E?01 2.61E?01 ALYREF NM_005782 1.73E?01 4.65E?01 1.51E?02 1.14E?01 1.16E?01 9.98E?02 KBTBD12 NM_207335 9.84E?02 2.96E?01 2.06E?01 4.87E?02 2.67E?01 6.69E?02 ADAL NM_001159280 3.05E?02 7.47E?03 1.72E?01 3.10E?01 2.05E?01 2.58E?01 P2RY10 NM_014499 1.65E?01 8.35E?02 1.34E?01 1.58E?01 2.56E?01 1.86E?01 NSUN4 NM_001256128 2.58E?01 7.64E?02 2.85E?01 2.19E?02 2.59E?01 8.23E?02 ANKRD45 NM_198493 8.44E?02 6.64E?02 3.58E?01 1.21E?03 4.70E?01 3.37E?03 HELZ2 NM_033405 4.25E?02 2.02E?01 4.11E?02 1.61E?01 2.54E?01 2.84E?01 NAP1L5 NM_153757 5.52E?02 3.24E?01 2.55E?02 2.54E?01 2.78E?02 2.97E?01 BABAM1 NM_014173 1.43E?01 1.75E?01 1.00E?01 2.89E?01 6.82E?02 2.09E?01 ADTRP NM_032744 1.77E?02 3.10E?01 3.92E?02 2.92E?01 1.07E?01 2.19E?01 AIF1 NM_001623 2.09E?01 2.28E?01 7.12E?02 1.38E?01 1.98E?01 1.42E?01 GPBP1 NM_001127236 1.82E?01 4.73E?02 3.83E?01 2.17E?02 2.81E?01 7.07E?02 RPS10 NM_001203245 9.83E?02 4.20E?01 5.17E?02 1.95E?01 4.04E?02 1.83E?01 C1orf162 NM_174896 2.83E?01 2.46E?02 2.64E?01 4.35E?02 3.08E?01 6.47E?02 SYNCRIP NM_006372 1.43E?01 2.44E?01 1.54E?01 1.55E?01 6.65E?02 2.25E?01 GRK4 NM_182982 1.93E?01 4.96E?02 2.37E?01 3.25E?02 4.20E?01 5.66E?02 TBC1D21 NM_153356 1.67E?01 3.44E?01 1.60E?01 1.59E?01 1.10E?01 4.93E?02 PDE4D NM_001197222 6.50E?01 1.23E?01 7.51E?02 5.31E?02 2.17E?02 6.67E?02 RPN1 NM_002950 2.64E?01 2.43E?01 1.06E?01 9.25E?02 1.14E?01 1.72E?01 FBXL19 NM_001282351 4.46E?01 6.32E?02 1.91E?01 1.25E?01 1.43E?01 2.33E?02 OR4S2 NM_001004059 3.36E?02 5.50E?02 1.87E?02 4.19E?01 4.55E?02 4.19E?01 ORC6 NM_014321 6.02E?02 2.35E?01 5.57E?02 3.25E?01 3.90E?02 2.76E?01 MRPL18 NM_014161 3.15E?01 2.69E?01 2.08E?01 6.53E?02 9.71E?02 3.89E?02 GALNT9 NM_021808 2.21E?01 4.46E?01 5.12E?02 1.36E?01 2.22E?02 1.16E?01 PIN4 NM_001170747 3.10E?01 2.27E?02 2.42E?01 7.09E?02 2.87E?01 6.04E?02 C2orf15 NM_144706 2.52E?02 2.78E?01 5.60E?03 2.40E?01 3.44E?03 4.42E?01 TUSC5 NM_172367 6.25E?02 1.46E?01 2.80E?01 1.34E?01 3.62E?01 1.06E?02 B4GALT2 NM_003780 4.30E?01 4.39E?02 9.21E?02 1.88E?01 2.79E?02 2.14E?01 NBL1 NM_001278166 4.89E?02 3.29E?01 2.08E?01 7.42E?02 2.71E?01 6.53E?02 AGK NM_018238 2.15E?01 2.02E?01 1.01E?01 1.80E?01 8.70E?02 2.12E?01 TCP11L1 NM_001145541 9.13E?02 1.66E?01 2.12E?02 3.48E?01 8.29E?02 2.88E?01 SOWAHC NM_023016 2.09E?02 2.29E?01 1.34E?01 2.97E?01 1.06E?01 2.10E?01 FOPNL NM_144600 7.00E?02 6.40E?01 4.87E?02 8.91E?02 4.94E?02 1.01E?01 NMNAT2 NM_170706 2.67E?01 7.96E?02 1.21E?01 2.03E?01 9.40E?02 2.34E?01 OR5P2 NM_153444 2.06E?01 5.70E?02 3.01E?01 3.93E?02 3.23E?01 7.29E?02 CPLX2 NM_006650 3.74E?01 1.07E?01 3.93E?01 2.69E?02 7.53E?02 2.38E?02 GNA13 NM_006572 1.68E?01 3.57E?01 1.52E?01 3.77E?02 2.41E?01 4.36E?02 PDXDC1 NM_001285448 6.19E?02 2.82E?01 8.05E?02 1.39E?01 1.44E?01 2.92E?01 NFE2L2 NM_006164 7.58E?02 8.85E?02 4.07E?01 6.06E?02 2.63E?01 1.06E?01 CYP2U1 NM_183075 2.38E?01 3.07E?01 4.26E?02 1.38E?01 9.61E?02 1.80E?01 PAGE5 NM_001013435 2.94E?01 5.28E?02 2.72E?01 2.54E?02 3.28E?01 2.99E?02 PVRL3 NM_001243288 5.76E?02 4.75E?01 2.33E?02 1.12E?01 6.55E?02 2.69E?01 SOAT1 NM_001252511 1.68E?02 1.40E?01 1.49E?02 2.23E?01 1.18E?02 5.96E?01 RRAGD NM_021244 2.48E?02 5.44E?01 2.02E?02 1.59E?01 3.60E?02 2.19E?01 KIF19 NM_153209 3.44E?01 2.01E?02 3.09E?01 3.31E?02 2.00E?01 9.72E?02 GUCY1A3 NM_001130684 5.12E?02 8.15E?01 3.15E?03 2.66E?02 9.63E?04 1.07E?01 PARP12 NM_022750 1.25E?01 5.19E?01 5.87E?02 2.15E?01 3.84E?02 4.82E?02 C2orf42 NM_017880 1.81E?01 1.13E?01 1.96E?01 1.73E?01 1.32E?01 2.11E?01 DPPA5 NM_001025290 2.89E?02 1.78E?02 6.85E?02 4.08E?01 7.18E?02 4.12E?01 NFASC NM_001160331 1.58E?01 2.20E?01 2.63E?01 9.65E?02 1.67E?01 1.03E?01 MED10 NM_032286 1.20E?02 2.67E?01 2.44E?02 3.51E?01 2.08E?02 3.33E?01 MSRB3 NM_001193461 1.38E?01 3.83E?01 1.44E?01 7.20E?02 2.24E?01 4.59E?02 RRP1B NM_015056 1.80E?01 5.62E?02 3.74E?01 2.05E?03 3.90E?01 5.18E?03 MAPKAP1 NM_024117 7.91E?03 5.71E?01 7.03E?02 1.22E?01 1.01E?01 1.37E?01 PDLIM2 NM_021630 5.42E?01 1.50E?01 1.73E?01 4.68E?02 9.68E?03 8.75E?02 TPSG1 NM_012467 4.45E?02 1.64E?01 7.39E?02 7.53E?02 3.59E?01 2.93E?01 STK32B NM_018401 3.23E?02 1.03E?01 1.94E?01 2.90E?01 2.55E?01 1.36E?01 VSIG4 NM_001100431 2.40E?01 2.81E?01 2.03E?01 7.62E?02 1.16E?01 9.49E?02 SIRT1 NM_001142498 2.47E?01 5.85E?02 2.12E?01 3.49E?02 3.61E?01 9.74E?02 TRAF3IP1 NM_015650 9.03E?02 4.90E?03 3.33E?01 1.06E?02 5.31E?01 4.17E?02 VILL NM_015873 1.10E?01 4.67E?01 1.88E?01 2.03E?02 2.02E?01 2.35E?02 PLCG1 NM_002660 6.95E?02 1.76E?01 2.06E?01 1.13E?01 3.41E?01 1.07E?01 TNXB NM_032470 1.20E?01 1.05E?01 3.78E?02 5.08E?01 3.80E?02 2.03E?01 SUMO2 NM_006937 1.73E?01 1.64E?01 1.54E?01 1.74E?01 2.06E?01 1.41E?01 OR10G7 NM_001004463 2.54E?03 3.80E?01 3.58E?02 1.92E?01 2.28E?01 1.74E?01 ARID2 NM_152641 4.94E?01 4.97E?02 2.18E?01 3.95E?03 1.05E?01 1.45E?01 CPEB1 NM_001079533 2.10E?01 1.86E?01 4.76E?02 2.47E?01 2.73E?01 5.20E?02 TNS4 NM_032865 1.63E?01 2.28E?01 6.74E?02 2.60E?01 1.04E?01 1.94E?01 MS4A6A NM_152851 3.93E?01 2.82E?01 1.18E?01 8.77E?02 1.05E?01 3.24E?02 DPF2 NM_006268 1.76E?01 4.05E?01 1.55E?01 9.54E?02 1.29E?01 5.87E?02 BRI3 NM_015379 1.12E?01 2.95E?01 2.32E?02 2.41E?01 5.44E?02 2.94E?01 PARD3 NM_001184788 5.69E?02 5.55E?01 9.44E?03 9.15E?02 4.59E?02 2.61E?01 AP5Z1 NM_014855 2.02E?01 3.10E?02 4.67E?02 4.05E?01 1.05E?01 2.30E?01 SLITRK6 NM_032229 3.20E?02 4.29E?01 8.60E?02 1.07E?01 7.11E?02 2.95E?01 MST4 NM_001042452 3.78E?01 9.38E?02 1.83E?01 1.14E?01 1.76E?01 7.63E?02 SMAD7 NM_001190822 5.55E?02 5.67E?01 9.21E?02 5.82E?02 1.02E?01 1.47E?01 YES1 NM_005433 1.53E?03 1.06E?01 6.65E?02 3.12E?01 1.41E?01 3.94E?01 CHRD NM_003741 1.32E?01 1.82E?01 2.38E?01 1.86E?01 1.44E?01 1.41E?01 TNIP2 NM_024309 2.84E?01 2.48E?01 6.98E?02 1.98E?01 2.61E?03 2.20E?01 ZRANB2 NM_005455 1.27E?01 1.23E?01 2.45E?01 7.42E?02 3.30E?01 1.24E?01 KIAA0586 NM_001244189 3.44E?01 7.65E?02 2.86E?02 2.02E?01 8.60E?02 2.86E?01 USPL1 NM_005800 2.85E?02 2.89E?01 2.24E?03 3.16E?01 1.35E?01 2.52E?01 HCRTR2 NM_001526 2.77E?01 8.07E?04 2.96E?01 1.70E?02 4.08E?01 2.47E?02 ZNF397 NM_001135178 2.19E?01 6.96E?02 1.25E?01 6.32E?02 2.29E?01 3.18E?01 FAM53B NM_014661 2.72E?01 1.42E?02 2.81E?01 6.29E?03 4.36E?01 1.40E?02 LYAR NM_017816 1.01E?01 6.28E?01 2.99E?02 6.13E?02 3.56E?02 1.68E?01 CAV1 NM_001172896 2.61E?01 2.50E?01 1.34E?01 1.86E?01 8.97E?02 1.04E?01 TMEM89 NM_001008269 4.06E?01 1.73E?02 3.26E?01 5.87E?03 2.56E?01 1.30E?02 SPPL2C NM_175882 1.95E?01 4.46E?02 2.41E?01 1.24E?01 3.56E?01 6.50E?02 ATE1 NM_001288736 3.04E?01 5.92E?02 2.54E?01 1.66E?01 1.07E?01 1.36E?01 CLDN23 NM_194284 1.39E?01 2.74E?01 4.25E?02 2.75E?01 3.83E?02 2.58E?01 PLEKHG1 NM_001029884 1.48E?01 1.11E?01 2.20E?01 2.10E?01 1.80E?01 1.59E?01 ETFDH NM_001281738 7.58E?02 1.13E?01 4.08E?02 2.87E?01 1.53E?01 3.59E?01 ISYNA1 NM_016368 4.61E?02 1.97E?01 2.69E?01 7.86E?02 3.36E?01 1.03E?01 CAV1 NM_001172897 1.87E?01 3.20E?01 8.99E?02 1.33E?01 1.75E?01 1.24E?01 EMILIN3 NM_052846 2.25E?01 1.04E?02 2.84E?01 1.88E?02 3.76E?01 1.16E?01 ASB15 NM_080928 1.37E?01 2.23E?01 5.79E?02 9.37E?02 3.97E?01 1.21E?01 IFNA2 NM_000605 4.56E?02 2.50E?01 7.82E?02 2.19E?01 2.28E?01 2.09E?01 RRAS NM_006270 1.33E?01 3.17E?01 1.70E?01 1.73E?01 4.76E?02 1.92E?01 SHANK3 NM_033517 1.55E?02 5.16E?01 3.73E?02 1.46E?01 1.34E?01 1.83E?01 TGIF1 NM_173211 3.70E?01 1.54E?01 1.61E?01 6.78E?02 1.72E?01 1.06E?01 SFRP2 NM_003013 7.58E?02 1.71E?01 3.73E?01 1.01E?01 3.06E?01 5.11E?03 CSRP2BP NM_020536 1.61E?01 2.43E?01 1.40E?01 2.16E?01 8.39E?02 1.88E?01 RBMXL2 NM_014469 7.58E?02 1.26E?01 4.25E?01 2.01E?04 4.05E?01 4.33E?04 GH2 NM_022556 3.57E?01 1.21E?01 4.98E?02 1.57E?01 1.50E?01 1.98E?01 GP1BB NM_000407 4.93E?02 5.89E?01 3.49E?02 2.33E?01 3.89E?02 8.86E?02 RAB9B NM_016370 7.06E?01 3.75E?03 1.31E?01 3.35E?02 1.19E?01 3.97E?02 IRX1 NM_024337 2.72E?02 3.86E?02 3.92E?01 7.08E?02 4.46E?01 5.96E?02 KLK13 NM_015596 2.49E?01 2.19E?01 1.23E?01 1.63E?01 8.45E?02 1.96E?01 CBX3 NM_016587 6.49E?01 5.27E?03 1.85E?01 6.56E?02 6.04E?02 6.88E?02 NFKB1 NM_001165412 4.58E?01 4.78E?03 1.66E?01 9.85E?02 1.12E?01 1.94E?01 PPP1R3F NM_033215 2.44E?01 2.65E?02 2.67E?01 7.23E?02 3.40E?01 8.43E?02 CCDC9 NM_015603 5.97E?02 9.42E?02 3.02E?01 7.05E?02 4.91E?01 1.82E?02 ORC4 NM_002552 1.48E?01 3.45E?01 1.42E?01 2.56E?01 8.25E?02 6.20E?02 PLEC NM_201378 1.56E?01 6.88E?02 2.51E?01 1.39E?01 2.48E?01 1.76E?01 WDR5 NM_052821 1.47E?01 4.72E?01 1.10E?01 1.02E?01 1.06E?01 1.01E?01 CA2 NM_000067 4.12E?01 3.63E?02 3.27E?01 1.14E?02 2.00E?01 5.11E?02 VANGL1 NM_138959 7.11E?02 3.31E?01 1.42E?01 1.10E?01 1.45E?01 2.39E?01 FOXK2 NM_004514 1.53E?01 3.15E?01 1.76E?01 1.17E?01 1.56E?01 1.23E?01 STEAP1B NM_207342 3.24E?01 2.28E?01 2.16E?01 2.35E?02 2.33E?01 1.37E?02 TRIM48 NM_024114 2.49E?01 7.57E?02 2.64E?01 1.13E?01 3.28E?01 9.26E?03 VMAC NM_001017921 4.61E?01 2.28E?01 1.65E?01 6.33E?02 9.58E?02 2.64E?02 PSME2 NM_002818 4.36E?02 1.95E?01 1.12E?01 2.96E?01 9.75E?02 2.96E?01 ZNF275 NM_001080485 3.10E?01 5.57E?03 3.56E?01 1.97E?02 3.32E?01 1.71E?02 CAPRIN1 NM_203364 1.85E?01 4.27E?01 1.37E?01 7.35E?02 1.10E?01 1.07E?01 ADCK2 NM_052853 2.52E?01 2.97E?01 1.86E?01 1.73E?02 2.70E?01 1.90E?02 DNAH12 NM_178504 2.76E?02 3.13E?01 5.97E?02 3.58E?01 2.04E?01 7.92E?02 WBSCR27 NM_152559 4.16E?01 3.77E?03 2.11E?01 3.18E?02 3.41E?01 3.99E?02 BRINP1 NM_014618 3.89E?01 5.28E?02 1.05E?01 1.07E?01 2.32E?01 1.58E?01 ZNF331 NM_001079906 1.05E?02 6.71E?02 7.09E?02 3.88E?01 9.00E?02 4.17E?01 UBXN1 NM_001286078 4.08E?02 5.67E?01 1.12E?02 2.66E?01 5.71E?03 1.53E?01 ART5 NM_001079536 1.55E?02 1.17E?01 2.29E?01 2.14E?01 2.20E?01 2.49E?01 IMPDH1 NM_001142574 3.04E?01 4.09E?02 1.84E?01 9.51E?02 3.07E?01 1.12E?01 HAUS8 NM_033417 9.22E?02 1.52E?01 5.73E?01 5.74E?02 1.09E?01 6.10E?02 ARFIP2 NM_012402 3.67E?01 4.97E?02 2.06E?01 9.44E?02 2.06E?01 1.22E?01 KRI1 NM_023008 1.52E?01 1.35E?01 2.31E?01 1.89E?01 2.62E?01 7.75E?02 TOP3B NM_001282113 1.27E?01 2.07E?02 5.16E?02 3.27E?01 1.80E?01 3.39E?01 COL5A2 NM_000393 1.31E?01 3.31E?01 2.61E?01 7.67E?02 2.33E?01 1.28E?02 PPP1R3D NM_006242 3.29E?01 1.37E?01 1.66E?01 1.10E?01 2.14E?01 8.99E?02 OR6N2 NM_001005278 1.09E?01 2.65E?01 2.56E?01 3.67E?02 3.19E?01 6.08E?02 GLTSCR2 NM_015710 5.13E?01 1.27E?01 9.58E?02 7.54E?02 1.23E?01 1.13E?01 SLC1A3 NM_001166695 3.51E?01 5.00E?02 2.27E?01 1.57E?01 9.14E?02 1.70E?01 DOCK11 NM_144658 1.44E?01 3.24E?01 6.02E?02 2.47E?01 6.37E?02 2.08E?01 RNPC3 NM_017619 6.16E?02 1.56E?01 1.15E?01 1.61E?01 1.87E?01 3.66E?01 VPS37A NM_001145152 4.27E?02 9.79E?01 5.51E?03 1.45E?02 1.84E?03 3.71E?03 PEX3 NM_003630 3.16E?01 4.58E?01 6.01E?02 1.28E?01 5.31E?02 3.24E?02 MAL NM_022440 6.01E?01 8.87E?02 2.20E?01 2.08E?02 1.12E?01 5.71E?03 OR51T1 NM_001004759 5.26E?01 2.17E?01 1.40E?01 9.04E?02 3.86E?02 3.68E?02 RORC NM_001001523 1.56E?01 2.27E?01 6.62E?02 1.49E?01 2.20E?01 2.32E?01 URI1 NM_001252641 3.72E?02 2.66E?01 1.64E?01 1.93E?01 1.62E?01 2.28E?01 NR2F2 NM_021005 3.02E?01 2.86E?01 4.15E?02 2.08E?01 5.34E?02 1.59E?01 CGB7 NM_033142 1.30E?01 2.38E?01 1.81E?01 1.94E?01 1.72E?01 1.35E?01 BCL2A1 NM_001114735 9.39E?02 5.87E?03 2.14E?01 2.20E?01 1.25E?01 3.92E?01 ZNF215 NM_013250 1.88E?01 1.64E?01 1.05E?02 3.31E?01 1.64E?02 3.41E?01 INA NM_032727 1.40E?02 2.67E?01 6.14E?03 3.77E?01 3.02E?03 3.85E?01 FAM69A NM_001252271 5.90E?02 3.22E?01 1.46E?01 1.66E?01 2.44E?01 1.14E?01 EPHX4 NM_173567 3.87E?02 2.16E?01 4.60E?02 3.71E?01 3.75E?02 3.43E?01 ITPKB NM_002221 7.08E?02 4.15E?01 5.04E?02 3.03E?01 3.80E?02 1.75E?01 C10orf25 NM_001039380 7.29E?01 2.03E?01 3.72E?02 2.74E?02 1.37E?02 4.28E?02 FRZB NM_001463 1.81E?01 3.70E?01 1.32E?01 1.63E?01 7.63E?02 1.31E?01 SMIM15 NM_001048249 2.71E?01 2.18E?01 1.54E?01 7.75E?02 9.15E?02 2.43E?01 IPCEF1 NM_015553 4.80E?02 1.17E?01 1.21E?01 1.06E?01 5.41E?01 1.20E?01 SPINK2 NM_021114 3.12E?01 1.00E?01 2.18E?01 2.17E?01 1.66E?01 4.21E?02

    TABLE-US-00004 TABLE 2 Negative control genes and candidate genes enriched in the CRISPRa screen. Set of 311 negative control housekeeping genes for estimating FDR of screening results and evaluating cytolytic activity. Negative control genes consisted of ribosomal proteins, RNA polymerases, translation factors, mitochondrial ribosomal proteins, GAPDH, and ACTB. Candidate genes were enriched in the top 1% across at least two screening replicates. Negative Negative Candidate Candidate Candidate Candidate Control Control Gene Gene Gene Gene Name ID Name Refseq Name Refseq ACTB NM 001101 ABCC8 NM 001287174 MAP4K4 NM 001242559 EIF1 NM 005801 ABHD5 NM 016006 MAPK11 NM 002751 EIF1AD NM 001242484 ABHD8 NM 024527 MAPRE2 NM 014268 EIF1AX NM 001412 ACACA NM 198839 MBD3L2 NM 144614 EIF1AY NM 004681 ACOT6 NM 001037162 MBD3L3 NM 001164425 EIF1B NM_005875 ACP6 NM_016361 MBLAC1 NM_203397 EIF2A NM 032025 ACSL1 NM 001286708 MCAM NM 006500 EIF2AK1 NM_001134335 ACTR2 NM_005722 MCL1 NM_021960 EIF2AK2 NM 002759 ADAMTS12 NM 030955 MCU NM 138357 EIF2AK2 NM 001135652 ADAMTS13 NM 139027 MDK NM 001270550 EIF2AK3 NM_004836 AFAP1L1 NM_001146337 ME2 NM_001168335 EIF2AK4 NM 001013703 AMER1 NM 152424 MEFV NM 001198536 EIF2B1 NM_001414 AMER3 NM_001105193 MEIS2 NM_172315 EIF2B2 NM 014239 AMER3 NM 001105195 MEN1 NM 000244 EIF2B3 NM 001261418 ANGEL2 NM 144567 MFSD6 NM 017694 EIF2B4 NM 172195 ANGPTL7 NM 021146 MGAT5B NM 001199172 EIF2B4 NM 015636 ANKAR NM 144708 MINPP1 NM 001178118 EIF2B5 NM_003907 ANKEF1 NM_198798 MKNK2 NM_017572 EIF2D NM 006893 ANKRD45 NM 198493 MLNR NM 001507 EIF2S1 NM_004094 ANKRD52 NM_173595 MOCS1 NM_001075098 EIF2S2 NM 003908 AP1B1 NM 001127 MPC1L NM 001195522 EIF2S3 NM 001415 AP3M1 NM 207012 MPP2 NM 001278371 EIF3A NM_003750 APC NM_001127510 MPZL2 NM_005797 EIF3B NM 003751 APLP2 NM 001243299 MRPL15 NM 014175 EIF3C NM_001037808 AQP1 NM_198098 MRPL53 NM_053050 EIF3C NM 001199142 AOP8 NM 001169 MSS51 NM 001024593 EIF3CL NM 001099661 ARFGEF1 NM 006421 MXI1 NM 130439 EIF3D NM 003753 ARHGAP27 NM 001282290 MYBL1 NM 001144755 EIF3E NM 001568 ARHGAP27 NM 174919 MYL9 NM 006097 EIF3F NM_003754 ARHGAP28 NM_001010000 MZF1 NM_001267033 EIF3G NM 003755 ARHGEF10L NM 018125 NAT8L NM 178557 EIF3H NM 003756 ARID3C NM 001017363 NBL1 NM 001204086 EIF3I NM 003757 ARL6IP5 NM 006407 NBL1 NM 001278165 EIF3J NM 003758 ARMCX5 NM 001168478 NBPF15 NM 173638 EIF3K NM_013234 ARMCX5 NM_001168480 NCOA7 NM_001199619 EIF3L NM 001242923 ARNT NM 001668 NEDD4L NM 001144966 EIF3M NM_006360 ARPP21 NM_001267617 NEDD4L NM_001144968 EIF4A1 NM 001416 ARPP21 NM 001267619 NEK6 NM 001166169 EIF4A2 NM 001967 ARRDC5 NM 001080523 NEK6 NM 001166171 EIF4A3 NM_014740 ASXL3 NM_030632 NFATC1 NM_001278670 EIF4B NM 001417 ATG3 NM 022488 NFE2L2 NM 001145413 EIF4E NM_001130678 ATP2A2 NM_170665 NIFK NM_032390 EIF4E NM 001968 ATP2C1 NM 001001485 NIPAL4 NM 001172292 EIF4E1B NM 001099408 ATP2C1 NM 001001487 NME1 NM 000269 EIF4E2 NM 001276337 ATP5S NM 015684 NME2 NM 001018139 EIF4E3 NM 001134650 B3GAT1 NM 018644 NOL9 NM 024654 EIF4E3 NM_001134651 B3GNT2 NM_006577 NSG1 NM_001287763 EIF4E3 NM 001134649 BCAR1 NM 001170717 NSG1 NM 014392 EIF4E3 NM_173359 BCL2A1 NM_001114735 NSMCE4A NM_001167865 EIF4E3 NM 001282886 BCOR NM 001123385 NUDT14 NM 177533 EIF4EBP1 NM 004095 BMP5 NM 021073 NUDT18 NM 024815 EIF4EBP2 NM_004096 BMX NM_001721 NXT2 NM_018698 EIF4EBP3 NM 003732 BMX NM 203281 ODF3 NM 001286136 EIF4ENIF1 NM_001164501 BPIFB3 NM_182658 ODF3L2 NM_182577 EIF4ENIF1 NM 001164502 BSG NM 198589 OGG1 NM 002542 EIF4G1 NM 182917 BSG NM 198591 OLAH NM 018324 EIF4G1 NM_001291157 BTAF1 NM_003972 OLFM1 NM_006334 EIF4G1 NM 004953 BTC NM 001729 OR13C2 NM 001004481 EIF4G1 NM_198244 BTNL10 NM_001287262 OR4C12 NM_001005270 EIF4G2 NM 001172705 C12orf29 NM 001009894 OR51L1 NM 001004755 EIF4G2 NM 001418 C12orf5 NM 020375 OR5AN1 NM 001004729 EIF4G3 NM 003760 C12orf74 NM 001178097 ORAI3 NM 152288 EIF4G3 NM 001198803 C16orf70 NM 025187 OTOP3 NM 178233 EIF4G3 NM_001198802 C16orf90 NM_001080524 OTX1 NM_014562 EIF4H NM 022170 C16orf93 NM 001014979 OVCH1 NM 183378 EIF5 NM_001969 C17orf102 NM_207454 OXR1 NM_001198532 EIF5 NM 183004 C19orf52 NM 138358 P2RX5 NM 001204519 EIF5A NM 001143761 C1orf146 NM 001012425 P2RX6 NM 001159554 EIF5A NM_001143762 C1orf64 NM_178840 P4HA3 NM_182904 EIF5A NM 001143760 C1orf87 NM 152377 PAM16 NM 016069 EIF5A NM_001970 C1R NM_001733 PBX3 NM_006195 EIF5A2 NM 020390 C20orf78 NM 001242671 PCBP1 NM 006196 EIF5AL1 NM_001099692 C20orf96 NM_153269 PCDH11X NM_001168360 EIF5B NM 015904 C2orf15 NM 144706 PCDHA12 NM 018903 EIF6 NM_181468 C2orf76 NM_001017927 PCDHGA1 NM_018912 EIF6 NM 181466 C2orf88 NM 001042520 PCP4 NM 006198 GAPDH NM_001289746 C2orf88 NM_001042521 PCSK9 NM_174936 GAPDH NM 002046 C5orf55 NM 138464 PCYOX1L NM 024028 GAPDH NM 001256799 C7orf76 NM 001201451 PDCL2 NM 152401 MRPL1 NM_020236 C8orf22 NM_001256598 PDE1A NM_001003683 MRPL10 NM 148887 C8orf33 NM 023080 PDE1A NM 001258314 MRPL11 NM_016050 C8orf76 NM_032847 PDE1A NM_005019 MRPL12 NM 002949 C8orf86 NM 207412 PDE4C NM 001098818 MRPL13 NM 014078 C9orf40 NM 017998 PDIA3 NM 005313 MRPL14 NM 032111 C9orf50 NM 199350 PDK2 NM 001199898 MRPL15 NM 014175 CA7 NM 005182 PDK2 NM 001199900 MRPL16 NM_017840 CAB39L NM_001287339 PEG3 NM_001146186 MRPL17 NM 022061 CALM1 NM 006888 PGM2L1 NM 173582 MRPL18 NM_014161 CAPNS2 NM_032330 PHF11 NM_001040443 MRPL19 NM 014763 CARD10 NM 014550 PIANP NM 001244015 MRPL2 NM 015950 CARHSP1 NM 001042476 PIGO NM 001201484 MRPL20 NM_017971 CATSPERG NM_021185 PIGZ NM_025163 MRPL21 NM 181515 CCDC66 NM 001141947 PITPNB NM 001284278 MRPL22 NM_014180 CCNC NM_005190 PITRM1 NM_001242307 MRPL23 NM 021134 CCR4 NM 005508 PITX1 NM 002653 MRPL24 NM 024540 CCSER2 NM 001284242 PLCD1 NM 001130964 MRPL27 NM 016504 CD14 NM 001174105 PLEKHG2 NM 022835 MRPL28 NM 006428 CD164L2 NM 207397 PLEKHG5 NM 001042663 MRPL3 NM_007208 CD200R1L NM_001199215 PLEKHM3 NM_001080475 MRPL30 NM 145212 CD274 NM 014143 PLN NM 002667 MRPL32 NM 031903 CD36 NM 001127444 PNLIPRP1 NM 006229 MRPL33 NM 004891 CD36 NM 001289908 POC1B NM 001199777 MRPL34 NM 023937 CD3G NM 000073 POLD3 NM 006591 MRPL35 NM_145644 CDC14A NM_033312 POLR3GL NM_032305 MRPL36 NM 032479 CDC20 NM 001255 POP7 NM 005837 MRPL37 NM_016491 CDC42BPB NM_006035 POU3F1 NM_002699 MRPL38 NM 032478 CDH18 NM 001167667 PPME1 NM 001271593 MRPL39 NM 017446 CDK10 NM 052988 PPOX NM 000309 MRPL4 NM_015956 CDK19 NM_015076 PPP1R18 NM_001134870 MRPL40 NM 003776 CDK2AP2 NM 001271849 PPP1R8 NM 002713 MRPL41 NM_032477 CDKN1A NM_001220778 PPRC1 NM_015062 MRPL42 NM 172177 CDKN2A NM 000077 PQBP1 NM 001167989 MRPL43 NM 176792 CDYL NM 004824 PQBP1 NM 001167990 MRPL44 NM 022915 CEBPE NM 001805 PRDM2 NM 001007257 MRPL45 NM 001278279 CELA2B NM 015849 PRDX1 NM 001202431 MRPL46 NM_022163 CEP41 NM_001257159 PRDX6 NM_004905 MRPL47 NM 020409 CGREF1 NM 001166241 PRH1 NM 001291314 MRPL48 NM_016055 CHCHD10 NM_213720 PRICKLE1 NM_001144883 MRPL49 NM 004927 CHID1 NM 001142676 PRKACB NM 002731 MRPL50 NM 019051 CHRNA10 NM 020402 PRKAG1 NM 001206710 MRPL51 NM_016497 CHRNA9 NM_017581 PRKAG1 NM_002733 MRPL52 NM 181306 CHST13 NM 152889 PROCA1 NM 152465 MRPL53 NM_053050 CHTOP NM_015607 PSMF1 NM_006814 MRPL54 NM 172251 CIART NM 144697 PSMF1 NM 178578 MRPL55 NM 181456 CIDEB NM 014430 PSMG3 NM 032302 MRPL57 NM_024026 CIDEC NM_001199623 PTGR1 NM_001146109 MRPL9 NM 031420 CLDN14 NM 001146077 PTK2 NM 001199649 MRPS10 NM_018141 CLDN17 NM_012131 PTPDC1 NM_001253830 MRPS11 NM 176805 CLDN8 NM 199328 PTPDC1 NM 177995 MRPS12 NM 021107 CLEC2L NM 001080511 PTPMT1 NM 001143984 MRPS12 NM 033362 CLIP3 NM 001199570 PTTG1IP NM 004339 MRPS14 NM 022100 CLIP3 NM 015526 PWP1 NM 007062 MRPS15 NM_031280 COL10A1 NM_000493 R3HDM1 NM_001282799 MRPS16 NM 016065 COL20A1 NM 020882 RAB43 NM 001204885 MRPS17 NM_015969 COL25A1 NM_001256074 RABEPK NM_001174153 MRPS18A NM 001193343 COL4A3 NM 000091 RABGAP1L NM 001035230 MRPS18B NM 014046 COMMD4 NM 017828 RABGAP1L NM 001243764 MRPS18C NM_016067 CORO2B NM_006091 RABGGTA NM_182836 MRPS2 NM 016034 COX10 NM 001303 RAD51AP2 NM 001099218 MRPS21 NM_018997 COX14 NM_001257134 RALGDS NM_001271774 MRPS22 NM 020191 CPLX3 NM 001030005 RALGDS NM 001271775 MRPS23 NM_016070 CPN2 NM_001080513 RASA2 NM_006506 MRPS24 NM 032014 CRB3 NM 174881 RASD2 NM 014310 MRPS25 NM_022497 CREG2 NM_153836 RASSF3 NM_178169 MRPS26 NM_030811 CREM NM 183012 RBBP8 NM 002894 MRPS27 NM_001286751 CSMD2 NM_052896 RBM24 NM_001143941 MRPS28 NM 014018 CST2 NM 001322 RBMXL2 NM 014469 MRPS30 NM 016640 CST4 NM 001899 RBPMS2 NM 194272 MRPS31 NM_005830 CSTF1 NM_001033521 RCAN2 NM_001251974 MRPS33 NM 053035 CTBP1 NM 001012614 RFC2 NM 002914 MRPS33 NM_016071 CXorf57 NM_018015 RFNG NM_002917 MRPS34 NM 023936 CYB5D2 NM 001254755 RHCG NM 016321 MRPS35 NM 001190864 CYB5RL NM 001031672 RHOH NM 001278369 MRPS36 NM 033281 DAAM2 NM 001201427 RIC8B NM 018157 MRPS5 NM 031902 DAAM2 NM 015345 RIIAD1 NM 001144956 MRPS6 NM_032476 DAB2IP NM_032552 RIMKLB NM_020734 MRPS7 NM 015971 DCN NM 001920 RINT1 NM 021930 MRPS9 NM_182640 DCP1A NM_001290204 RNF146 NM_001242851 POLR1A NM 015425 DCTN2 NM 001261413 RNF165 NM 152470 POLR1B NM 001282772 DDHD2 NM 001164234 RNF186 NM 019062 POLR1B NM_001282776 DDIT4L NM_145244 RNF213 NM_001256071 POLR1C NM 203290 DDX43 NM 018665 RNLS NM 018363 POLR1D NM_015972 DEFB127 NM_139074 RPA1 NM_002945 POLR1D NM 001206559 DKK2 NM 014421 RPL15 NM 001253384 POLR1E NM 001282766 DNAJB1 NM 006145 RPL6 NM 000970 POLR2A NM 000937 DNPEP NM 012100 RPLP1 NM 213725 POLR2B NM 000938 DPF1 NM 004647 RPN2 NM 001135771 POLR2C NM_032940 DPM3 NM_153741 RPS27A NM_001135592 POLR2D NM 004805 DSEL NM 032160 RPUSD4 NM 032795 POLR2E NM 002695 DUPD1 NM 001003892 RRP1B NM 015056 POLR2F NM 021974 DUT NM 001025249 RXRA NM 002957 POLR2G NM 002696 DUT NM 001948 RXRG NM 001256571 POLR2H NM_001278715 ECHDC1 NM_018479 SAMD1 NM_138352 POLR2H NM 001278700 EFHC1 NM 001172420 SAMD3 NM 001258275 POLR2I NM_006233 EFHC1 NM_018100 SATB1 NM_001195470 POLR2J NM 006234 EFHD1 NM 025202 SBSN NM 001166034 POLR2J2 NM 032959 EFNA1 NM 004428 SCP2D1 NM 178483 POLR2J3 NM_001097615 EIF2B3 NM_001261418 SCRN1 NM_001145514 POLR2K NM 005034 EIF4G3 NM 003760 SDC2 NM 002998 POLR2L NM_021128 EMX2 NM_001165924 SEMA3E NM_001178129 POLR2M NM 015532 EN1 NM 001426 SEPN1 NM 020451 POLR3A NM 007055 ENHO NM 198573 SEPTIN9 NM 001113491 POLR3B NM 001160708 ENO2 NM 001975 SERF2 NM 001199876 POLR3B NM 018082 ENPP3 NM 005021 SERF2 NM 001199877 POLR3C NM_006468 ERCC6-PGBD3 NM_001277059 SERF2 NM_001199878 POLR3D NM 001722 ESRRG NM 001134285 SERPINB1 NM 030666 POLR3E NM_001258034 ESX1 NM_153448 SETD4 NM_001007261 POLR3F NM 001282526 EXOSC9 NM 005033 SETDB2 NM 001160308 POLR3G NM 006467 FAHD2B NM 199336 SETDB2 NM 031915 POLR3GL NM_032305 FAM118A NM_017911 SFMBT2 NM_001018039 POLR3H NM 001282884 FAM153A NM 173663 SFMBT2 NM 001029880 POLR3H NM_001018052 FAM222A NM_032829 SFTPC NM_001172410 POLR3K NM 016310 FAM58A NM 001130997 SGCB NM 000232 POLRMT NM 005035 FAM84A NM 145175 SH3TC1 NM 018986 RPL10 NM_001256577 FANCA NM_001286167 SHD NM_020209 RPL10A NM 007104 FASTKD2 NM 014929 SHE NM 001010846 RPL10L NM_080746 FBXL12 NM_017703 SHROOM3 NM_020859 RPL11 NM 001199802 FGF14 NM 004115 SLC12A6 NM 001042497 RPL12 NM 000976 FLCN NM 144997 SLC25A23 NM 024103 RPL13 NM 001243130 FLOT2 NM 004475 SLC2A8 NM 014580 RPL13 NM 033251 FLVCR2 NM 001195283 SLC35F3 NM 173508 RPL13A NM_012423 FNDC8 NM_017559 SLC4A2 NM_001199692 RPL14 NM 001034996 FRAT2 NM 012083 SLC7A13 NM 138817 RPL14 NM_003973 FSCN3 NM_020369 SLC9A1 NM_003047 RPL15 NM 001253380 FSD1 NM 024333 SLMO1 NM 006553 RPL15 NM 001253384 FUK NM 145059 SMARCAD1 NM 001254949 RPL15 NM_001253382 FUOM NM_198472 SMIM13 NM_001135575 RPL15 NM 001253383 FURIN NM 001289824 SOCS2 NM 001270468 RPL17 NM_001199340 FUT10 NM_032664 SOCS2 NM_003877 RPL17 NM 001199342 FUT6 NM 000150 SPEG NM 001173476 RPL17- NM_001199355 FXYD3 NM_005971 SPOCK3 NM_016950 C18orf32 RPL18 NM 000979 GABARAP NM 007278 SPTBN1 NM 003128 RPL18A NM_000980 GABBR1 NM_021904 SPTBN1 NM_178313 RPL19 NM 000981 GABRB3 NM 001191321 SRC NM 198291 RPL21 NM_000982 GABRR1 NM_001256704 SSX7 NM_173358 RPL22 NM 000983 GABRR1 NM 001267582 STAMBP NM 006463 RPL22L1 NM 001099645 GALK2 NM 001001556 STEAP2 NM 001040666 RPL23 NM_000978 GALK2 NM_002044 STEAP2 NM_001244946 RPL23A NM 000984 GATA2 NM 001145662 STK40 NM 032017 RPL24 NM_000986 GATA2 NM_032638 STRN3 NM_001083893 RPL26 NM 000987 GGN NM 152657 SULT2B1 NM 177973 RPL26L1 NM 016093 GHR NM 001242406 SUSD1 NM 022486 RPL27 NM 000988 GNAL NM 001142339 SUV39H1 NM 003173 RPL27A NM 000990 GNG13 NM 016541 SYAP1 NM 032796 RPL28 NM_000991 GNGT1 NM_021955 TAF1A NM_001201536 RPL29 NM 000992 GOLM1 NM 016548 TAPBPL NM 018009 RPL3 NM_000967 GPKOW NM_015698 TCF4 NM_001243233 RPL30 NM 000989 GPR119 NM 178471 TDO2 NM 005651 RPL31 NM 001098577 GPR87 NM 023915 TEAD4 NM 003213 RPL32 NM_000994 GPRASP2 NM_001184876 TEAD4 NM_201443 RPL32 NM 001007074 GPX6 NM 182701 TERF2IP NM 018975 RPL34 NM_033625 GRIP1 NM_001178074 TERT NM_198253 RPL34 NM 000995 GSTO2 NM 001191014 TGFBR2 NM 003242 RPL35 NM 007209 GUCY1A3 NM 001130684 TIFA NM 052864 RPL35A NM 000996 HAUS4 NM 001166269 TLE2 NM 001144761 RPL36 NM 015414 HBZ NM 005332 TLE3 NM 020908 RPL36 NM_033643 HES1 NM_005524 TMEM125 NM_144626 RPL36A- NM 001199973 HGD NM 000187 TMEM141 NM 032928 HNRNPH2 RPL36AL NM_001001 HHATL NM_020707 TMEM147 NM_032635 RPL37 NM 000997 HIST1H2BB NM 021062 TMEM164 NM 017698 RPL37A NM_000998 HMGB2 NM_001130689 TMEM170B NM_001100829 RPL38 NM 000999 HMMR NM 012484 TMEM201 NM 001010866 RPL39 NM 001000 HOOK1 NM 015888 TMEM223 NM 001080501 RPL39L NM 052969 HOXB6 NM 018952 TMEM25 NM 032780 RPL3L NM 005061 HRH2 NM 022304 TMEM5 NM 014254 RPL4 NM_000968 HRNR NM_001009931 TMEM53 NM_024587 RPL41 NM 001035267 HYPK NM 016400 TMEM56 NM 001199679 RPL5 NM_000969 IARS2 NM_018060 TMEM56 NM_152487 RPL6 NM 000970 IFI27L2 NM 032036 TMEM92 NM 153229 RPL7 NM 000971 IFNA7 NM 021057 TMPRSS5 NM 030770 RPL7A NM_000972 IFNAR1 NM_000629 TMX1 NM_030755 RPL7L1 NM 198486 IL15RA NM 001243539 TNIP2 NM 001161527 RPL8 NM_000973 IL18RAP NM_003853 TNIP2 NM_024309 RPL8 NM 033301 IL1A NM 000575 TNIP3 NM 024873 RPL9 NM 001024921 INA NM 032727 TNPO2 NM 001136195 RPL9 NM 000661 INO80 NM 017553 TNS3 NM 022748 RPLP0 NM 001002 INTS10 NM 018142 TPTE2 NM 001271850 RPLP1 NM_213725 INTS3 NM_023015 TREH NM_007180 RPLP2 NM 001004 IPO7 NM 006391 TRIM39 NM 021253 RPS10 NM_001203245 IQGAP2 NM_001285460 TRIM7 NM_203293 RPS10- NM 001202470 IRF5 NM 032643 TSHR NM 000369 NUDT3 RPS11 NM 001015 ISLR NM 201526 TSPAN5 NM 005723 RPS12 NM_001016 ISOC1 NM_016048 TSSK6 NM_032037 RPS13 NM 001017 ITLN1 NM 017625 TSTD3 NM 001195131 RPS14 NM_005617 JMJD7-PLA2G4B NM_005090 TTC37 NM_014639 RPS15 NM 001018 JUNB NM 002229 TULP2 NM 003323 RPS15A NM 001019 KCNF1 NM 002236 UBA5 NM 024818 RPS16 NM_001020 KCNH6 NM_173092 UBA5 NM_198329 RPS17 NM 001021 KCNQ2 NM 004518 UBASH3A NM 018961 RPS17L NM_001199057 KHNYN NM_015299 UBE2J1 NM_016021 RPS18 NM 022551 KIAA1456 NM 001099677 UGT1A9 NM 021027 RPS19 NM 001022 KIAA1456 NM 020844 UHRF1 NM 001290050 RPS19BP1 NM 194326 KIAA1462 NM 020848 UHRF1 NM 001290051 RPS2 NM 002952 KLHL2 NM 007246 URGCP-MRPS24 NM 001204871 RPS20 NM_001146227 KLK14 NM_022046 VCPIP1 NM_025054 RPS21 NM 001024 KLK9 NM 012315 VEPH1 NM 024621 RPS23 NM_001025 KLRC1 NM_002259 VGLL2 NM_153453 RPS24 NM 033022 KRAS NM 004985 VPS37A NM 001145152 RPS25 NM 001028 KRBA1 NM 001290187 VPS9D1 NM 004913 RPS26 NM 001029 KRT14 NM 000526 WARS2 NM 015836 RPS27 NM_001030 KRT17 NM_000422 WDR76 NM_001167941 RPS27A NM 001177413 KRT31 NM 002277 WRAP53 NM 001143991 RPS27A NM_002954 KRTAP20-2 NM_181616 XRCC6 NM_001469 RPS27A NM 001135592 KRTAP20-3 NM 001128077 XRN1 NM 019001 RPS27L NM 015920 KRTAP5-6 NM 001012416 YEATS4 NM 006530 RPS28 NM_001031 L3MBTL1 NM_032107 YTHDF3 NM_001277817 RPS29 NM 001030001 LARP1B NM 018078 YTHDF3 NM 001277818 RPS3 NM_001005 LDHB NM_002300 YY1AP1 NM_001198902 RPS3A NM 001006 LIFR NM 002310 YY1AP1 NM 018253 RPS4X NM 001007 LINGO4 NM 001004432 ZBTB10 NM 001277145 RPS4Y1 NM 001008 LMBRD2 NM 001007527 ZC3H6 NM 198581 RPS4Y2 NM 001039567 LMNA NM 001257374 ZFP41 NM 001271156 RPS5 NM_001009 LMO7 NM_005358 ZFP91 NM_053023 RPS6 NM 001010 LMX1B NM 001174147 ZFX NM 001178086 RPS6KA1 NM_001006665 LOC100131094 NM_001242901 ZMYM4 NM_005095 RPS6KA1 NM 002953 LOC100131303 NM 001282442 ZNF14 NM 021030 RPS6KA2 NM 021135 LRRC69 NM 001129890 ZNF182 NM 006962 RPS6KA2 NM_001006932 LRRFIP2 NM_006309 ZNF267 NM_003414 RPS6KA3 NM 004586 LSM4 NM 012321 ZNF30 NM 194325 RPS6KA4 NM_003942 LSMEM1 NM_182597 ZNF302 NM_001289191 RPS6KA5 NM 004755 LSP1 NM 001013253 ZNF471 NM 020813 RPS6KA6 NM 014496 LSP1 NM 001289005 ZNF486 NM 052852 RPS6KB1 NM 003161 LYG2 NM 175735 ZNF497 NM 001207009 RPS6KB2 NM 003952 LYVE1 NM 006691 ZNF560 NM 152476 RPS6KC1 NM_001136138 MACROD1 NM_014067 ZNF576 NM_024327 RPS6KL1 NM 031464 MACROD2 NM 080676 ZNF653 NM 138783 RPS7 NM 001011 MAGEA4 NM 001011549 ZNF710 NM 198526 RPS8 NM 001012 MAGEA4 NM 001011550 ZNF728 NM 001267716 RPS9 NM 001013 MAGEB17 NM 001277307 ZNF766 NM 001010851 RPSA NM_002295 MANEA NM_024641 ZNF81 NM_007137 RPSA NM 001012321 MAP3K7CL NM 001286624 ZNF827 NM 178835 MAP3K7CL NM_001286634

    TABLE-US-00005 TABLE 3A FDR of the CRISPRa acute screening results. Gene targets are in ranked order. Gene names, RefSeq IDs, and estimated FDR using negative control genes (see Methods) for each of the top 1000 genes in the screening bioreps are listed. Acute no Acute Acute no Acute T cells T cells T cells T cells Gene id biorep 1 biorep 1 biorep 2 biorep 2 CYB5D2 NM_001254755 0.00000 0.00000 0.00000 0.00322 ISLR NM_201526 0.00322 0.00322 0.00000 0.00000 CD274 NM_014143 0.00000 0.00322 0.00643 0.00000 AHR NM_001621 0.00643 0.00965 0.00322 0.00322 WRAP53 NM_001143991 0.02251 0.00322 0.00322 0.00000 MCL1 NM_021960 0.00000 0.00643 0.00000 0.02251 MAGED2 NM_014599 0.00000 0.00965 0.01608 0.00965 KCNQ2 NM_004518 0.00000 0.01608 0.00000 0.02251 GNAL NM_001142339 0.03215 0.00965 0.00000 0.00000 MYBL1 NM_001144755 0.00000 0.03859 0.00000 0.00322 SCMH1 NM_001172222 0.00322 0.00965 0.01929 0.00965 C1R NM_001733 0.00322 0.00965 0.01929 0.00965 SDC2 NM_002998 0.01286 0.00643 0.02251 0.00322 ZBTB10 NM_001277145 0.00000 0.00965 0.00000 0.04180 CYP2S1 NM_030622 0.01286 0.00965 0.01929 0.00965 TBC1D9B NM_015043 0.00643 0.01608 0.01608 0.01608 SREK1IP1 NM_173829 0.00000 0.01286 0.04180 0.00322 JADE3 NM_001077445 0.00322 0.02894 0.01608 0.00965 KCTD18 NM_152387 0.01286 0.00965 0.03215 0.00322 LMNA NM_001257374 0.01286 0.04502 0.00000 0.00322 JMJD1C NM_001282948 0.00965 0.01608 0.00322 0.03215 EGR3 NM_004430 0.02572 0.01286 0.00643 0.01608 RPS7 NM_001011 0.00965 0.00322 0.02572 0.02894 STAG2 NM_001042749 0.01286 0.02251 0.01929 0.01286 JUNB NM_002229 0.00000 0.00000 0.05788 0.00965 HIST3H2BB NM_175055 0.01286 0.02251 0.01286 0.01929 LGALS9C NM_001040078 0.00000 0.00643 0.01929 0.05466 C12orf73 NM_001135570 0.03215 0.03859 0.00000 0.00965 GRIP1 NM_001178074 0.00000 0.00322 0.06752 0.01608 COMMD4 NM_017828 0.06431 0.00965 0.00643 0.00643 TBX20 NM_001077653 0.02251 0.00965 0.01929 0.03537 CENPE NM_001813 0.02251 0.02894 0.02251 0.01608 MEIS2 NM_172315 0.00965 0.01286 0.07395 0.00965 HIST1H2BI NM_003525 0.00965 0.02572 0.03537 0.04180 TLE2 NM_001144761 0.02251 0.09003 0.00000 0.00000 DHX33 NM_001199699 0.05788 0.03859 0.01608 0.00000 RABEPK NM_001174153 0.05466 0.06431 0.00000 0.00000 RREB1 NM_001003699 0.00643 0.09003 0.00322 0.02251 COX14 NM_001257134 0.00000 0.00322 0.06752 0.05466 CGREF1 NM_001166241 0.00965 0.09003 0.00643 0.02251 MFSD12 NM_174983 0.04180 0.02251 0.02251 0.04180 TSPY1 NM_001197242 0.08360 0.04180 0.00322 0.00322 CXCL5 NM_002994 0.00000 0.00322 0.05466 0.07395 BCAR1 NM_001170719 0.06431 0.01286 0.02251 0.03215 IL34 NM_001172772 0.00965 0.01286 0.00643 0.10932 SYNCRIP NM_001159673 0.07717 0.00322 0.00000 0.05788 ANXA8 NM_001271702 0.03215 0.10611 0.00000 0.00000 DSC1 NM_004948 0.00000 0.04502 0.06752 0.02572 CDK19 NM_015076 0.00000 0.00643 0.10611 0.02572 SLC35G4 NM_001282300 0.00643 0.00965 0.07074 0.05466 LAMC3 NM_006059 0.04180 0.04180 0.00643 0.05145 FLNA NM_001110556 0.05145 0.04180 0.01608 0.03537 KIF21A NM_001173463 0.04180 0.08039 0.02251 0.00000 KCNK6 NM_004823 0.05788 0.00643 0.03215 0.04823 TCF23 NM_175769 0.00000 0.00965 0.13505 0.00322 CDO1 NM_001801 0.00000 0.00322 0.03215 0.11254 PRKACB NM_002731 0.06431 0.08039 0.00643 0.00000 STARD13 NM_178006 0.11576 0.02572 0.00643 0.00322 TMEM19 NM_018279 0.03859 0.03859 0.01929 0.05466 EPHA1 NM_005232 0.00965 0.00965 0.04180 0.09646 TMEM87B NM_032824 0.03859 0.09646 0.01286 0.00965 FLCN NM_144997 0.06109 0.09646 0.00000 0.00000 RABGGTA NM_182836 0.06109 0.08360 0.00643 0.00965 PPIC NM_000943 0.00322 0.00965 0.07074 0.07717 TRIM58 NM_015431 0.00965 0.09003 0.02251 0.04180 ZNF583 NM_152478 0.14148 0.02251 0.00000 0.00000 CSTB NM_000100 0.08039 0.05466 0.01608 0.01608 DCST2 NM_144622 0.03859 0.00965 0.10611 0.01286 BCL2L1 NM_001191 0.04180 0.03859 0.08682 0.00322 REG4 NM_001159352 0.08360 0.00965 0.00322 0.07395 RNF166 NM_001171816 0.03859 0.07074 0.00965 0.05466 RNLS NM_018363 0.02251 0.00965 0.11576 0.02572 ZBTB7B NM_001252406 0.06431 0.07395 0.01608 0.02251 RASA2 NM_006506 0.06431 0.02251 0.01608 0.07717 ST8SIA5 NM_013305 0.05466 0.08039 0.04180 0.00643 ACYP1 NM_001107 0.01286 0.00965 0.12862 0.03537 DUS4L NM_181581 0.00965 0.04502 0.04180 0.09003 NXNL1 NM_138454 0.07074 0.08360 0.00965 0.02251 PCNA NM_182649 0.00965 0.01286 0.06109 0.10289 TCTE3 NM_174910 0.05466 0.09646 0.00643 0.03215 C7orf76 NM_001201451 0.08360 0.08360 0.00322 0.02251 SYCE1 NM_001143764 0.00322 0.04823 0.09003 0.05466 PPP1R1B NM_032192 0.00965 0.00965 0.12219 0.05466 CSTF1 NM_001033522 0.06431 0.08039 0.04180 0.00965 RARRES3 NM_004585 0.04180 0.09325 0.05788 0.00322 SNX20 NM_001144972 0.04180 0.11576 0.03215 0.00965 NLRP2 NM_001174081 0.08360 0.02572 0.01608 0.07395 SLC1A1 NM_004170 0.03859 0.14791 0.00000 0.01286 AMZ1 NM_001284355 0.04180 0.08682 0.03215 0.04180 NACC1 NM_052876 0.09968 0.08360 0.00322 0.01608 SRBD1 NM_018079 0.05466 0.06752 0.01286 0.07074 METRN NM_024042 0.00000 0.00322 0.17685 0.02572 MYL4 NM_001002841 0.05145 0.09003 0.01608 0.05145 ERMP1 NM_024896 0.03215 0.04502 0.11576 0.01608 TBC1D2 NM_001267572 0.00643 0.06109 0.08682 0.05466 STK4 NM_006282 0.02572 0.02572 0.08039 0.07717 AKR1C1 NM_001353 0.02251 0.00965 0.15434 0.02572 PRICKLE1 NM_153026 0.01286 0.02894 0.11897 0.05466 NAV3 NM_014903 0.00322 0.03859 0.07395 0.09968 GNPDA2 NM_138335 0.14148 0.00965 0.05788 0.00643 ZNF281 NM_001281294 0.00965 0.00965 0.14791 0.05145 MYO15A NM_016239 0.14791 0.00965 0.00643 0.05466 FOXC1 NM_001453 0.04180 0.06431 0.08682 0.02572 GSTCD NM_024751 0.08360 0.05145 0.03215 0.05466 CATSPERB NM_024764 0.05466 0.06431 0.02894 0.07395 RAB27A NM_183234 0.06752 0.09968 0.01286 0.04180 ACVRL1 NM_001077401 0.01608 0.02572 0.01286 0.17042 LIPT1 NM_145198 0.08682 0.03859 0.08682 0.01286 MAGEA11 NM_005366 0.05145 0.08039 0.07074 0.02251 TYK2 NM_003331 0.03215 0.07395 0.02572 0.09325 HES1 NM_005524 0.00000 0.00965 0.11576 0.10289 TAAR2 NM_014626 0.03859 0.02251 0.07717 0.09003 YY1AP1 NM_001198903 0.06109 0.08039 0.08682 0.00322 TRIM39 NM_021253 0.10289 0.12540 0.00000 0.00322 C1QTNF9B- NM_001014442 0.02251 0.06752 0.06752 0.07395 AS1 UBA3 NM_003968 0.03859 0.02572 0.12862 0.04180 CPXCR1 NM_033048 0.02251 0.03859 0.01608 0.16077 C20orf197 NM_173644 0.08360 0.02572 0.02572 0.10289 ARNT NM_001668 0.11576 0.10932 0.01608 0.00000 PRKAG1 NM_002733 0.08360 0.13826 0.01608 0.00322 NOTCH2 NM_024408 0.09968 0.11576 0.01608 0.00965 ARMCX5 NM_001168480 0.14148 0.09325 0.00643 0.00322 SOCS2 NM_001270468 0.00965 0.02572 0.11897 0.09003 PHF21A NM_016621 0.14148 0.06431 0.02894 0.00965 SMIM13 NM_001135575 0.12219 0.06752 0.01608 0.04180 MRPL23 NM_021134 0.03215 0.05788 0.10611 0.05466 TRAF3 NM_001199427 0.03859 0.09003 0.01286 0.11254 SMIM12 NM_138428 0.07395 0.12540 0.04180 0.01286 HPSE2 NM_001166244 0.06752 0.09003 0.01929 0.07717 GOS2 NM_015714 0.06109 0.01608 0.07074 0.10932 OTOP1 NM_177998 0.08360 0.08360 0.01608 0.07717 OR4C11 NM_001004700 0.16399 0.06431 0.02251 0.00965 ZNF385B NM_001113398 0.10611 0.10289 0.01608 0.03537 PREPL NM_006036 0.08360 0.13826 0.02251 0.01608 UBE2NL NM_001012989 0.03859 0.05466 0.01929 0.15113 BCL6 NM_001706 0.04180 0.03215 0.02251 0.16720 HIST1H4J NM_021968 0.04180 0.02572 0.18006 0.01608 PROSC NM_007198 0.12540 0.11254 0.01608 0.01608 COL9A3 NM_001853 0.12540 0.10289 0.00643 0.03537 ZNF763 NM_001012753 0.13183 0.09325 0.00643 0.04180 DEFB127 NM_139074 0.11576 0.15756 0.00000 0.00000 ALS2CL NM_001190707 0.06431 0.08039 0.02894 0.09968 RPS3A NM_001006 0.05145 0.05466 0.01608 0.15434 CST4 NM_001899 0.00000 0.00322 0.25723 0.01608 DPP6 NM_001039350 0.06752 0.03215 0.00643 0.17042 CELF2 NM_001083591 0.03859 0.12540 0.02251 0.09003 KRT31 NM_002277 0.11576 0.15434 0.00322 0.00322 ATXNIL NM_001137675 0.16077 0.08360 0.01929 0.01608 CUZD1 NM_022034 0.13183 0.08360 0.02251 0.04180 SFMBT2 NM_001018039 0.10611 0.16720 0.00322 0.00322 FBXO9 NM_033481 0.09968 0.09968 0.01286 0.06752 RPS27A NM_001135592 0.10932 0.15113 0.00643 0.01608 ARL4A NM_001195396 0.09968 0.11576 0.04180 0.02572 TAF1 NM_001286074 0.08360 0.03859 0.01608 0.14791 SRSF9 NM_003769 0.12540 0.16077 0.00000 0.00000 GPBAR1 NM_170699 0.14148 0.00965 0.08682 0.04823 COLEC11 NM_001255988 0.14469 0.03859 0.06752 0.03537 TRIM64C NM_001206631 0.06752 0.00965 0.01608 0.19614 CXorf57 NM_018015 0.07717 0.09325 0.01608 0.10289 RECK NM_021111 0.05145 0.21865 0.01608 0.00322 HGD NM_000187 0.17685 0.08360 0.01929 0.00965 PRDM8 NM_020226 0.15434 0.10932 0.00322 0.02251 SMIM19 NM_138436 0.09646 0.00322 0.11576 0.07395 STK25 NM_001271978 0.00000 0.02572 0.18650 0.07717 KLHL25 NM_022480 0.19936 0.00965 0.06752 0.01608 CYP1A2 NM_000761 0.12540 0.09003 0.00643 0.07074 TMEM116 NM_001193453 0.16399 0.12219 0.00322 0.00322 DEFA3 NM_005217 0.08682 0.06431 0.08682 0.05466 ACOT6 NM_001037162 0.13826 0.15434 0.00000 0.00000 PPFIBP2 NM_003621 0.03215 0.02894 0.03215 0.19936 COMMD1 NM_152516 0.04180 0.03215 0.14148 0.07717 AVEN NM_020371 0.01286 0.08360 0.14469 0.05466 MBD3L3 NM_001164425 0.01286 0.02572 0.08682 0.17042 MGAT5 NM_002410 0.07395 0.08039 0.06752 0.07395 ZNF675 NM_138330 0.14469 0.07074 0.03215 0.04823 BBS5 NM_152384 0.03215 0.04180 0.07074 0.15113 LIN54 NM_001115007 0.16399 0.08360 0.01608 0.03537 F8 NM_000132 0.14148 0.08039 0.04180 0.03537 C18orf21 NM_001201476 0.00000 0.00965 0.25723 0.03215 CDC20 NM_001255 0.15113 0.14791 0.00000 0.00000 PRAF2 NM_007213 0.10289 0.09325 0.02251 0.08039 ZFP62 NM_152283 0.07395 0.13826 0.03215 0.05466 TSEN34 NM_001282333 0.16077 0.08360 0.01608 0.04180 FRAT2 NM_012083 0.01286 0.00643 0.08682 0.19614 FAM78A NM_033387 0.14148 0.08360 0.02251 0.05466 P2RX5 NM_001204519 0.16077 0.13826 0.00000 0.00322 GPHN NM_020806 0.03859 0.06752 0.00643 0.18971 LSMEM2 NM_153215 0.08682 0.03215 0.09325 0.09325 TCEAL2 NM_080390 0.06109 0.01608 0.06752 0.16077 PFKFB2 NM_006212 0.12219 0.08360 0.02251 0.07717 GPT2 NM_001142466 0.10289 0.15113 0.01286 0.04180 SPATA31A6 NM_001145196 0.00965 0.21543 0.01608 0.06752 COMTD1 NM_144589 0.03215 0.08360 0.02251 0.17042 MAP3K13 NM_001242317 0.07395 0.08360 0.09968 0.05466 EIF1AD NM_001242484 0.05466 0.06431 0.08360 0.10932 JADE3 NM_014735 0.19936 0.03859 0.03215 0.04180 TMX1 NM_030755 0.00000 0.00322 0.08360 0.22508 MYO1B NM_001161819 0.03215 0.03859 0.11897 0.12219 FBXO42 NM_018994 0.16399 0.11576 0.01929 0.01608 TBX21 NM_013351 0.10289 0.01286 0.05788 0.14148 LINC01272 NM_001278655 0.00965 0.02251 0.16077 0.12540 TMEM256 NM_152766 0.11897 0.11576 0.06752 0.01608 HTR6 NM_000871 0.09968 0.09646 0.08682 0.03537 ZNF667 NM_022103 0.11576 0.07395 0.06752 0.06109 PCDHA12 NM_018903 0.00965 0.00965 0.17042 0.13183 LNX2 NM_153371 0.09003 0.04502 0.01929 0.16720 KRTAP10-2 NM_198693 0.04180 0.08360 0.01608 0.18006 SLC16A11 NM_153357 0.17685 0.13826 0.00322 0.00322 C18orf8 NM_001276342 0.23151 0.05466 0.02251 0.01608 FKBP2 NM_004470 0.12540 0.11576 0.01608 0.06752 TES NM_152829 0.12219 0.15434 0.00643 0.04180 POC5 NM_001099271 0.10289 0.10932 0.08682 0.02572 ANO3 NM_031418 0.09968 0.03215 0.04180 0.15113 ARSF NM_001201538 0.20900 0.09003 0.01929 0.00965 ALKBH6 NM_032878 0.06752 0.05466 0.20257 0.00322 SHROOM2 NM_001649 0.01286 0.01286 0.27010 0.03215 PHF1 NM_002636 0.06752 0.16077 0.06431 0.03537 TCEAL4 NM_024863 0.19614 0.08682 0.02251 0.02251 PABPC4L NM_001114734 0.03215 0.02251 0.09646 0.17685 SNX27 NM_030918 0.11576 0.03215 0.01608 0.16720 HAPLN4 NM_023002 0.24759 0.01929 0.03215 0.03215 KCNQ5 NM_001160130 0.09968 0.09003 0.07074 0.07395 INTS10 NM_018142 0.00000 0.00965 0.07395 0.25080 TMEM234 NM_019118 0.14148 0.07395 0.04180 0.07717 RORC NM_005060 0.11576 0.14469 0.04180 0.03215 MSH6 NM_001281494 0.01286 0.00965 0.23473 0.08039 IMP3 NM_018285 0.08360 0.04502 0.01608 0.19293 OR7A5 NM_017506 0.00000 0.00965 0.07395 0.25402 SLC35C1 NM_018389 0.06752 0.08360 0.10932 0.07717 ATAD3B NM_031921 0.04180 0.07395 0.08360 0.13826 AMPD1 NM_000036 0.10289 0.10289 0.08039 0.05145 UBE2J1 NM_016021 0.08360 0.24116 0.00643 0.00965 GUCY1A3 NM_001130684 0.01608 0.03859 0.15756 0.12862 SLFNL1 NM_001168247 0.15756 0.11576 0.01286 0.05466 FAM115A NM_001206938 0.01286 0.00965 0.08682 0.23151 OR9Q1 NM_001005212 0.14148 0.16077 0.02251 0.01608 C1orf27 NM_001164246 0.03859 0.05466 0.12862 0.12219 SLC4A8 NM_001258403 0.00965 0.03859 0.12540 0.17042 ATF7IP NM_018179 0.05145 0.15756 0.02572 0.11254 MAP2K2 NM_030662 0.12540 0.00965 0.18971 0.02251 DNASE1L1 NM_006730 0.09968 0.11897 0.08682 0.04180 LYVE1 NM_006691 0.20900 0.12540 0.00643 0.00965 MTHFD2 NM_006636 0.08360 0.18328 0.01608 0.06752 PDF NM_022341 0.01608 0.00965 0.01929 0.30547 KDELC1 NM_024089 0.16077 0.09003 0.09646 0.00322 MBD3L2 NM_144614 0.00322 0.00965 0.10611 0.23151 EPHA6 NM_001278300 0.06431 0.11576 0.12862 0.04180 BCL7B NM_001707 0.00643 0.08039 0.01929 0.24437 SLFNL1 NM_144990 0.04180 0.11897 0.02251 0.16720 ZNF664- NM_001204299 0.14148 0.10289 0.09325 0.01608 FAM101A MASP2 NM_006610 0.16399 0.09003 0.03215 0.06752 UNKL NM_001276414 0.11576 0.08360 0.01608 0.13826 SEPP1 NM_005410 0.10289 0.10289 0.09325 0.05466 CHERP NM_006387 0.12540 0.09003 0.02572 0.11254 ITM2C NM_030926 0.00000 0.00322 0.08360 0.26688 MARVELD3 NM_052858 0.16077 0.07395 0.08360 0.03537 SH2D1B NM_053282 0.09003 0.02572 0.09003 0.14791 ISLR2 NM_001130137 0.04180 0.02572 0.03215 0.25402 OPRK1 NM_000912 0.06109 0.12540 0.02894 0.13826 PIP5K1C NM_012398 0.11576 0.06431 0.02251 0.15113 UBAC2 NM_001144072 0.16077 0.07395 0.07395 0.04823 BCAT1 NM_001178093 0.16077 0.15113 0.04180 0.00322 BAHD1 NM_014952 0.16077 0.15756 0.02251 0.01608 MTA2 NM_004739 0.19614 0.10611 0.02572 0.02894 ASL NM_001024943 0.20900 0.09325 0.05466 0.00322 CERKL NM_001160277 0.16077 0.10932 0.04180 0.04823 MFNG NM_001166343 0.04180 0.00965 0.08682 0.22186 NGFR NM_002507 0.10289 0.08039 0.01608 0.16077 ZKSCAN3 NM_024493 0.03215 0.02572 0.20900 0.09325 CDKNIA NM_001220778 0.03215 0.02572 0.05788 0.24437 HYAL4 NM_012269 0.05145 0.02894 0.02251 0.25723 OLFM1 NM_001282612 0.27653 0.02572 0.01286 0.04823 CDK16 NM_033018 0.03859 0.10611 0.20257 0.01608 CACNB2 NM_201596 0.15434 0.09003 0.01608 0.10289 ZSCAN26 NM_152736 0.00965 0.04180 0.02251 0.28939 DEFB130 NM_001037804 0.08360 0.00965 0.22186 0.05145 CORO6 NM_032854 0.23473 0.12540 0.00322 0.00322 CETN2 NM_004344 0.15113 0.16077 0.01608 0.04180 CXCL1 NM_001511 0.11576 0.24437 0.00643 0.00322 SATB2 NM_015265 0.13183 0.19614 0.01608 0.02572 CORO1B NM_020441 0.18971 0.16077 0.00322 0.01608 OLIG1 NM_138983 0.16077 0.19614 0.00000 0.01286 SMPDL3B NM_001009568 0.03215 0.04180 0.01608 0.27974 KCNQ3 NM_004519 0.04180 0.03859 0.09325 0.19614 TMEM261 NM_033428 0.04180 0.05466 0.19614 0.07717 PANK1 NM_138316 0.05145 0.04823 0.02251 0.24759 SMC4 NM_001288753 0.03859 0.06109 0.06431 0.20579 PLEKHF1 NM_024310 0.04180 0.00965 0.08682 0.23473 ZAN NM_003386 0.23151 0.13183 0.00643 0.00643 ZNF214 NM_013249 0.16077 0.16077 0.01608 0.03859 TBL1X NM_001139467 0.04180 0.05466 0.16720 0.11254 CFC1 NM_032545 0.16077 0.18650 0.01608 0.01286 STAT3 NM_213662 0.08360 0.10611 0.01608 0.17042 PWWP2B NM_138499 0.10289 0.22508 0.00643 0.04180 TAL2 NM_005421 0.04180 0.10611 0.17363 0.05466 NLRC4 NM_021209 0.06109 0.19936 0.07395 0.04180 LPPR5 NM_001037317 0.11576 0.23151 0.01608 0.01608 DNAH14 NM_144989 0.04180 0.05466 0.15113 0.13183 ST6GALNAC2 NM_006456 0.02894 0.21543 0.11897 0.01608 ANXA2 NM_001136015 0.04180 0.00322 0.14148 0.19293 C11orf70 NM_001195005 0.10289 0.02251 0.08682 0.16720 RING1 NM_002931 0.21865 0.12219 0.00322 0.03537 NOV NM_002514 0.17363 0.09646 0.06752 0.04180 ZMYM4 NM_005095 0.02251 0.03859 0.09646 0.22186 FUT6 NM_000150 0.14148 0.24116 0.00000 0.00000 C15orf41 NM_001130010 0.11576 0.09003 0.09646 0.08039 ARPC4 NM_001024960 0.14148 0.01286 0.09003 0.13826 PQBP1 NM_001167990 0.11576 0.12540 0.10611 0.03537 URB1 NM_014825 0.06109 0.09003 0.20579 0.02572 LHX9 NM_020204 0.00322 0.06431 0.08360 0.23151 CASKIN2 NM_001142643 0.07717 0.09325 0.08360 0.13183 HSF1 NM_005526 0.08360 0.19936 0.03215 0.07074 CBL NM_005188 0.11576 0.21543 0.02251 0.03215 SPTBN1 NM_003128 0.08360 0.00322 0.23473 0.07074 DPP6 NM_001290253 0.16399 0.06431 0.08682 0.07717 CTRL NM_001907 0.09003 0.15113 0.05788 0.09325 SMAD4 NM_005359 0.24759 0.10611 0.00000 0.03859 COQ2 NM_015697 0.05145 0.03859 0.20257 0.09968 BIN3 NM_018688 0.11576 0.27010 0.00322 0.00322 LMOD1 NM_012134 0.18650 0.15113 0.01929 0.03537 H2AFY2 NM_018649 0.14469 0.11576 0.09325 0.04180 FAM175A NM_139076 0.09003 0.07395 0.07074 0.16077 ANKRD66 NM_001162435 0.11576 0.03859 0.05788 0.18650 HEY2 NM_012259 0.18328 0.14469 0.01929 0.05145 SNCA NM_000345 0.11897 0.08360 0.10932 0.09003 RNF121 NM_018320 0.17042 0.21543 0.01286 0.00322 SLC45A3 NM_033102 0.19936 0.13826 0.02251 0.04180 MNAT1 NM_002431 0.10289 0.02572 0.03215 0.24116 HNRNPCL1 NM_001013631 0.16077 0.00322 0.15113 0.09003 UQCRHL NM_001089591 0.07074 0.09325 0.03215 0.20900 C9orf50 NM_199350 0.00643 0.01608 0.12540 0.25723 AMMECR1L NM_031445 0.08360 0.23151 0.01286 0.07717 PLEKHG5 NM_001042665 0.03859 0.02894 0.17685 0.16077 OR5R1 NM_001004744 0.04180 0.13826 0.15113 0.07395 TRHDE NM_013381 0.18328 0.21543 0.00322 0.00322 CHST5 NM_024533 0.17042 0.08360 0.08682 0.06752 TTC38 NM_017931 0.16077 0.17363 0.01929 0.05466 ZNF750 NM_024702 0.21543 0.12219 0.06109 0.00965 IMMP1L NM_144981 0.14148 0.15113 0.01608 0.09968 MAPKAPK3 NM_004635 0.06109 0.18006 0.09003 0.07717 COL4A5 NM_000495 0.08360 0.09325 0.16077 0.07395 NMU NM_006681 0.11576 0.24759 0.01608 0.03215 SERPINB12 NM_080474 0.19293 0.16077 0.02251 0.03537 CHMP1A NM_001083314 0.00000 0.00322 0.13826 0.27010 USP5 NM_001098536 0.20900 0.13505 0.04180 0.02572 TDRD3 NM_001146070 0.11576 0.21543 0.01286 0.06752 CAPG NM_001256139 0.08039 0.13826 0.17042 0.02251 RARRES2 NM_002889 0.19936 0.17363 0.02251 0.01608 ECI2 NM_006117 0.10289 0.21543 0.08360 0.00965 ELAC2 NM_001165962 0.26045 0.09003 0.01929 0.04180 COL11A1 NM_001190709 0.14469 0.09003 0.16720 0.01286 CASC1 NM_001204102 0.16077 0.13183 0.08682 0.03537 SOS1 NM_005633 0.11576 0.09003 0.04180 0.16720 PNLIPRP1 NM_006229 0.00000 0.00322 0.12862 0.28296 GABARAPL2 NM_007285 0.18650 0.09003 0.12219 0.01608 KIAA1217 NM_001098500 0.23794 0.09968 0.03537 0.04180 XRCC6BP1 NM_033276 0.04180 0.02572 0.27331 0.07395 DMPK NM_001081563 0.29582 0.02572 0.05788 0.03537 AMER3 NM_001105193 0.24759 0.16077 0.00322 0.00643 TMEM95 NM_198154 0.19614 0.17042 0.01608 0.03537 KCNIP4 NM_001035004 0.06109 0.18328 0.07074 0.10289 NXPE3 NM_001134456 0.27653 0.08360 0.00643 0.05466 CLN6 NM_017882 0.15434 0.09003 0.01286 0.16399 MAGEE1 NM_020932 0.00965 0.04180 0.11897 0.25080 BCAS1 NM_003657 0.03859 0.08682 0.25723 0.04180 IFNA7 NM_021057 0.00000 0.00322 0.15113 0.27010 ZNF395 NM_018660 0.09968 0.00322 0.27010 0.05145 PTGES3 NM_006601 0.09968 0.15756 0.12862 0.04180 SEPTIN1 NM_052838 0.09003 0.25080 0.07074 0.01608 FAM195B NM_001288799 0.01608 0.08039 0.02572 0.30547 MAZ NM_002383 0.11576 0.09325 0.08039 0.13826 ALS2 NM_020919 0.02251 0.00965 0.30868 0.08682 SEBOX NM_001080837 0.02251 0.02572 0.36977 0.00965 GON4L NM_001282856 0.20900 0.08360 0.08360 0.05466 CXorf23 NM_198279 0.16077 0.17042 0.08682 0.01286 CNTNAP3B NM_001201380 0.12219 0.04502 0.06752 0.19614 HIST1H4F NM_003540 0.19936 0.21543 0.00000 0.01608 NKG7 NM_005601 0.03215 0.03859 0.28617 0.07395 EXOC5 NM_006544 0.03215 0.09003 0.14791 0.16077 PACRG NM_001080378 0.16720 0.10289 0.08360 0.07717 SIPA1L1 NM_001284245 0.14469 0.15434 0.08360 0.04823 NUS1 NM_138459 0.16077 0.09003 0.04180 0.13826 SETD1A NM_014712 0.14791 0.23473 0.04180 0.00965 NACAD NM_001146334 0.32476 0.09646 0.00322 0.00965 OSGIN2 NM_004337 0.11576 0.12540 0.11576 0.07717 PAICS NM_006452 0.20579 0.02572 0.01286 0.18971 TOR1A NM_000113 0.19936 0.12219 0.01929 0.09325 TLE3 NM_020908 0.18650 0.09325 0.04180 0.11254 C16orf93 NM_001014979 0.06752 0.00965 0.11254 0.24759 KLF7 NM_001270942 0.03859 0.00965 0.18006 0.20900 BTBD7 NM_001289133 0.09003 0.09003 0.07074 0.18650 FBXW12 NM_207102 0.17363 0.16720 0.08682 0.00965 CEACAM1 NM_001024912 0.09968 0.07395 0.07074 0.19293 PTRH2 NM_016077 0.10289 0.07395 0.23473 0.02572 KLK7 NM_005046 0.25080 0.15434 0.02251 0.00965 MAML1 NM_014757 0.07395 0.02251 0.11897 0.22186 ARID1B NM_020732 0.11576 0.28939 0.02251 0.00965 SPP2 NM_006944 0.14469 0.12862 0.12540 0.04180 PHACTR4 NM_023923 0.00965 0.00322 0.17042 0.25723 ASB2 NM_001202429 0.14148 0.08039 0.18650 0.03215 HIST1H2BH NM_003524 0.06109 0.08360 0.26367 0.03215 KRTAP26-1 NM_203405 0.02251 0.03859 0.09003 0.28939 CAMKK2 NM_172226 0.11576 0.09003 0.22830 0.00965 NGLY1 NM_001145294 0.11576 0.15113 0.07395 0.10289 MLPH NM_001281473 0.00965 0.02572 0.30547 0.10289 HDLBP NM_005336 0.10289 0.13826 0.16720 0.03537 SEC22A NM_012430 0.27010 0.09968 0.03215 0.04180 MRPS7 NM_015971 0.23151 0.14469 0.04502 0.02251 CCDC116 NM_152612 0.02251 0.02894 0.02251 0.36977 TBC1D4 NM_014832 0.16077 0.15756 0.07395 0.05466 NKX2-1 NM_001079668 0.08682 0.08360 0.00643 0.27010 ANKRD37 NM_181726 0.04823 0.07074 0.09646 0.23151 OR2Z1 NM_001004699 0.13505 0.11576 0.09325 0.10289 MAPK1 NM_002745 0.06431 0.06431 0.21865 0.09968 PRMT8 NM_001256536 0.14148 0.20900 0.04502 0.05466 PDE1B NM_001165975 0.16077 0.16720 0.02251 0.09968 CCNC NM_005190 0.14148 0.17363 0.09325 0.04180 PM20D2 NM_001010853 0.00965 0.08360 0.01929 0.33762 ATP1A1 NM_001160233 0.04180 0.02894 0.30868 0.07074 HMCES NM_020187 0.23794 0.16077 0.03215 0.01929 C8orf76 NM_032847 0.31190 0.13826 0.00000 0.00000 TBC1D10C NM_198517 0.10289 0.09646 0.21543 0.03537 FAM65C NM_080829 0.01286 0.09003 0.12862 0.22186 PCOLCE2 NM_013363 0.04180 0.10289 0.14148 0.16720 TMEM213 NM_001085429 0.16720 0.23151 0.01929 0.03537 LRRC29 NM_001004055 0.24759 0.18971 0.00322 0.01608 EML2 NM_001193269 0.05466 0.08360 0.14791 0.17042 MUC22 NM_001198815 0.02251 0.09003 0.02251 0.32154 NTF3 NM_001102654 0.19614 0.09968 0.02251 0.13826 PCGF5 NM_032373 0.11897 0.09003 0.08039 0.17042 DNAJA4 NM_001130183 0.16720 0.20257 0.08682 0.00322 CTSK NM_000396 0.09968 0.09003 0.08682 0.18328 PAX6 NM_001258463 0.18650 0.12540 0.04180 0.10611 ACADVL NM_001270447 0.23473 0.15434 0.02251 0.04823 LOC100131303 NM_001282442 0.00000 0.00322 0.08682 0.36977 FUT4 NM_002033 0.03859 0.03859 0.09003 0.29260 FBLIM1 NM_017556 0.03859 0.08360 0.02572 0.31190 MED31 NM_016060 0.04180 0.08360 0.17042 0.16720 BTN2A1 NM_001197234 0.07074 0.08360 0.10289 0.20579 HERC1 NM_003922 0.03215 0.07395 0.08682 0.27010 SLAIN2 NM_020846 0.14469 0.15756 0.11897 0.04180 ANP32E NM_001136479 0.02572 0.02251 0.16077 0.25402 PNPLA6 NM_001166111 0.14148 0.10932 0.17685 0.03537 CARD11 NM_032415 0.10289 0.08360 0.21222 0.06431 C1orf35 NM_024319 0.08039 0.09325 0.08360 0.20900 MYO1C NM_033375 0.00000 0.01286 0.17685 0.27653 CPNE9 NM_153635 0.05466 0.00965 0.06752 0.33441 ZNF354C NM_014594 0.06752 0.03859 0.27331 0.08682 SLITRK3 NM_014926 0.17042 0.28939 0.00322 0.00322 GNAI2 NM_002070 0.10289 0.21865 0.11576 0.02894 HOXB13 NM_006361 0.06109 0.02572 0.30225 0.07717 PRDM13 NM_021620 0.04180 0.02251 0.18006 0.22186 C16orf13 NM_032366 0.10289 0.15434 0.02251 0.18650 NFKBIE NM_004556 0.01608 0.42122 0.00000 0.03215 TMEM201 NM_001010866 0.11576 0.16077 0.10611 0.08682 FGF22 NM_020637 0.03859 0.11897 0.21865 0.09325 VNIR5 NM_173858 0.16077 0.03215 0.10932 0.16720 XRCC2 NM_005431 0.09003 0.06431 0.22830 0.08682 GBP4 NM_052941 0.01608 0.02572 0.25723 0.17042 VCX NM_013452 0.14148 0.12862 0.17685 0.02251 NTF4 NM_006179 0.11576 0.21543 0.08682 0.05466 SUMO2 NM_006937 0.09003 0.21543 0.08682 0.08039 ZFP28 NM_020828 0.00000 0.00322 0.38907 0.08039 BIRC5 NM_001168 0.10289 0.00965 0.17042 0.18971 TMUB2 NM_177441 0.14148 0.16077 0.07074 0.09968 N4BP2L2 NM_033111 0.06431 0.10611 0.07074 0.23151 OLFM1 NM_006334 0.23151 0.21865 0.01608 0.00965 FBLIM1 NM_001024216 0.09003 0.11576 0.04180 0.22830 DEGS1 NM_003676 0.12540 0.07395 0.20257 0.07395 GJB6 NM_006783 0.05466 0.07395 0.24437 0.10289 OR12D2 NM_013936 0.12540 0.22508 0.01286 0.11254 PBRM1 NM_018313 0.20579 0.21543 0.00000 0.05466 FSD1 NM_024333 0.26367 0.19936 0.01286 0.00000 GH2 NM_022556 0.16077 0.25080 0.02251 0.04180 CDKN2A NM_000077 0.25080 0.21543 0.00643 0.00322 TSTD1 NM_001113207 0.11576 0.04180 0.21865 0.09968 ACSL6 NM_001205251 0.16077 0.18328 0.02251 0.10932 HPR NM_020995 0.02251 0.09325 0.17685 0.18328 DEDD NM_001039712 0.29260 0.15756 0.01286 0.01608 FARS2 NM_006567 0.16399 0.11576 0.15756 0.04180 CLEC4E NM_014358 0.20579 0.21543 0.01608 0.04180 SMARCAD1 NM_001254949 0.01608 0.05466 0.11897 0.28939 NOTCH1 NM_017617 0.05466 0.19936 0.01929 0.20579 TMEM47 NM_031442 0.15434 0.08360 0.09325 0.14791 ATG3 NM_022488 0.26367 0.21543 0.00000 0,00000 ZFX NM_001178086 0.00000 0.00322 0.07074 0.40514 STAM NM_003473 0.13505 0.20257 0.03215 0.10932 C6orf223 NM_153246 0.06109 0.19293 0.01929 0.20579 ARHGAP29 NM_004815 0.08360 0.02251 0.06431 0.30868 PHF8 NM_001184898 0.08360 0.17042 0.09646 0.13183 SLC15A1 NM_005073 0.08360 0.16077 0.01608 0.22186 BAMBI NM_012342 0.11576 0.08360 0.11576 0.16720 NOP14 NM_003703 0.02251 0.03215 0.15756 0.27010 PHPT1 NM_001287343 0.04180 0.24116 0.18650 0.01608 SAMD3 NM_001258275 0.00643 0.01286 0.14148 0.32476 LILRB4 NM_001278427 0.03537 0.08360 0.19614 0.17042 LSM7 NM_016199 0.08039 0.20900 0.03537 0.16077 SLC2A6 NM_001145099 0.14469 0.13826 0.04180 0.16077 IQCJ-SCHIP1 NM_001197113 0.02251 0.02251 0.16077 0.27974 PHLPP2 NM_001289003 0.09968 0.11897 0.08682 0.18006 CELA2B NM_015849 0.00000 0.00322 0.06752 0.41479 MAFA NM_201589 0.29582 0.09968 0.01608 0.07395 RRM2 NM_001165931 0.13505 0.00965 0.22830 0.11254 LOC81691 NM_001199053 0.14148 0.09968 0.17685 0.06752 C1orf228 NM_001145636 0.16077 0.14791 0.05466 0.12540 C4orf26 NM_001257072 0.05145 0.24116 0.18650 0.00965 HOXC13 NM_017410 0.11576 0.09325 0.10932 0.17042 HIF3A NM_152794 0.01608 0.03215 0.17042 0.27010 CLEC12A NM_201623 0.07717 0.08039 0.17042 0.16077 RBFOX1 NM_001142333 0.19614 0.21543 0.04180 0.03537 MXRA8 NM_001282583 0.23794 0.08360 0.09968 0.06752 GATA1 NM_002049 0.14148 0.30868 0.02251 0.01608 WNT5B NM_030775 0.10289 0.16077 0.08682 0.13826 PDZD4 NM_032512 0.05788 0.01286 0.25080 0.16720 MAST3 NM_015016 0.07717 0.03859 0.18650 0.18650 SLC25A37 NM_016612 0.08360 0.13826 0.12862 0.13826 PRPF38A NM_032864 0.05466 0.04823 0.11576 0.27331 KIAA1549L NM_012194 0.16077 0.23794 0.02251 0.07074 SLC7A5 NM_003486 0.27010 0.19614 0.02251 0.00322 CUEDC2 NM_024040 0.27010 0.13826 0.00322 0.08039 HOXA4 NM_002141 0.18006 0.26688 0.01929 0.02572 YOD1 NM_018566 0.16077 0.17042 0.07074 0.09325 ANAPC11 NM_001002245 0.00643 0.00965 0.14148 0.33762 HOOK2 NM_001100176 0.18328 0.19293 0.07074 0.04823 MED14 NM_004229 0.13183 0.06431 0.26367 0.03537 ALDOA NM_001243177 0.36977 0.06752 0.02251 0.03537 BCKDHB NM_000056 0.18650 0.08360 0.04180 0.18650 TRPM3 NM_001007471 0.14469 0.13826 0.02251 0.19293 SLCO1B3 NM_019844 0.17042 0.20900 0.06752 0.05466 CCNA1 NM_001111047 0.15113 0.11576 0.06752 0.16720 LRP4 NM_002334 0.14148 0.21543 0.09325 0.05145 HAND2 NM_021973 0.10289 0.12540 0.06752 0.20579 C17orf100 NM_001105520 0.34405 0.08360 0.01929 0.05466 OR5K4 NM_001005517 0.10289 0.06431 0.06431 0.27010 CHCHD4 NM_001098502 0.05145 0.06431 0.12540 0.26367 PRR35 NM_145270 0.16077 0.18971 0.12862 0.02572 ODF3L2 NM_182577 0.10289 0.11576 0.07717 0.20900 UTP6 NM_018428 0.11576 0.23151 0.08682 0.07074 MAGEC3 NM_138702 0.14148 0.10611 0.09646 0.16077 ESRRB NM_004452 0.18006 0.21543 0.03215 0.07717 RNASEH2A NM_006397 0.29260 0.10611 0.09646 0.00965 SBSN NM_001166034 0.19936 0.24116 0.01286 0.05466 PUM2 NM_001282791 0.08360 0.17363 0.05466 0.19614 SMAD1 NM_005900 0.17042 0.21543 0.09003 0.03215 CDK16 NM_006201 0.16720 0.21543 0.04180 0.08360 EPPK1 NM_031308 0.17363 0.16077 0.09325 0.08039 MID1 NM_001193277 0.08360 0.10289 0.02572 0.29582 BTF3 NM_001037637 0.16077 0.25080 0.01608 0.08360 STEAP2 NM_001040666 0.04180 0.16077 0.12862 0.18006 PSMA6 NM_001282234 0.13183 0.09968 0.09325 0.18650 EMP1 NM_001423 0.16077 0.12540 0.01929 0.20579 SLC18A1 NM_003053 0.12540 0.02894 0.18650 0.17042 KRTAP21-2 NM_181617 0.19936 0.13826 0.09325 0.08039 HRASLS5 NM_054108 0.14148 0.14791 0.06431 0.15756 CCDC22 NM_014008 0.18006 0.24437 0.01929 0.06752 HSBP1 NM_001537 0.12540 0.25402 0.04180 0.09325 IFT81 NM_014055 0.17685 0.32154 0.00322 0.01286 NLGN4Y NM_001206850 0.14148 0.05466 0.12862 0.18971 RNF8 NM_003958 0.09003 0.08360 0.11897 0.22186 APOLD1 NM_030817 0.15113 0.18971 0.12219 0.05145 NOSTRIN NM_001039724 0.06431 0.19936 0.01929 0.23151 IRX3 NM_024336 0.14148 0.16077 0.10932 0.10289 OR2AG2 NM_001004490 0.09003 0.09003 0.12862 0.20900 SDHB NM_003000 0.15756 0.27974 0.06431 0.01608 MORN3 NM_173855 0.03859 0.08360 0.12540 0.27010 KRTAP13-2 NM_181621 0.06752 0.18650 0.09325 0.17042 CTDSP1 NM_001206878 0.03859 0.23151 0.05788 0.18971 HIST1H4G NM_003547 0.09968 0.02572 0.11897 0.27331 BTBD2 NM_017797 0.11576 0.25080 0.08682 0.06431 ATP8B2 NM_020452 0.05466 0.09968 0.18006 0.18328 OR5AN1 NM_001004729 0.00322 0.01608 0.39228 0.10932 AASDHPPT NM_015423 0.20900 0.07717 0.09646 0.13826 TMEM11 NM_003876 0.17685 0.13183 0.18650 0.02572 TDO2 NM_005651 0.17685 0.16720 0.09646 0.08039 NOS1AP NM_014697 0.29260 0.16720 0.02572 0.03537 KCNA3 NM_002232 0.13183 0.23794 0.11576 0.03859 KHDC1L NM_001126063 0.05466 0.06752 0.34727 0.05466 GABPA NM_001197297 0.16077 0.35048 0.00322 0.00965 URGCP- NM_001204871 0.19614 0.32476 0.00000 0.00322 MRPS24 NFAT5 NM_001113178 0.15434 0.21543 0.04180 0.11254 LOC100129520 NM_001195272 0.17685 0.11576 0.02251 0.20900 MINPP1 NM_001178118 0.15434 0.32476 0.01929 0.02572 MB21D2 NM_178496 0.03859 0.02572 0.22830 0.23151 MTUS1 NM_001001931 0.27010 0.13183 0.02251 0.10289 EFCAB3 NM_001144933 0.09003 0.13183 0.27331 0.03537 SLC19A1 NM_001205207 0.23151 0.19293 0.08360 0.02251 SECISBP2 NM_001282690 0.14469 0.26367 0.00965 0.11254 LIN7A NM_004664 0.09968 0.09003 0.16077 0.18006 TBL2 NM_012453 0.06752 0.02572 0.16720 0.27010 USP53 NM_019050 0.08360 0.11576 0.13505 0.19614 OSR1 NM_145260 0.08360 0.08360 0.05788 0.30547 DYNLT3 NM_006520 0.01608 0.02251 0.22186 0.27010 BLOC1S1 NM_001487 0.13505 0.09646 0.11897 0.18006 KLF11 NM_001177716 0.13183 0.04180 0.09003 0.27010 HIST1H3A NM_003529 0.11576 0.20900 0.08682 0.12219 APLP1 NM_005166 0.09003 0.08360 0.22830 0.13183 CXCL13 NM_006419 0.23794 0.27010 0.01608 0.00965 BCL2A1 NM_001114735 0.00000 0.00322 0.11897 0.41158 SLC35F2 NM_017515 0.13505 0.11576 0.15756 0.12540 C1orf21 NM_030806 0.31511 0.21543 0.00322 0.00000 S100A13 NM_001024210 0.18328 0.02572 0.06752 0.25723 LAMTOR2 NM_001145264 0.06752 0.13183 0.08360 0.25402 FGR NM_001042747 0.14148 0.10289 0.08682 0.20579 CCDC30 NM_001080850 0.09003 0.17363 0.06431 0.20900 PRELP NM_002725 0.16077 0.34084 0.02572 0.00965 PIGS NM_033198 0.14791 0.07395 0.09325 0.22186 DGCR6L NM_033257 0.14148 0.12540 0.22830 0.04180 IP6K3 NM_054111 0.10289 0.33119 0.05466 0.04823 PTPRB NM_001109754 0.04823 0.09968 0.10611 0.28296 RAB4A NM_001271998 0.27010 0.08682 0.04180 0.13826 SECISBP2 NM_024077 0.23151 0.11576 0.01929 0.17042 ZNF491 NM_152356 0.05788 0.07717 0.25723 0.14469 CHST8 NM_001127895 0.25080 0.15434 0.05788 0.07395 MGRN1 NM_001142291 0.17685 0.15113 0.08039 0.13183 LPAR6 NM_001162497 0.14469 0.10289 0.20579 0.08682 SLC12A1 NM_001184832 0.14148 0.21543 0.01608 0.16720 PSME2 NM_002818 0.17685 0.22508 0.08360 0.05466 NAT16 NM_198571 0.08360 0.27010 0.08682 0.09968 AKAP3 NM_001278309 0.05466 0.13183 0.12540 0.23151 ECHS1 NM_004092 0.11576 0.10289 0.11897 0.20579 STAG3 NM_012447 0.19936 0.23151 0.02251 0.09003 RANBP10 NM_020850 0.06752 0.11576 0.08360 0.27653 ZNF182 NM_001178099 0.31511 0.01286 0.00000 0.21543 FAM64A NM_001195228 0.15756 0.13505 0.15756 0.09325 PTPN14 NM_005401 0.05145 0.14148 0.12862 0.22186 ARRDC2 NM_015683 0.01608 0.09003 0.14791 0.28939 AZIN1 NM_015878 0.16399 0.11576 0.18650 0.07717 ASZ1 NM_130768 0.12540 0.03859 0.18006 0.19936 RFC4 NM_181573 0.01286 0.00965 0.41801 0.10289 CD247 NM_198053 0.10289 0.10932 0.08360 0.24759 SLC25A35 NM_201520 0.02251 0.01286 0.20257 0.30547 MAP3K3 NM_203351 0.19293 0.30868 0.00965 0.03215 KCND1 NM_004979 0.13183 0.13183 0.04180 0.24116 GPR174 NM_032553 0.04180 0.09325 0.17042 0.24116 RIIAD1 NM_001144956 0.32476 0.21543 0.00322 0.00322 NFS1 NM_001198989 0.10289 0.15434 0.08682 0.20257 NLRC4 NM_001199139 0.11576 0.08682 0.20579 0.13826 CNP NM_033133 0.05466 0.06431 0.22186 0.20579 EMP3 NM_001425 0.32797 0.08039 0.09646 0.04180 NXF1 NM_001081491 0.06752 0.02572 0.08039 0.37299 GLIPR2 NM_001287013 0.02251 0.05466 0.06109 0.40836 SEMA4B NM_020210 0.20900 0.28296 0.01608 0.04180 SLC39A13 NM_001128225 0.16720 0.12540 0.08682 0.17042 ETFB NM_001985 0.21543 0.31190 0.00643 0.01608 PRSS1 NM_002769 0.16077 0.03859 0.33762 0.01286 LHX3 NM_014564 0.04180 0.02572 0.28617 0.19614 PRPF38B NM_018061 0.11576 0.09325 0.11897 0.22186 LMF1 NM_022773 0.00000 0.00322 0.27010 0.27653 ANKRD24 NM_133475 0.14469 0.04502 0.31833 0.04180 ARHGAP11A NM_014783 0.19614 0.24116 0.03215 0.08039 STX1B NM_052874 0.20900 0.09003 0.24437 0.00965 PKD2L2 NM_001258449 0.31511 0.14791 0.01608 0.07395 R3HDM1 NM_001282799 0.00643 0.00965 0.26688 0.27010 ARHGEF10 NM_014629 0.12540 0.21543 0.17042 0.04180 PQBP1 NM_001167989 0.25080 0.30225 0.00000 0.00000 FADD NM_003824 0.17042 0.09646 0.10611 0.18006 RPL5 NM_000969 0.08039 0.08039 0.30225 0.09325 CYB5RL NM_001031672 0.28617 0.21543 0.02251 0.03215 DOK7 NM_173660 0.25080 0.22186 0.06752 0.01608 MAFF NM_001161573 0.18328 0.31833 0.01608 0.04180 BTN3A2 NM_001197249 0.23794 0.21543 0.09003 0.01608 SBDS NM_016038 0.40514 0.01286 0.01608 0.12540 FRMPD3 NM_032428 0.01608 0.01608 0.29582 0.23151 MORF4L1 NM_206839 0.19936 0.26367 0.01608 0.08039 GPRASP1 NM_001099411 0.52090 0.03859 0.00000 0.00000 ANKRD35 NM_001280799 0.03215 0.02894 0.33762 0.16077 ZMYM2 NM_001190965 0.16077 0.11576 0.11576 0.17042 CISH NM_013324 0.16720 0.13826 0.08682 0.17042 RSL1D1 NM_015659 0.05145 0.08360 0.10611 0.32154 EXOC6 NM_019053 0.19936 0.09003 0.07395 0.19936 OR4F29 NM_001005221 0.16077 0.29260 0.01929 0.09003 CBX1 NM_001127228 0.36334 0.15434 0.02572 0.01929 ACAA1 NM_001607 0.30868 0.21543 0.02251 0.01608 CUL5 NM_003478 0.03215 0.03859 0.27010 0.22186 MLYCD NM_012213 0.15113 0.35691 0.01929 0.03537 CEP68 NM_015147 0.06109 0.07717 0.12862 0.29582 S100A4 NM_019554 0.27010 0.19936 0.01929 0.07395 SLCO1B7 NM_001009562 0.16077 0.24116 0.08682 0.07717 RPS27A NM_001177413 0.16720 0.11897 0.04823 0.23151 SIGLEC5 NM_003830 0.16399 0.09003 0.12862 0.18328 CLUH NM_015229 0.07395 0.02894 0.39228 0.07074 KIAA1033 NM_015275 0.16077 0.17363 0.12862 0.10289 ARHGAP21 NM_020824 0.15434 0.16077 0.03215 0.21865 MRPL55 NM_181456 0.11576 0.10932 0.29904 0.04180 RPN2 NM_001135771 0.39550 0.16399 0.00000 0.00965 UBA5 NM_198329 0.23794 0.30868 0.00643 0.01608 ARHGAP27 NM_001282290 0.02894 0.01929 0.24437 0.27653 STAP2 NM_017720 0.11576 0.22186 0.08039 0.15113 OR5H6 NM_001005479 0.00000 0.00965 0.18650 0.37299 RNF222 NM_001146684 0.27010 0.24116 0.01608 0.04502 AATF NM_012138 0.08360 0.13183 0.08682 0.27010 C2orf50 NM_182500 0.20579 0.24116 0.04180 0.08360 DLX1 NM_178120 0.36334 0.19614 0.00322 0.00965 TMCO2 NM_001008740 0.09968 0.16077 0.11576 0.19614 FNDC3A NM_001079673 0.26367 0.25080 0.01608 0.04180 NRG1 NM_001159996 0.05466 0.13826 0.01929 0.36013 SEPTIN9 NM_001113495 0.14469 0.32154 0.01929 0.08682 PTPMT1 NM_001143984 0.03859 0.06431 0.28617 0.18328 DPT NM_001937 0.08682 0.17042 0.17685 0.13826 RSPRY1 NM_133368 0.02251 0.00965 0.16720 0.37299 KANSL1L NM_152519 0.04180 0.13826 0.09325 0.29904 SNX32 NM_152760 0.32476 0.21543 0.00322 0.02894 TXLNA NM_175852 0.03859 0.00965 0.21865 0.30547 KRTAP8-1 NM_175857 0.17363 0.23151 0.11254 0.05466 CLIC6 NM_053277 0.14148 0.18650 0.22186 0.02251 EXOSC8 NM_181503 0.16077 0.31833 0.04180 0.05466 OR9G4 NM_001005284 0.27974 0.15113 0.07395 0.07074 SEPTIN5 NM_001009939 0.03859 0.21543 0.03537 0.28617 VAT1L NM_020927 0.13183 0.21543 0.11897 0.10932 TEX11 NM_031276 0.05145 0.09968 0.26367 0.16077 WDR7 NM_052834 0.30868 0.13826 0.08682 0.04180 C9orf169 NM_199001 0.11576 0.06431 0.26367 0.13183 UGT2B15 NM_001076 0.18328 0.13826 0.06752 0.18650 LRRC43 NM_001098519 0.13826 0.09325 0.18006 0.16720 CHID1 NM_001142675 0.16077 0.12540 0.21543 0.07717 ELAVL4 NM_001144775 0.31833 0.21543 0.01286 0.03215 MBNL3 NM_001170701 0.23151 0.08360 0.08360 0.18006 TET3 NM_001287491 0.11897 0.32154 0.03859 0.09968 DIRAS2 NM_017594 0.15113 0.09003 0.08360 0.25402 KCNN2 NM_170775 0.21865 0.10932 0.08039 0.17042 MOBP NM_182935 0.00965 0.01286 0.21865 0.33762 LSP1 NM_001242932 0.27010 0.19936 0.03215 0.07717 RUNDC3A NM_006695 0.30868 0.21865 0.02251 0.02894 TDRD10 NM_182499 0.26688 0.28296 0.01608 0.01608 ID1 NM_181353 0.19936 0.35048 0.01929 0.01286 REPS1 NM_001128617 0.11576 0.16077 0.14791 0.15756 TMED5 NM_001167830 0.15434 0.19614 0.09325 0.13826 ZC4H2 NM_001178033 0.21222 0.32154 0.01608 0.03215 ETV6 NM_001987 0.16720 0.13826 0.08360 0.19293 PIK3C2A NM_002645 0.19936 0.23151 0.09646 0.05466 HS3ST4 NM_006040 0.14469 0.09003 0.06109 0.28617 SAC3D1 NM_013299 0.12540 0.10932 0.04180 0.30547 CHST6 NM_021615 0.25723 0.25723 0.01286 0.05466 LCE1F NM_178354 0.27010 0.23794 0.03215 0.04180 VSX2 NM_182894 0.03215 0.00965 0.27010 0.27010 SULF2 NM_198596 0.08682 0.09325 0.14791 0.25402 TRAK1 NM_001265609 0.16077 0.12219 0.07074 0.23151 ALDH8A1 NM_022568 0.09003 0.21865 0.11576 0.16077 C20orf173 NM_001145350 0.23794 0.33119 0.01286 0.00322 CFLAR NM_001202517 0.27010 0.29582 0.00322 0.01608 METTL21A NM_145280 0.08360 0.40836 0.01608 0.07717 RIN2 NM_001242581 0.07074 0.04180 0.10611 0.36656 PSMC1 NM_002802 0.07074 0.08360 0.02251 0.40836 TSPY2 NM_022573 0.08039 0.14791 0.29582 0.06109 TTC24 NM_001105669 0.27010 0.26688 0.01286 0.03859 SLC6A8 NM_005629 0.13183 0.42122 0.01929 0.01608 RGL3 NM_001035223 0.26045 0.20900 0.08682 0.03215 CCDC104 NM_001282761 0.08360 0.19614 0.23473 0.07395 CAST NM_001284212 0.03859 0.03215 0.39228 0.12540 PLN NM_002667 0.03859 0.08360 0.24437 0.22186 NAIP NM_004536 0.02251 0.16077 0.23473 0.17042 IVL NM_005547 0.23151 0.21543 0.08682 0.05466 MITD1 NM_138798 0.04180 0.11576 0.18650 0.24437 NR1H4 NM_001206993 0.04502 0.02894 0.26367 0.25080 NUDT10 NM_153183 0.15113 0.25080 0.08682 0.09968 ADCYAPIR1 NM_001199637 0.06752 0.09003 0.22830 0.20579 MAP2K5 NM_001206804 0.13183 0.19614 0.05788 0.20579 DLAT NM_001931 0.26045 0.24759 0.04180 0.04180 MAP3K11 NM_002419 0.16720 0.09003 0.06431 0.27010 FIGF NM_004469 0.23151 0.27010 0.08682 0.00322 GGN NM_152657 0.00000 0.00965 0.27010 0.31190 DNAJC17 NM_018163 0.13183 0.09003 0.17363 0.19614 FGD6 NM_018351 0.10289 0.12219 0.15756 0.20900 DNAJC25- NM_004125 0.11897 0.10289 0.17685 0.19293 GNG10 LRRC36 NM_001161575 0.32154 0.24116 0.01608 0.01608 GALK2 NM_001001556 0.08360 0.08360 0.15756 0.27010 FAM213B NM_001195736 0.16077 0.13826 0.12540 0.17042 SERF2 NM_001199878 0.00000 0.00322 0.44051 0.15113 ACP6 NM_016361 0.31511 0.27010 0.00643 0.00322 ANKRD13C NM_030816 0.20900 0.08360 0.03215 0.27010 KIAA1958 NM_133465 0.31833 0.16720 0.07395 0.03537 TIGD6 NM_001243253 0.14148 0.06752 0.09646 0.28939 BIVM-ERCC5 NM_001204425 0.00000 0.01286 0.26367 0.32154 OSBPL8 NM_020841 0.27974 0.08039 0.08682 0.15113 TANC2 NM_025185 0.16077 0.09003 0.23473 0.11254 OR6K6 NM_001005184 0.39228 0.20257 0.00000 0.00322 CREM NM_182724 0.23473 0.21543 0.00965 0.13826 MRPL30 NM_145212 0.07074 0.18006 0.17363 0.17363 SPATA13 NM_153023 0.17685 0.17363 0.07074 0.17685 METTL20 NM_001135863 0.17685 0.08682 0.28617 0.05145 DEFB133 NM_001166478 0.10289 0.08682 0.08682 0.32476 HN1 NM_001288609 0.18650 0.05466 0.27331 0.08682 CD36 NM_001289908 0.24759 0.32476 0.00322 0.02572 IL13 NM_002188 0.15756 0.44051 0.00322 0.00000 WBSCR16 NM_148842 0.39228 0.17042 0.01286 0.02572 EBPL NM_001278636 0.10289 0.13183 0.16077 0.20579 FAM9C NM_174901 0.23794 0.21543 0.06752 0.08039 METTL13 NM_015935 0.24759 0.21543 0.12540 0.01608 OXR1 NM_001198532 0.02251 0.01286 0.40836 0.16077 MDH1 NM_001199112 0.14148 0.09003 0.27010 0.10289 CARD8 NM_014959 0.25080 0.30868 0.00643 0.03859 FCRL6 NM_001004310 0.04180 0.05466 0.21865 0.28939 QTRTD1 NM_024638 0.10289 0.19614 0.12540 0.18006 PSMB1 NM_002793 0.16077 0.15434 0.01608 0.27653 APOL2 NM_030882 0.16077 0.11576 0.31833 0.01286 OR2M5 NM_001004690 0.14148 0.10289 0.09325 0.27010 EIF2AK2 NM_001135652 0.11897 0.15756 0.14791 0.18328 AQP8 NM_001169 0.16077 0.42122 0.00322 0.02251 DEF8 NM_001242821 0.35691 0.15756 0.01929 0.07395 CLEC19A NM_001256720 0.11576 0.13826 0.01608 0.33762 TMED2 NM_006815 0.08360 0.09646 0.12862 0.29904 TAC1 NM_013997 0.16077 0.09646 0.10611 0.24437 TOLLIP NM_019009 0.25080 0.12219 0.14148 0.09325 ARHGAP18 NM_033515 0.01286 0.02251 0.38585 0.18650 TMEM255B NM_182614 0.19936 0.35691 0.02251 0.02894 KIAA1456 NM_001099677 0.27010 0.30868 0.00322 0.02572 PLK3 NM_004073 0.25723 0.30868 0.00643 0.03537 KIAA0368 NM_001080398 0.14148 0.17363 0.07074 0.22186 FAM163B NM_001080515 0.14469 0.09003 0.15434 0.22186 DTNA NM_001198944 0.15434 0.21543 0.20257 0.03859 CBFA2T3 NM_005187 0.02251 0.00965 0.11897 0.45981 STAMBP NM_006463 0.00000 0.00000 0.10289 0.50804 ASB17 NM_080868 0.31511 0.25080 0.00322 0.04180 KIAA1804 NM_032435 0.10611 0.21543 0.18650 0.10289 AK3 NM_001199853 0.14469 0.12219 0.07074 0.27653 MDM2 NM_002392 0.12540 0.21543 0.02572 0.24759 SRM NM_003132 0.06109 0.12540 0.18328 0.24437 PAIP2B NM_020459 0.06109 0.07395 0.28617 0.19293 EN1 NM_001426 0.27974 0.32476 0.00000 0.01286 ATP11C NM_173694 0.36334 0.23473 0.00643 0.01286 HTR2A NM_001165947 0.03537 0.16077 0.22830 0.19293 OSBPL3 NM_145322 0.12219 0.11576 0.21865 0.16077 PHF21B NM_001135862 0.30868 0.23151 0.04180 0.03537 PSMB4 NM_002796 0.01929 0.04502 0.28296 0.27010 EIF4EBP1 NM_004095 0.08360 0.23151 0.28939 0.01286 FRMPD4 NM_014728 0.08682 0.12540 0.08682 0.32154 PCDHGB3 NM_018924 0.06752 0.10289 0.12540 0.32476 LXN NM_020169 0.07074 0.16720 0.09325 0.28939 OR2T1 NM_030904 0.00965 0.06109 0.30868 0.24116 C17orf62 NM_001193655 0.31511 0.29260 0.00322 0.01286 FOXP1 NM_001244813 0.18971 0.10289 0.17042 0.16077 SUPT4H1 NM_003168 0.14791 0.23151 0.22830 0.01608 PDE4D NM_006203 0.27010 0.26688 0.01608 0.07074 MAL NM_022440 0.00000 0.01286 0.44373 0.16720 PDC NM_022576 0.03859 0.08360 0.06752 0.43408 MEF2C NM_001193349 0.14148 0.10611 0.08682 0.28939 IL36RN NM_173170 0.13505 0.12862 0.07074 0.28939 NSMCE2 NM_173685 0.32476 0.24437 0.01608 0.04180 MBOAT7 NM_001146056 0.16077 0.09003 0.12540 0.25080 ALDH18A1 NM_002860 0.08360 0.09003 0.26367 0.18971 MARCHF1 NM_017923 0.31511 0.21543 0.01608 0.08039 MS4A2 NM_001256916 0.16077 0.30868 0.02572 0.13183 SCML4 NM_001286409 0.03859 0.09003 0.36013 0.13826 KLRC2 NM_002260 0.00643 0.04180 0.30868 0.27010 FBXL12 NM_017703 0.30868 0.31833 0.00000 0,00000 AMPD2 NM_001257360 0.09968 0.15756 0.08039 0.28939 USP5 NM_003481 0.08360 0.13826 0.14791 0.25723 TSPAN5 NM_005723 0.11576 0.35048 0.02251 0.13826 CNBD1 NM_173538 0.26367 0.22830 0.11576 0.01929 MMP11 NM_005940 0.13183 0.13505 0.30868 0.05466 EBF2 NM_022659 0.00965 0.08360 0.12862 0.40836 MXI1 NM_130439 0.32154 0.30868 0.00000 0.00000 CERS2 NM_181746 0.15434 0.35048 0.09003 0.03537 SPATS2L NM_001282735 0.00643 0.07395 0.13505 0.41479 CASKIN1 NM_020764 0.41479 0.16077 0.02251 0.03215 ZNF200 NM_003454 0.09646 0.06752 0.19614 0.27010 CYP3A43 NM_057096 0.14469 0.22830 0.06431 0.19293 ZEB1 NM_001174094 0.24759 0.35691 0.01286 0.01608 MYADM NM_001020818 0.16077 0.21865 0.09325 0.16077 RAB41 NM_001032726 0.12540 0.13183 0.18006 0.19614 GPR149 NM_001038705 0.32154 0.27010 0.00643 0.03537 KLHL3 NM_001257194 0.03859 0.09325 0.11576 0.38585 MYRF NM_013279 0.16077 0.07395 0.31833 0.08039 TMEM141 NM_032928 0.18328 0.28296 0.00000 0.16720 ACPT NM_033068 0.19614 0.38264 0.01608 0.03859 HAUS8 NM_033417 0.31511 0.13826 0.12540 0.05466 FBLIM1 NM_001024215 0.22830 0.24116 0.15434 0.00965 SHFM1 NM_006304 0.09003 0.11576 0.17685 0.25080 FGD3 NM_033086 0.14148 0.18650 0.17685 0.12862 PEX11B NM_003846 0.16399 0.21543 0.08682 0.17042 WDR1 NM_017491 0.10289 0.30868 0.01608 0.20900 SLC25A36 NM_018155 0.09003 0.26688 0.09325 0.18650 DDRGK1 NM_023935 0.03859 0.08682 0.23473 0.27653 CDC26 NM_139286 0.31833 0.19614 0.08682 0.03537 ATP6V1H NM_213620 0.12540 0.10289 0.17685 0.23151 GOLGA8J NM_001282472 0.19936 0.33119 0.00643 0.09968 PDCL3 NM_024065 0.19936 0.21543 0.05788 0.16399 CD36 NM_001289909 0.23151 0.30868 0.06109 0.03537 ALG10 NM_032834 0.08360 0.18650 0.22830 0.13826 KCNC3 NM_004977 0.16077 0.16077 0.12540 0.19293 TRIL NM_014817 0.14148 0.31190 0.01608 0.17042 PIH1D1 NM_017916 0.23151 0.18971 0.08682 0.13183 MGAT5B NM_001199172 0.32476 0.30868 0.00643 0.00000 MARCHF5 NM_017824 0.23794 0.20579 0.18006 0.01608 TM7SF2 NM_001277233 0.30868 0.21865 0.07074 0.04180 OARD1 NM_145063 0.25723 0.19936 0.06752 0.11576 IL18BP NM_001145057 0.14148 0.05466 0.09646 0.34727 EEF1A2 NM_001958 0.14148 0.06431 0.12862 0.30547 SIDT1 NM_017699 0.27010 0.08360 0.10611 0.18006 KIRREL NM_018240 0.23151 0.15113 0.22830 0.02894 MAK16 NM_032509 0.16077 0.09003 0.02251 0.36656 SSX5 NM_175723 0.15113 0.22830 0.15756 0.10289 TOX NM_014729 0.16077 0.03215 0.16399 0.28617 CIRH1A NM_032830 0.26367 0.19614 0.12862 0.05466 RICTOR NM_152756 0.27010 0.35691 0.01286 0.00322 PNLIPRP3 NM_001011709 0.27653 0.10932 0.07074 0.18650 CXorf27 NM_012274 0.14469 0.14791 0.04180 0.30868 CABYR NM_153770 0.10611 0.03859 0.41158 0.08682 GLB1 NM_001135602 0.23794 0.18328 0.04180 0.18006 MCAM NM_006500 0.11576 0.08360 0.41801 0.02572 ZBTB25 NM_006977 0.26045 0.23794 0.02251 0.12219 ZDHHC1 NM_013304 0.13826 0.24116 0.04180 0.22186 ULBP2 NM_025217 0.17363 0.13826 0.16077 0.17042 FOXN1 NM_003593 0.23151 0.36013 0.04180 0.01286 PLA2G2C NM_001105572 0.16077 0.34727 0.08682 0.05145 BMPR2 NM_001204 0.16720 0.23151 0.00643 0.24116 C18orf54 NM_001288982 0.31833 0.24116 0.07074 0.01608 GBP6 NM_198460 0.11897 0.09003 0.27010 0.16720 TRIM60 NM_001258025 0.09003 0.42122 0.06752 0.06752 ACADM NM_001286043 0.31511 0.27010 0.01929 0.04180 EIF3H NM_003756 0.18328 0.27010 0.07395 0.11897 TPP1 NM_000391 0.07717 0.07074 0.07074 0.42765 SPARCL1 NM_001128310 0.00000 0.00965 0.45016 0.18650 SLC39A1 NM_001271958 0.19293 0.18650 0.08682 0.18006 HLA-DMA NM_006120 0.00000 0.01929 0.32154 0.30547 HMHA1 NM_012292 0.02251 0.00965 0.20579 0.40836 BPIFB2 NM_025227 0.02251 0.00643 0.45016 0.16720 PKHD1 NM_138694 0.05466 0.02572 0.10611 0.45981 DPYSL3 NM_001387 0.17685 0.13826 0.27010 0.06109 ACADL NM_001608 0.10289 0.17363 0.07074 0.29904 AIFM3 NM_001146288 0.24759 0.36334 0.02251 0.01608 ZNF548 NM_001172773 0.00643 0.00322 0.39228 0.24759 TRPV1 NM_080704 0.23151 0.16077 0.08682 0.17042 MROH7 NM_001039464 0.30868 0.26688 0.03215 0.04180 SMIM5 NM_001162995 0.15434 0.04502 0.11576 0.33441 CCDC93 NM_019044 0.09968 0.07395 0.27010 0.20579 PRELID2 NM_138492 0.06431 0.13183 0.15756 0.29582 IGJ NM_144646 0.11576 0.30868 0.03215 0.19293 ELL2 NM_012081 0.14469 0.30225 0.17685 0.02572 NCBP1 NM_002486 0.32476 0.19293 0.08682 0.04823 PID1 NM_017933 0.17042 0.09325 0.12862 0.26045 RBMS3 NM_001177711 0.25080 0.09003 0.08360 0.22830 STX10 NM_001271609 0.32154 0.15434 0.14469 0.03215 EPB41L3 NM_001281535 0.17363 0.16077 0.27010 0.04823 SECTM1 NM_003004 0.16399 0.12862 0.25723 0.10289 PTPRO NM_030667 0.15113 0.14791 0.26367 0.09003 ZNF566 NM_032838 0.27010 0.24116 0.09968 0.04180 ABCA2 NM_212533 0.15434 0.18328 0.09325 0.22186 OPRM1 NM_001145287 0.23151 0.34727 0.02251 0.05145 CEP83 NM_001042399 0.11576 0.11576 0.09003 0.33441 FAM156B NM_001099684 0.16720 0.30868 0.04180 0.13826 RNF19B NM_001127361 0.09003 0.01929 0.22186 0.32476 APC NM_001127510 0.16720 0.21543 0.00322 0.27010 TRAPPC3 NM_001270895 0.25402 0.09003 0.11897 0.19293 NGDN NM_015514 0.23151 0.17363 0.11897 0.13183 IFT140 NM_014714 0.10611 0.29582 0.18006 0.07395 ZNF518A NM_014803 0.01286 0.00965 0.08682 0.54984 DGCR6 NM_005675 0.13183 0.05466 0.26688 0.20579 STS NM_000351 0.26367 0.17363 0.01608 0.20579 DPP9 NM_139159 0.27010 0.30547 0.01608 0.06752 KLRC1 NM_002259 0.00965 0.01608 0.26688 0.36656 IPO5 NM_002271 0.20900 0.17363 0.12862 0.14791 WNT5B NM_032642 0.27653 0.38264 0.00000 0.00000 ARHGEF1 NM_199002 0.16077 0.22830 0.21543 0.05466 KCNAB3 NM_004732 0.13826 0.22508 0.14791 0.14791 KIAA1024 NM_015206 0.15756 0.13826 0.14148 0.22186 HEATR2 NM_017802 0.19614 0.02251 0.06752 0.37299 SLAIN1 NM_001242868 0.20900 0.17042 0.19614 0.08682 CD84 NM_001184879 0.09003 0.08360 0.36013 0.12862 PACS2 NM_001243127 0.31511 0.19936 0.09325 0.05466 BDKRB1 NM_000710 0.14148 0.09003 0.20257 0.22830 C6orf58 NM_001010905 0.03859 0.08360 0.27010 0.27010 SULF1 NM_001128205 0.11897 0.07395 0.22830 0.24116 CIZ1 NM_001131015 0.31511 0.09003 0.17685 0.08039 TEX33 NM_001163857 0.19614 0.04823 0.22508 0.19293 GHR NM_001242406 0.18650 0.42122 0.00643 0.04823 NME3 NM_002513 0.32154 0.26688 0.02572 0.04823 KLC1 NM_005552 0.01286 0.00965 0.18006 0.45981 RASGRF2 NM_006909 0.11576 0.09003 0.07074 0.38585 MPHOSPH8 NM_017520 0.16720 0.18328 0.14148 0.17042 PCDHGA4 NM_018917 0.08360 0.02572 0.36013 0.19293 CARF NM_024744 0.18971 0.25080 0.01608 0.20579 BMP2K NM_198892 0.03859 0.00965 0.34084 0.27331 SCAP NM_012235 0.27010 0.35691 0.00643 0.02894 PHTF1 NM_006608 0.14469 0.11576 0.06752 0.33441 PTRH1 NM_001002913 0.19614 0.20900 0.09325 0.16720 GRIN2A NM_001134408 0.12540 0.08360 0.18006 0.27653 KCNH1 NM_002238 0.01286 0.09003 0.19614 0.36656 NUP188 NM_015354 0.01608 0.00643 0.37621 0.26688 WRNIP1 NM_130395 0.04180 0.08039 0.15113 0.39228 LTA4H NM_001256643 0.23794 0.16720 0.18328 0.07717 UBIAD1 NM_013319 0.35691 0.21222 0.09325 0.00322 CDKN1A NM_078467 0.02894 0.04502 0.20257 0.38907 RNF165 NM_152470 0.33762 0.27010 0.00643 0.05145 TMEM233 NM_001136534 0.06752 0.10289 0.32797 0.16720 CCSER1 NM_207491 0.10289 0.10289 0.37942 0.08039 LOC200726 NM_001102659 0.23151 0.27010 0.12540 0.04180 DDX19B NM_001257173 0.32154 0.08039 0.16720 0.09968 SBNO2 NM_014963 0.01286 0.01608 0.21865 0.42122 SSX7 NM_173358 0.27010 0.36013 0.01608 0.02251 LRRC27 NM_001143757 0.16720 0.01608 0.18006 0.30547 PHACTR3 NM_001199505 0.00965 0.08360 0.28617 0.28939 NDUFAB1 NM_005003 0.39550 0.26688 0.00643 0.00000 APBB1IP NM_019043 0.04180 0.07395 0.30868 0.24437 TENC1 NM_198316 0.23794 0.09646 0.08682 0.24759 OGN NM_014057 0.27974 0.34727 0.00643 0.03537 UTP3 NM_020368 0.06109 0.08360 0.23473 0.28939 TSHZ1 NM_005786 0.10289 0.09003 0.17685 0.29904 PPIP5K2 NM_015216 0.16077 0.06431 0.22186 0.22186 PSMB8 NM_148919 0.25080 0.34727 0.01929 0.05145

    TABLE-US-00006 TABLE 3B FDR of the CRISPRa chronic screening results. Gene targets are in ranked order. Gene names, RefSeq IDs, and estimated FDR using negative control genes (see Methods) for each of the top 1000 genes in the screening bioreps are listed. Chronic Chronic Chronic Chronic Chronic Chronic Round 1 Round 1 Round 2 Round 2 Round 3 Round 3 Gene id biorep 1 biorep 2 biorep 1 biorep 2 biorep 1 biorep 2 B3GNT2 NM_006577 0.00322 0.00000 0.00000 0.00000 0.00000 0.00000 JUNB NM_002229 0.00000 0.00322 0.00000 0.00965 0.00000 0.01286 INO80 NM_017553 0.00000 0.00965 0.00000 0.00965 0.03537 0.00965 F8A2 NM_001007523 0.00965 0.00965 0.00000 0.01608 0.00643 0.02572 STK40 NM_032017 0.00965 0.01286 0.00000 0.01286 0.01929 0.01286 C2orf88 NM_001042520 0.00000 0.01608 0.00643 0.00965 0.05466 0.00965 KRBA1 NM_001290187 0.00000 0.05145 0.00000 0.02894 0.00000 0.02894 DKK2 NM_014421 0.00000 0.02894 0.00000 0.04823 0.00000 0.03859 ITLN1 NM_017625 0.01929 0.05145 0.00000 0.02572 0.00000 0.03537 IQSEC3 NM_015232 0.02251 0.02894 0.02251 0.02572 0.01608 0.02251 NIPAL1 NM_207330 0.00965 0.01286 0.03859 0.00965 0.06109 0.01286 FEZ2 NM_005102 0.00000 0.09646 0.00000 0.02572 0.01286 0.01286 WDR76 NM_001167941 0.00000 0.09003 0.00000 0.02572 0.03537 0.01286 ZNF497 NM_001207009 0.00322 0.02894 0.03537 0.03537 0.06109 0.01286 CIDEC NM_001199623 0.09325 0.00322 0.04823 0.00965 0.01608 0.00965 KCNF1 NM_002236 0.02894 0.05145 0.02251 0.01286 0.04180 0.02251 RINT1 NM_021930 0.06752 0.00322 0.03859 0.00965 0.04823 0.01608 LGALS14 NM_203471 0.04823 0.00322 0.07717 0.00965 0.05466 0.01286 ATP2A2 NM_170665 0.00000 0.11897 0.00965 0.03537 0.01286 0.03537 TMEM55B NM_144568 0.04823 0.01286 0.06431 0.01608 0.05788 0.01608 CHRND NM_001256657 0.10289 0.01929 0.03859 0.00965 0.03537 0.01286 LHX2 NM_004789 0.10289 0.00322 0.04180 0.00965 0.04823 0.01608 ZNF576 NM_024327 0.02894 0.13505 0.00322 0.02894 0.01286 0.01608 CCBL2 NM_001008661 0.00965 0.09003 0.03859 0.02572 0.05466 0.00965 GABBR1 NM_021904 0.00000 0.17042 0.00000 0.01608 0.01929 0.02251 GOLGA8M NM_001282468 0.01286 0.02894 0.09646 0.00965 0.07717 0.00643 CCDC160 NM_001101357 0.00965 0.09646 0.00000 0.05466 0.00000 0.07395 RBPMS2 NM_194272 0.03859 0.13826 0.01286 0.00965 0.02894 0.01286 CMTM3 NM_144601 0.05788 0.00643 0.07395 0.02894 0.05788 0.02251 KCNH7 NM_033272 0.00000 0.06431 0.02251 0.03859 0.00965 0.11897 YY1AP1 NM_001198902 0.16399 0.00000 0.05788 0.00965 0.01608 0.00965 ASXL3 NM_030632 0.02894 0.02572 0.02572 0.06431 0.02251 0.09003 RCAN2 NM_001251974 0.01929 0.07717 0.00000 0.06431 0.00000 0.09968 ADAMTS12 NM_030955 0.08360 0.00322 0.04823 0.06431 0.00965 0.05466 SGPP2 NM_152386 0.02251 0.07717 0.01286 0.05145 0.05466 0.04502 CCDC66 NM_001141947 0.07717 0.02572 0.08039 0.00965 0.06109 0.01286 JUN NM_002228 0.01929 0.00322 0.09646 0.03537 0.09968 0.01608 ACTG1 NM_001199954 0.07074 0.07717 0.03537 0.05466 0.01608 0.02251 MBD3L3 NM_001164425 0.02894 0.04502 0.03859 0.07395 0.03859 0.05145 MAGEA4 NM_001011549 0.00000 0.13183 0.00000 0.04823 0.00000 0.09968 RPS11 NM_001015 0.06431 0.02572 0.05788 0.02894 0.08360 0.01929 POP1 NM_015029 0.09003 0.02894 0.06109 0.02894 0.06431 0.01286 SMIM12 NM_001164825 0.05145 0.14791 0.01286 0.01608 0.03859 0.02251 RPUSD4 NM_032795 0.00000 0.05466 0.00000 0.07717 0.01608 0.14148 SCN11A NM_014139 0.06752 0.00322 0.07717 0.03537 0.05466 0.05466 FLI1 NM_001167681 0.09325 0.00643 0.01286 0.06431 0.01608 0.09968 FAM118A NM_017911 0.00000 0.27010 0.00000 0.00965 0.00322 0.00965 PCYT2 NM_001184917 0.01929 0.09646 0.00000 0.07395 0.00322 0.09968 CALD1 NM_033140 0.07074 0.07717 0.03859 0.04502 0.03859 0.02572 SSX4B NM_001034832 0.04180 0.11576 0.03859 0.03537 0.04502 0.02251 NELFA NM_005663 0.03537 0.03859 0.03859 0.06752 0.05466 0.06431 CDKN2A NM_000077 0.00965 0.05145 0.08039 0.01608 0.11576 0.02894 STYX NM_001130701 0.03215 0.01929 0.06752 0.03215 0.06109 0.09003 ZBTB22 NM_001145338 0.10289 0.00965 0.10611 0.00965 0.06431 0.01286 ATG16L2 NM_033388 0.05466 0.00643 0.03859 0.04502 0.05466 0.10932 CD109 NM_001159587 0.11254 0.00643 0.12219 0.00965 0.05466 0.00643 ACTA1 NM_001100 0.04823 0.08039 0.09325 0.02894 0.05466 0.01286 BEX2 NM_001168401 0.00965 0.07717 0.00322 0.04502 0.03537 0.14791 SHROOM3 NM_020859 0.00000 0.20257 0.00000 0.04823 0.00000 0.06752 ERMN NM_001009959 0.01929 0.19293 0.00000 0.03537 0.00000 0.07395 SRC NM_198291 0.05788 0.20579 0.00643 0.02894 0.00965 0.01608 TACR3 NM_001059 0.09003 0.00322 0.09968 0.00965 0.11576 0.00643 NYNRIN NM_025081 0.14469 0.09325 0.00000 0.04502 0.00643 0.03537 FCER1A NM_002001 0.02894 0.10611 0.03859 0.05466 0.03859 0.05788 EFCAB1 NM_001142857 0.03537 0.04502 0.08039 0.02894 0.12862 0.01608 CYB5R3 NM_001171661 0.04502 0.09646 0.06752 0.04502 0.06752 0.01608 PPP2R2C NM_001206995 0.03537 0.00322 0.09325 0.02572 0.16077 0.02251 MCRS1 NM_006337 0.13505 0.07717 0.03859 0.03215 0.05466 0.01608 LRFN1 NM_020862 0.07717 0.09646 0.07074 0.03215 0.05466 0.02894 EFNA1 NM_004428 0.12540 0.13183 0.03859 0.02572 0.01608 0.02572 MACROD2 NM_001033087 0.08360 0.16077 0.01929 0.03215 0.01286 0.05466 NSL1 NM_015471 0.00322 0.11576 0.00000 0.11576 0.00965 0.11897 HGC6.3 NM_001129895 0.05466 0.02894 0.03859 0.05788 0.01929 0.16399 C11orf83 NM_001085372 0.11576 0.02894 0.09968 0.03215 0.06431 0.02251 CPEB1 NM_030594 0.00322 0.06431 0.02251 0.07717 0.05466 0.15113 RPL13 NM_001243130 0.11576 0.07395 0.01608 0.03859 0.03859 0.09325 RBBP8 NM_002894 0.14791 0.04180 0.10611 0.00965 0.06109 0.01286 CMTM4 NM_181521 0.00965 0.01929 0.04180 0.07395 0.09968 0.13505 ABCA4 NM_000350 0.06752 0.08039 0.08039 0.03215 0.06431 0.05788 RPL15 NM_001253384 0.10289 0.04180 0.08682 0.00643 0.14791 0.00322 SF3A2 NM_007165 0.01929 0.22508 0.07074 0.00965 0.05466 0.00965 REM1 NM_014012 0.17685 0.01929 0.03859 0.05145 0.01286 0.09003 LTN1 NM_015565 0.05788 0.13183 0.07074 0.06431 0.03537 0.02894 DISP2 NM_033510 0.00000 0.22508 0.00000 0.07395 0.00000 0.09325 NSG1 NM_001287763 0.00000 0.08039 0.00643 0.16077 0.05788 0.09003 TMEM147 NM_032635 0.00000 0.20257 0.00965 0.04823 0.06109 0.07717 FAM47A NM_203408 0.00000 0.27010 0.00322 0.03215 0.04502 0.04823 EXOC3L1 NM_178516 0.04823 0.06109 0.10611 0.05145 0.06109 0.07074 LITAF NM_004862 0.04823 0.11576 0.08039 0.01608 0.13183 0.01286 ZIC5 NM_033132 0.00000 0.11576 0.03859 0.07074 0.08039 0.09968 CCDC169 NM_001144984 0.09003 0.05145 0.08039 0.03537 0.09968 0.05145 SATB1 NM_001195470 0.00000 0.12219 0.00643 0.09646 0.03537 0.14791 EXOC4 NM_021807 0.10932 0.09003 0.03859 0.05788 0.04823 0.06431 HMGB2 NM_001130689 0.00000 0.20257 0.09646 0.00965 0.10289 0.00322 ESRRG NM_001134285 0.07074 0.07717 0.09325 0.00965 0.16077 0.00643 LTBR NM_002342 0.03859 0.00322 0.18971 0.00965 0.16720 0.00965 CLDN4 NM_001305 0.00965 0.07717 0.00322 0.11254 0.02894 0.18650 ECHDC1 NM_018479 0.19936 0.00643 0.09646 0.02894 0.06109 0.02894 WBP1L NM_017787 0.04823 0.05466 0.10611 0.03215 0.15113 0.03537 KCNQ4 NM_004700 0.10289 0.02894 0.13183 0.02572 0.06431 0.07395 NSUN3 NM_022072 0.02251 0.04502 0.03859 0.07395 0.07074 0.17685 TMEM132A NM_017870 0.09003 0.07717 0.08360 0.01608 0.15113 0.01286 DVL3 NM_004423 0.05466 0.09003 0.14148 0.06431 0.06431 0.01608 SLC25A35 NM_201520 0.00965 0.03215 0.09646 0.07395 0.16720 0.05145 MX1 NM_001178046 0.00965 0.14469 0.03859 0.07717 0.05466 0.10932 KLK10 NM_002776 0.09325 0.13183 0.03859 0.09325 0.01929 0.05788 CD97 NM_078481 0.02894 0.00965 0.11897 0.03537 0.15113 0.09003 ATG16L1 NM_017974 0.08360 0.07717 0.08039 0.06431 0.10289 0.02572 TMPRSS5 NM_030770 0.03537 0.05466 0.00965 0.09646 0.05466 0.18650 SPATA31A5 NM_001113541 0.05466 0.03859 0.10932 0.05788 0.13183 0.04823 CD151 NM_139030 0.15434 0.15756 0.03859 0.00965 0.05466 0.02572 PLEC NM_201382 0.07074 0.10611 0.12219 0.04823 0.07074 0.02251 CELF2 NM_006561 0.00322 0.18328 0.00965 0.13826 0.05466 0.05466 DUSP10 NM_144728 0.12540 0.15434 0.09646 0.02251 0.01286 0.03537 MEPE NM_001291183 0.15434 0.02251 0.07395 0.05788 0.04823 0.09003 LOC113230 NM_001291291 0.07717 0.01286 0.14791 0.02572 0.16077 0.02251 MYL6B NM_002475 0.09003 0.03215 0.07074 0.07717 0.03537 0.14148 KCNV1 NM_014379 0.00965 0.03215 0.09325 0.06752 0.14148 0.10289 CNN3 NM_001839 0.03859 0.07717 0.09646 0.06431 0.09968 0.07074 KIF3A NM_007054 0.12219 0.02894 0.10932 0.02894 0.09968 0.05788 NOL12 NM_024313 0.08360 0.00643 0.07717 0.03215 0.16077 0.09003 SLC25A1 NM_005984 0.04823 0.18328 0.04502 0.03537 0.04180 0.09646 UBE2T NM_014176 0.08682 0.04502 0.10611 0.02572 0.13505 0.05145 FAM155A NM_001080396 0.00965 0.07717 0.08039 0.11254 0.05466 0.11897 DAPL1 NM_001017920 0.03859 0.21543 0.04502 0.04502 0.06109 0.05145 NFE2 NM_001136023 0.00000 0.17042 0.00000 0.17363 0.01286 0.09968 PKIG NM_001281444 0.00000 0.06431 0.01286 0.17685 0.05466 0.14791 CCDC109B NM_017918 0.16399 0.11897 0.05788 0.04502 0.04823 0.02251 TGFBR1 NM_001130916 0.12219 0.05145 0.08039 0.04180 0.06431 0.10289 C1orf158 NM_152290 0.12219 0.11576 0.12862 0.01608 0.05788 0.02251 ZFAT NM_001289394 0.15756 0.01286 0.09325 0.07074 0.06431 0.06752 TRIM7 NM_203293 0.15434 0.00322 0.13505 0.00965 0.15756 0.00965 MTRR NM_024010 0.02251 0.11897 0.00322 0.17685 0.01608 0.13505 TAP1 NM_000593 0.09003 0.05466 0.05466 0.05788 0.08682 0.13826 SHE NM_001010846 0.06752 0.00322 0.16399 0.00965 0.22508 0.01286 TRIM50 NM_001281451 0.00322 0.09003 0.09646 0.06752 0.14148 0.08360 MPP2 NM_001278375 0.15434 0.08682 0.12219 0.00965 0.10289 0.00965 MIER1 NM_001146112 0.18971 0.05788 0.06752 0.05788 0.05788 0.05466 EDC3 NM_025083 0.00000 0.24759 0.00322 0.07395 0.03537 0.12862 GSC NM_173849 0.12540 0.06109 0.04180 0.09003 0.06109 0.10932 NPY5R NM_006174 0.02894 0.05145 0.00643 0.17042 0.01929 0.21222 HHATL NM_020707 0.00000 0.00322 0.06431 0.16399 0.01929 0.24116 TAAR8 NM_053278 0.11576 0.07717 0.12540 0.01608 0.14791 0.01286 ASB8 NM_024095 0.07717 0.08039 0.10932 0.00965 0.20900 0.01286 TTLL10 NM_001130045 0.20579 0.04180 0.08039 0.05788 0.06431 0.04823 ABCG4 NM_022169 0.00965 0.11254 0.10932 0.03537 0.17042 0.06109 BCL11B NM_138576 0.03859 0.17685 0.08039 0.07717 0.06109 0.06431 USP10 NM_001272075 0.10289 0.06431 0.13505 0.02572 0.14791 0.02251 TMEM182 NM_144632 0.23794 0.09003 0.09325 0.01608 0.05145 0.01286 VAMP2 NM_014232 0.08360 0.07717 0.03859 0.12862 0.05466 0.11897 ZNF135 NM_001289401 0.08360 0.16720 0.09325 0.03537 0.06431 0.05788 AP1S1 NM_001283 0.06431 0.09003 0.09646 0.05788 0.08360 0.10932 DSEL NM_032160 0.00000 0.22508 0.00000 0.12862 0.00322 0.14791 LDLRAD3 NM_174902 0.27974 0.00322 0.06431 0.02894 0.10289 0.02572 EIF5A NM_001143760 0.13505 0.11254 0.06109 0.08039 0.03537 0.08360 GNG11 NM_004126 0.13826 0.02251 0.17685 0.04180 0.07074 0.05788 MBNL3 NM_133486 0.06752 0.09646 0.11254 0.06109 0.10289 0.06752 UIMC1 NM_001199297 0.36334 0.11576 0.01286 0.00965 0.00000 0.00965 GCNT2 NM_145649 0.03859 0.28617 0.03859 0.04823 0.08682 0.01608 SHD NM_020209 0.00965 0.23151 0.00000 0.16399 0.00000 0.10932 SULT2B1 NM_177973 0.09003 0.08039 0.17685 0.01608 0.11576 0.03537 SRP54 NM_003136 0.09003 0.07717 0.07395 0.09325 0.05466 0.12862 ZNF605 NM_001164715 0.00000 0.17363 0.00000 0.09325 0.00965 0.24116 C9orf84 NM_173521 0.02251 0.13505 0.03859 0.05466 0.24116 0.02572 ADCYAP1 NM_001099733 0.12540 0.14148 0.07074 0.07074 0.05466 0.05788 ORIN1 NM_012363 0.03537 0.07395 0.13505 0.07074 0.16077 0.04502 SEPTIN9 NM_001113496 0.09003 0.03859 0.19936 0.00965 0.17363 0.01286 HAVCR1 NM_001173393 0.07717 0.14148 0.09325 0.05788 0.10289 0.05466 C3orf80 NM_001168214 0.04502 0.09646 0.03859 0.18006 0.06109 0.10611 TTC37 NM_014639 0.00000 0.10289 0.00322 0.06431 0.01929 0.33762 DDX43 NM_018665 0.01286 0.02251 0.06752 0.10289 0.10932 0.21222 ZNF277 NM_021994 0.00000 0.34405 0.03537 0.04502 0.07074 0.03859 AP3M1 NM_207012 0.33441 0.02251 0.03859 0.03215 0.06752 0.03859 TNFAIP8L2- NM_001204848 0.19936 0.17042 0.08039 0.02572 0.04823 0.01608 SCNM1 SMPDL3B NM_001009568 0.03859 0.15756 0.11254 0.07717 0.06431 0.09003 CORO1C NM_001105237 0.13826 0.01929 0.15113 0.04502 0.12862 0.05788 CDK2AP2 NM_001271849 0.04180 0.03859 0.17042 0.00965 0.27331 0.00965 RIMKLB NM_020734 0.09003 0.00322 0.19293 0.00000 0.25402 0.00322 TNS3 NM_022748 0.44051 0.00643 0.06431 0.00965 0.01929 0.00322 GATC NM_176818 0.08360 0.14469 0.09646 0.08682 0.10289 0.02894 SOCS3 NM_003955 0.08360 0.07395 0.12540 0.13183 0.07717 0.05466 C10orf105 NM_001164375 0.03537 0.16077 0.12540 0.03215 0.10932 0.08360 SSH3 NM_017857 0.09003 0.14791 0.02572 0.06431 0.03537 0.18650 LSP1 NM_001289005 0.00000 0.22186 0.00000 0.19936 0.02251 0.10932 YPEL5 NM_001127400 0.25080 0.07717 0.04823 0.05788 0.06431 0.05466 OBP2A NM_014582 0.11576 0.14148 0.07395 0.09325 0.04180 0.09003 TRIM5 NM_033092 0.11576 0.02894 0.15434 0.03537 0.20900 0.01286 SMIM24 NM_001136503 0.02572 0.13826 0.04180 0.15756 0.09325 0.09968 IL1RL2 NM_003854 0.14148 0.09646 0.09325 0.09325 0.06431 0.06752 KIF13A NM_001105568 0.15434 0.04180 0.08039 0.03537 0.12862 0.11897 IRX1 NM_024337 0.00965 0.00643 0.17363 0.03537 0.28296 0.05145 CD81 NM_004356 0.04823 0.15756 0.10289 0.02894 0.17363 0.04823 AHCYL1 NM_001242674 0.09003 0.24116 0.03859 0.06431 0.03859 0.09003 GPR26 NM_153442 0.30547 0.19614 0.03859 0.00965 0.00322 0.00965 RPL6 NM_000970 0.14791 0.00322 0.25402 0.00965 0.14148 0.00643 OR4C11 NM_001004700 0.13505 0.05145 0.13505 0.08360 0.06431 0.09325 ZNF408 NM_001184751 0.08360 0.07717 0.07074 0.15756 0.06752 0.10611 SLC26A8 NM_001193476 0.25402 0.00643 0.08039 0.07717 0.04180 0.10289 FMO3 NM_006894 0.06752 0.06752 0.16077 0.03215 0.22186 0.01286 HNRNPR NM_001102398 0.09325 0.06431 0.18971 0.02894 0.17363 0.01608 TPRN NM_001128228 0.10289 0.02894 0.12219 0.04502 0.15113 0.11576 CACNA2D2 NM_001174051 0.02572 0.14148 0.09325 0.05788 0.13826 0.10932 EFHC1 NM_001172420 0.06752 0.00322 0.18971 0.00965 0.28939 0.00965 TEC NM_003215 0.01929 0.07395 0.13505 0.04502 0.24437 0.05145 MSRB1 NM_016332 0.07717 0.23151 0.10611 0.03215 0.06431 0.06109 ZNF248 NM_001267606 0.03859 0.03215 0.15113 0.03859 0.24116 0.07395 PELP1 NM_014389 0.29260 0.07717 0.10611 0.00965 0.07717 0.01286 PROC NM_000312 0.13826 0.17042 0.07074 0.07717 0.06109 0.05788 NPB NM_148896 0.11576 0.13505 0.12540 0.02572 0.14791 0.02572 LTF NM_001199149 0.00322 0.18006 0.03859 0.15756 0.05466 0.14791 FBXO33 NM_203301 0.09003 0.08682 0.09968 0.06752 0.14791 0.09003 ZEB1 NM_001174096 0.24437 0.13183 0.04180 0.06431 0.01929 0.08039 MCL1 NM_021960 0.00000 0.20257 0.00000 0.17685 0.02894 0.17685 FOPNL NM_144600 0.09968 0.30547 0.03859 0.07074 0.01286 0.05788 UBE2L3 NM_001256355 0.04502 0.00643 0.09325 0.11254 0.16077 0.17042 SMARCA2 NM_001289397 0.01286 0.00643 0.00000 0.17363 0.01608 0.37942 TRIM62 NM_018207 0.02894 0.14148 0.07717 0.09968 0.05466 0.18650 UBXN7 NM_015562 0.04502 0.16077 0.19614 0.01286 0.16077 0.01608 ATF7IP NM_018179 0.04180 0.07717 0.04180 0.11897 0.03537 0.27653 ABI1 NM_001178116 0.08360 0.08682 0.11254 0.07074 0.13826 0.09968 EEFSEC NM_021937 0.09325 0.05145 0.14469 0.04823 0.20257 0.05466 USP7 NM_003470 0.07717 0.20579 0.08682 0.03215 0.14148 0.05145 TMPRSS9 NM_182973 0.16399 0.05466 0.09003 0.13505 0.07074 0.08039 C9orf92 NM_001271829 0.22830 0.00643 0.19293 0.00965 0.14791 0.01286 SAMD8 NM_144660 0.21865 0.01286 0.10611 0.05788 0.11576 0.08682 ZNF766 NM_001010851 0.12540 0.00965 0.19614 0.00965 0.25402 0.00643 DNAH5 NM_001369 0.12540 0.03215 0.19293 0.03537 0.18971 0.02572 GPS2 NM_004489 0.10289 0.19614 0.07074 0.07395 0.04823 0.10932 NFIC NM_205843 0.16399 0.00965 0.06752 0.11254 0.06109 0.18650 TERF2 NM_005652 0.41479 0.02894 0.09325 0.00965 0.04823 0.00965 HNRNPF NM_004966 0.15113 0.03537 0.20579 0.03215 0.11576 0.06431 NPFF NM_003717 0.02572 0.11576 0.03859 0.17685 0.06109 0.18650 CST4 NM_001899 0.07074 0.00643 0.22830 0.00965 0.28296 0.00965 FLOT2 NM_004475 0.16720 0.04502 0.00000 0.18650 0.00000 0.20900 PPP3R2 NM_147180 0.39871 0.02251 0.10611 0.00965 0.05466 0.01608 PLA2G4B NM_001114633 0.01929 0.20257 0.03859 0.13505 0.04823 0.16399 PGAP2 NM_001256235 0.06752 0.09646 0.08039 0.09646 0.13826 0.12862 ADRA2A NM_000681 0.08360 0.13183 0.09325 0.04502 0.14791 0.10932 C7orf26 NM_024067 0.03537 0.16720 0.11254 0.16077 0.06109 0.07395 AMER1 NM_152424 0.00000 0.29582 0.00000 0.13505 0.03215 0.14791 EOMES NM_005442 0.03537 0.04502 0.17685 0.07074 0.23794 0.04823 CYB5D2 NM_144611 0.08360 0.13183 0.09646 0.09968 0.09325 0.10932 RCOR3 NM_001136223 0.10289 0.20257 0.10932 0.02572 0.14791 0.02572 TBP NM_001172085 0.10289 0.04180 0.13505 0.02572 0.25723 0.05145 SLURP1 NM_020427 0.11576 0.05145 0.09003 0.15113 0.09325 0.11576 PLAG1 NM_001114635 0.01929 0.29904 0.00000 0.13826 0.00000 0.16077 ELP3 NM_018091 0.04180 0.29582 0.02572 0.09646 0.05788 0.09968 CTDNEP1 NM_001143775 0.02572 0.07717 0.03859 0.11897 0.15113 0.20900 PPAT NM_002703 0.31833 0.02894 0.08039 0.02894 0.15113 0.01286 RAPGEF6 NM_016340 0.18971 0.02894 0.18006 0.00965 0.20257 0.00965 TOP3B NM_001282113 0.09325 0.06109 0.08039 0.15434 0.06431 0.17042 MTARC2 NM_017898 0.03859 0.09003 0.02572 0.18971 0.05466 0.22508 ITGB1BP2 NM_012278 0.12540 0.18328 0.13183 0.04502 0.09003 0.05145 PLAA NM_001031689 0.01929 0.40514 0.02251 0.07717 0.05466 0.04823 ATP7A NM_000052 0.06752 0.13826 0.07074 0.13826 0.10289 0.10932 GDA NM_001242506 0.00643 0.45981 0.01286 0.04502 0.05466 0.05145 MPHOSPH8 NM_017520 0.12862 0.00643 0.19293 0.04502 0.23151 0.02572 TLE3 NM_020908 0.12540 0.00643 0.19936 0.00000 0.29904 0.00000 ADH5 NM_000671 0.06109 0.05788 0.10611 0.10932 0.13183 0.16399 RPS15A NM_001019 0.19936 0.03215 0.06752 0.10932 0.00643 0.21543 SH2D4B NM_001145719 0.09003 0.19293 0.03859 0.13826 0.06109 0.10932 SMARCAD1 NM_001254949 0.00322 0.14148 0.03859 0.17042 0.08682 0.19293 ALAS1 NM_199166 0.15434 0.00643 0.20900 0.03215 0.21865 0.01286 ATP6V0D2 NM_152565 0.03859 0.31833 0.04180 0.07074 0.05466 0.10932 IL20RB NM_144717 0.13505 0.03859 0.17363 0.00965 0.26367 0.01286 SOCS2 NM_001270467 0.39871 0.01929 0.08039 0.05145 0.04823 0.03859 MBD3L2 NM_144614 0.02572 0.02894 0.12540 0.05466 0.23794 0.16399 MTX3 NM_001167741 0.05466 0.07717 0.09325 0.14469 0.14791 0.11897 HIST1H2BK NM_080593 0.09325 0.14469 0.10611 0.03537 0.17363 0.08360 CTBP1 NM_001012614 0.10289 0.00322 0.22830 0.00000 0.29582 0.00643 KBTBD7 NM_032138 0.33441 0.08039 0.10611 0.03215 0.05788 0.02572 DNPEP NM_012100 0.00000 0.04502 0.00000 0.24759 0.00000 0.34727 EIF2B2 NM_014239 0.15756 0.18328 0.07395 0.05145 0.12540 0.04823 LRIT1 NM_015613 0.17685 0.13183 0.12540 0.06431 0.10289 0.03859 PACRG NM_001080378 0.02894 0.33441 0.04180 0.11254 0.05145 0.07074 LARP6 NM_001286679 0.29260 0.14148 0.08039 0.04502 0.05466 0.02572 MOB4 NM_015387 0.27653 0.01286 0.15113 0.02894 0.14791 0.02251 HAUS4 NM_001166269 0.32476 0.00643 0.16399 0.03215 0.06752 0.04823 RALGDS NM_001271774 0.39871 0.03859 0.02572 0.06431 0.04823 0.06752 ENY2 NM_001193557 0.03215 0.03859 0.19293 0.07395 0.20257 0.10289 HSD17B1 NM_000413 0.11576 0.03859 0.29904 0.05466 0.07717 0.05788 PAAF1 NM_001267803 0.06752 0.05466 0.04823 0.17363 0.05466 0.24759 THOP1 NM_003249 0.23794 0.13183 0.17685 0.00965 0.08039 0.00965 EXOC3L2 NM_138568 0.09325 0.07395 0.09968 0.03859 0.12862 0.21222 PRDX1 NM_001202431 0.00000 0.22508 0.00000 0.17363 0.03537 0.21222 BACE1 NM_138971 0.09325 0.23473 0.09646 0.02572 0.16077 0.03859 DYNC1I1 NM_001135556 0.37942 0.08039 0.09968 0.02894 0.03859 0.02251 FAM178B NM_001172667 0.06752 0.01929 0.25080 0.03215 0.24437 0.03537 PHKB NM_000293 0.03859 0.41479 0.01286 0.07395 0.04502 0.06752 TCF7L2 NM_001198529 0.00965 0.38264 0.03859 0.10611 0.01608 0.09968 CSAG1 NM_153478 0.07074 0.29260 0.11254 0.05788 0.09325 0.02572 AKAP6 NM_004274 0.18650 0.24759 0.09646 0.05466 0.05466 0.01608 POLD3 NM_006591 0.00965 0.23473 0.03859 0.17042 0.05466 0.14791 PCDHGB1 NM_018922 0.20579 0.06752 0.10611 0.06752 0.16077 0.05145 COL9A3 NM_001853 0.00000 0.06109 0.09968 0.07074 0.32154 0.10611 PMM1 NM_002676 0.06431 0.03859 0.17685 0.06752 0.24437 0.06752 TTLL3 NM_001025930 0.08360 0.14148 0.09325 0.17042 0.04823 0.12540 C6orf48 NM_001287484 0.16720 0.07717 0.16399 0.03537 0.15113 0.06752 SHCBP1 NM_024745 0.03859 0.07717 0.15113 0.07717 0.15756 0.16077 PLEKHM3 NM_001080475 0.16077 0.02894 0.17042 0.02572 0.24116 0.03537 BTK NM_000061 0.10932 0.07717 0.08360 0.15756 0.07717 0.16077 YES1 NM_005433 0.00000 0.09003 0.01286 0.25402 0.05466 0.25402 EIF4EBP1 NM_004095 0.06752 0.08039 0.16720 0.07717 0.10289 0.17042 DMPK NM_001081563 0.17363 0.00643 0.12219 0.06752 0.06109 0.23473 LMO2 NM_001142316 0.18650 0.17363 0.05466 0.13826 0.05466 0.05788 GHRHR NM_000823 0.04823 0.06752 0.03859 0.25402 0.04823 0.21222 ABHD8 NM_024527 0.01929 0.14148 0.03859 0.22186 0.05466 0.19293 RCN2 NM_002902 0.04180 0.08039 0.03859 0.21222 0.00322 0.29260 KIAA0247 NM_014734 0.09968 0.01286 0.36334 0.00965 0.17363 0.01286 EPC1 NM_001282391 0.00965 0.30547 0.11254 0.10932 0.06109 0.07395 VSIG10L NM_001163922 0.09968 0.02894 0.09325 0.16399 0.08039 0.20900 NBR1 NM_001291571 0.01286 0.09003 0.03859 0.17685 0.05466 0.30225 LZTR1 NM_006767 0.15434 0.29260 0.07717 0.04502 0.05466 0.05145 CA7 NM_005182 0.02572 0.19614 0.00000 0.18971 0.00965 0.25402 ACOT7 NM_181864 0.02572 0.11897 0.08039 0.17042 0.06109 0.21865 ATP2C1 NM_001199181 0.13505 0.07717 0.08682 0.15434 0.10289 0.11897 CD274 NM_014143 0.07717 0.00643 0.18971 0.02572 0.36334 0.01608 LEMD2 NM_181336 0.46624 0.03215 0.01286 0.04502 0.00000 0.12219 CLDN19 NM_001185117 0.14469 0.11576 0.15113 0.05788 0.17363 0.03537 ZNF728 NM_001267716 0.29904 0.18006 0.00000 0.07395 0.00000 0.12862 IHH NM_002181 0.03859 0.35691 0.07395 0.05788 0.10289 0.05145 RREB1 NM_001003699 0.08360 0.02572 0.19936 0.04502 0.25402 0.07717 CLCN3 NM_001243374 0.04823 0.30547 0.08039 0.13505 0.06431 0.05145 RNF150 NM_020724 0.32476 0.15434 0.03859 0.05788 0.03537 0.07395 CDC27 NM_001114091 0.04823 0.07717 0.11254 0.07074 0.32154 0.05788 IFIT3 NM_001549 0.02894 0.29260 0.04502 0.15756 0.04823 0.11576 POU2F3 NM_014352 0.12219 0.14791 0.12219 0.07395 0.15113 0.07074 KCNMA1 NM_001271518 0.18971 0.03215 0.17363 0.05788 0.14791 0.08682 HUS1B NM_148959 0.16720 0.03215 0.28296 0.00965 0.18650 0.01286 WARS2 NM_015836 0.00000 0.13183 0.00000 0.17685 0.00000 0.38264 KRT18 NM_199187 0.07074 0.22186 0.18971 0.03537 0.15756 0.01608 FAM217B NM_001190826 0.13505 0.17042 0.08039 0.13826 0.05466 0.11254 LYPD5 NM_001288763 0.29260 0.16077 0.12540 0.03537 0.05466 0.02251 CHMP2B NM_014043 0.00965 0.29260 0.03859 0.16720 0.06431 0.11897 AICDA NM_020661 0.03537 0.22508 0.03859 0.17685 0.03537 0.18006 EDARADD NM_080738 0.07074 0.09003 0.24116 0.05788 0.21865 0.01608 ZNF239 NM_005674 0.15434 0.03859 0.17685 0.04823 0.20257 0.07395 COQ6 NM_182480 0.25080 0.07717 0.16077 0.00643 0.18971 0.00965 RFPL2 NM_001098527 0.02572 0.19614 0.11254 0.13826 0.14791 0.07395 CCNI NM_006835 0.06431 0.14148 0.10611 0.13183 0.15113 0.09968 SPEG NM_001173476 0.12540 0.29260 0.14148 0.01608 0.10932 0.01286 FBXO15 NM_001142958 0.28939 0.00000 0.13183 0.00965 0.25402 0.01286 PHF3 NM_001290260 0.12219 0.09003 0.08360 0.15756 0.10289 0.14148 OR2C3 NM_198074 0.00965 0.29904 0.00643 0.22186 0.01286 0.14791 GNB4 NM_021629 0.03859 0.03859 0.22508 0.03537 0.30868 0.05145 HIST1H3G NM_003534 0.08360 0.14148 0.18006 0.03215 0.23473 0.02572 FXN NM_001161706 0.06752 0.07717 0.08039 0.17685 0.04823 0.25080 PIANP NM_001244015 0.08682 0.11576 0.00000 0.24116 0.00000 0.26045 PIGZ NM_025163 0.19936 0.02251 0.27974 0.00965 0.18650 0.00643 ANKRD45 NM_198493 0.08682 0.12219 0.18006 0.00965 0.29904 0.00643 MRPS15 NM_031280 0.13826 0.17363 0.07074 0.12219 0.09003 0.10932 SLC39A1 NM_001271960 0.26688 0.16399 0.07395 0.06752 0.06431 0.07074 KAZALD1 NM_030929 0.06431 0.14148 0.03859 0.17363 0.05466 0.23473 DDX1 NM_004939 0.09003 0.08682 0.19614 0.06431 0.22508 0.04823 WNT2B NM_004185 0.09003 0.03859 0.10932 0.24437 0.10289 0.12862 CTXN3 NM_001048252 0.08360 0.09646 0.15113 0.03537 0.30868 0.03859 GSN NM_001258030 0.33762 0.05145 0.09646 0.06752 0.07074 0.09003 USP22 NM_015276 0.38907 0.14148 0.08682 0.02572 0.04823 0.02251 LGALS9B NM_001042685 0.04180 0.06109 0.18971 0.08682 0.22508 0.10932 MSRB3 NM_001193460 0.03859 0.34405 0.09325 0.08039 0.08682 0.07395 ZNF354A NM_005649 0.16720 0.15756 0.16399 0.02572 0.18650 0.01608 TMEM184C NM_018241 0.03859 0.05145 0.18971 0.11254 0.19614 0.12862 PHF19 NM_001286840 0.27653 0.02251 0.09646 0.05466 0.18650 0.08039 P2RX1 NM_002558 0.12540 0.17042 0.06752 0.06752 0.18971 0.09646 CORO6 NM_032854 0.07074 0.13183 0.05788 0.17363 0.05466 0.22830 SLC7A6 NM_001076785 0.12862 0.03859 0.17685 0.07395 0.18971 0.11254 NDRG4 NM_022910 0.00322 0.30225 0.03859 0.15756 0.05788 0.16077 SLC16A3 NM_004207 0.16399 0.17042 0.12540 0.06431 0.13826 0.05788 MOSPD1 NM_019556 0.03859 0.03215 0.05788 0.27653 0.06752 0.24759 ASB4 NM_016116 0.25402 0.02894 0.18006 0.04823 0.15113 0.05788 PPM1G NM_177983 0.05466 0.24759 0.04502 0.18328 0.05145 0.14148 SERPINB8 NM_001276490 0.29260 0.00322 0.20579 0.01286 0.18650 0.02251 MROH6 NM_001100878 0.14469 0.22186 0.12219 0.12862 0.06431 0.04180 LTBP1 NM_001166266 0.15756 0.00643 0.17363 0.07395 0.09646 0.21543 SLCO5A1 NM_001146008 0.02251 0.02894 0.09325 0.20257 0.23794 0.14148 SOSTDC1 NM_015464 0.12862 0.00322 0.25402 0.02572 0.27974 0.03537 TVP23B NM_016078 0.00965 0.08039 0.00000 0.27974 0.01929 0.33762 IQCF2 NM_203424 0.14791 0.13183 0.19293 0.05788 0.14791 0.04823 CES3 NM_001185176 0.10289 0.22508 0.13505 0.05788 0.11576 0.09003 POU4F1 NM_006237 0.31190 0.17042 0.09646 0.03859 0.09968 0.01286 CCNT2 NM_058241 0.15756 0.03215 0.15113 0.06752 0.20900 0.11254 NDUFA5 NM_001282419 0.03859 0.24759 0.02572 0.23473 0.07717 0.10611 ZNF443 NM_005815 0.27653 0.14148 0.07717 0.06752 0.06109 0.10611 OCLN NM_001205255 0.00000 0.13183 0.08039 0.19614 0.05145 0.27331 PPP1R37 NM_019121 0.03537 0.39871 0.03859 0.09325 0.05466 0.11254 NKX2-1 NM_003317 0.01286 0.07717 0.27653 0.07395 0.22186 0.07074 ZNF283 NM_181845 0.19614 0.19614 0.17685 0.02894 0.08039 0.05466 PCDH1 NM_001278613 0.15113 0.08682 0.19936 0.03215 0.25402 0.01286 DCP1A NM_001290204 0.00322 0.16077 0.00000 0.27974 0.00000 0.29260 MXRA8 NM_001282582 0.25723 0.06752 0.12219 0.11897 0.07074 0.09968 INA NM_032727 0.01929 0.18650 0.00000 0.22186 0.00000 0.30868 CPEB1 NM_001079533 0.17685 0.21543 0.09646 0.06431 0.12540 0.05788 OR2D3 NM_001004684 0.04823 0.24759 0.03537 0.10932 0.05466 0.24437 KIAA1109 NM_015312 0.00965 0.14148 0.07074 0.15434 0.23151 0.13183 DPM3 NM_153741 0.32476 0.02894 0.17685 0.00965 0.18971 0.00965 ARL1 NM_001177 0.03537 0.18006 0.07717 0.19293 0.06752 0.18650 TMTC2 NM_152588 0.06431 0.11576 0.08039 0.16720 0.06109 0.25080 DAZAP2 NM_001136269 0.18971 0.17042 0.06431 0.15756 0.09325 0.06752 ART1 NM_004314 0.28939 0.00643 0.17685 0.05466 0.09325 0.12219 NMT2 NM_004808 0.00643 0.22508 0.00643 0.27653 0.01608 0.21222 TIMM23B NM_001290117 0.01286 0.04502 0.03859 0.25402 0.09968 0.29260 TDRD9 NM_153046 0.08360 0.33441 0.09968 0.06752 0.04823 0.10932 PTDSS2 NM_030783 0.03537 0.17042 0.01286 0.23473 0.04823 0.24437 ZNF764 NM_001172679 0.32476 0.02894 0.19293 0.03537 0.11576 0.04823 DEFB127 NM_139074 0.11576 0.34405 0.03859 0.07074 0.05466 0.12219 CNTN1 NM_001256064 0.15434 0.07717 0.18971 0.06752 0.19293 0.06431 PRKRA NM_001139518 0.52733 0.03859 0.10611 0.00965 0.05466 0.01286 HMMR NM_012484 0.40836 0.00643 0.20900 0.00965 0.10289 0.01286 ROPN1 NM_017578 0.01929 0.19614 0.00965 0.24437 0.04180 0.23794 MCF2L NM_001112732 0.06431 0.03215 0.15113 0.09646 0.15756 0.24759 NCDN NM_001014839 0.02572 0.27010 0.08039 0.16720 0.14148 0.06752 USP2 NM_001243759 0.14791 0.09646 0.19936 0.04823 0.19293 0.06752 KCNK2 NM_001017424 0.02894 0.37299 0.03859 0.13826 0.05466 0.11897 ATP6V0C NM_001694 0.03859 0.00322 0.25723 0.06431 0.28296 0.10611 SPTBN4 NM_025213 0.02251 0.34405 0.02572 0.17685 0.06431 0.11897 ITGB4 NM_001005619 0.03859 0.13826 0.11897 0.08682 0.24437 0.12862 RNF24 NM_001134338 0.09003 0.00643 0.23473 0.03215 0.33441 0.05788 NLGN4Y NM_014893 0.32476 0.14148 0.04180 0.11254 0.03537 0.10289 TRIM73 NM_198924 0.09003 0.16077 0.12540 0.13826 0.10289 0.14148 ELP2 NM_001242875 0.01929 0.16720 0.09646 0.16720 0.17363 0.13505 YTHDF1 NM_017798 0.00965 0.48232 0.07395 0.06752 0.06109 0.06431 CHD4 NM_001273 0.42444 0.02251 0.07717 0.06752 0.05145 0.11897 SOCS1 NM_003745 0.11576 0.09646 0.19614 0.05788 0.24116 0.05466 C20orf196 NM_152504 0.30547 0.03859 0.16399 0.05145 0.13826 0.06431 NMNAT2 NM_170706 0.28296 0.04502 0.09646 0.10611 0.10932 0.12219 AWAT2 NM_001002254 0.08682 0.03215 0.20579 0.01608 0.33441 0.09003 SLITRK1 NM_052910 0.08682 0.35370 0.18971 0.04823 0.07395 0.01286 TBX1 NM_080646 0.16077 0.07717 0.21543 0.01608 0.28617 0.00965 SLC28A3 NM_022127 0.04502 0.03859 0.12219 0.17042 0.13826 0.25080 NRG3 NM_001165973 0.02894 0.24759 0.10611 0.22186 0.07717 0.08682 RHOB NM_004040 0.42765 0.08039 0.15113 0.03537 0.03859 0.03537 PPCS NM_001287506 0.29260 0.07717 0.13505 0.07717 0.09646 0.09003 INHBC NM_005538 0.00000 0.17042 0.03859 0.24116 0.05466 0.26688 TOE1 NM_025077 0.10289 0.01286 0.19293 0.12862 0.16720 0.16720 LDHA NM_001165414 0.12862 0.13183 0.17363 0.13505 0.12862 0.07395 NAE1 NM_003905 0.29260 0.05145 0.15434 0.05788 0.16077 0.05788 COG4 NM_015386 0.28617 0.04502 0.08039 0.04502 0.24759 0.07395 DAO NM_001917 0.25402 0.23473 0.03859 0.07074 0.05145 0.12862 RNASEH2B NM_024570 0.27974 0.06752 0.19293 0.03537 0.18650 0.01608 NTRK3 NM_002530 0.24437 0.22508 0.12540 0.03215 0.13826 0.01286 TLX2 NM_016170 0.04502 0.24759 0.15434 0.03215 0.23794 0.06431 HTR5A NM_024012 0.12862 0.01929 0.20579 0.04502 0.24437 0.13826 GJB3 NM_001005752 0.18971 0.02251 0.09325 0.15756 0.10932 0.21222 CAV1 NM_001172896 0.15756 0.17363 0.09325 0.18971 0.07074 0.09968 ELMO1 NM_014800 0.27653 0.14148 0.10611 0.12219 0.01929 0.11897 LMO3 NM_001243610 0.13505 0.03215 0.19293 0.05466 0.28296 0.09003 EXOSC1 NM_016046 0.11576 0.17042 0.13505 0.07074 0.16720 0.12862 PRDM8 NM_020226 0.05466 0.32154 0.03859 0.06752 0.05466 0.25080 EPG5 NM_020964 0.04180 0.29260 0.04502 0.15756 0.10289 0.14791 ARSH NM_001011719 0.03859 0.25723 0.15434 0.07717 0.18650 0.07395 DEDD NM_001039711 0.03859 0.20257 0.03859 0.25723 0.03859 0.21222 DUSP22 NM_020185 0.10289 0.06431 0.13183 0.07395 0.18971 0.22508 KCNH2 NM_172056 0.02251 0.13826 0.04502 0.28939 0.07717 0.21543 TOX2 NM_001098797 0.11576 0.08682 0.08039 0.10611 0.28296 0.11897 PCDH11X NM_001168360 0.00965 0.20257 0.01286 0.25402 0.06109 0.25080 SPEN NM_015001 0.00000 0.22508 0.03859 0.22186 0.05466 0.25080 NSD1 NM_172349 0.02894 0.31190 0.12219 0.10932 0.13826 0.08039 EGR1 NM_001964 0.02572 0.33119 0.03859 0.17685 0.02572 0.19293 C16orf72 NM_014117 0.06431 0.26367 0.08360 0.17685 0.10289 0.09968 TBCCD1 NM_018138 0.10289 0.27010 0.14148 0.06431 0.07395 0.13826 WDR54 NM_032118 0.01929 0.11897 0.02251 0.26045 0.08039 0.28939 TENM3 NM_001080477 0.01929 0.17363 0.07074 0.13505 0.13826 0.25402 PIP4K2B NM_003559 0.16720 0.32154 0.15434 0.03537 0.10289 0.01286 LIN7C NM_018362 0.44051 0.03859 0.10611 0.04502 0.05466 0.10932 PCDP1 NM_001271049 0.19293 0.24759 0.12540 0.05788 0.07074 0.09968 NDUFS6 NM_004553 0.14148 0.32154 0.08360 0.07074 0.10289 0.07395 IQCA1 NM_001270585 0.03859 0.44373 0.07717 0.09646 0.06431 0.07395 GAR1 NM_032993 0.17685 0.33119 0.13183 0.06431 0.06431 0.02572 ZNF274 NM_133502 0.28617 0.09003 0.14469 0.01608 0.24759 0.01286 CACNA1B NM_001243812 0.15434 0.17042 0.15756 0.14469 0.12219 0.04823 DPH5 NM_015958 0.37299 0.07717 0.15434 0.03215 0.11576 0.04502 IL18RAP NM_003853 0.15756 0.35370 0.00322 0.16720 0.02894 0.09003 KBTBD12 NM_207335 0.09325 0.19614 0.18971 0.04502 0.24116 0.03537 PNOC NM_001284244 0.09003 0.02894 0.15434 0.25402 0.06431 0.20900 NFE2L2 NM_006164 0.27653 0.05788 0.18006 0.01608 0.24437 0.02572 F13B NM_001994 0.10289 0.08682 0.08039 0.18650 0.14148 0.20579 EXO1 NM_003686 0.38585 0.02251 0.13505 0.02894 0.18650 0.04502 HEY1 NM_001282851 0.17363 0.02894 0.19614 0.06752 0.27331 0.06431 CBLC NM_012116 0.14148 0.33441 0.00000 0.16720 0.06109 0.09968 VWA2 NM_001272046 0.08360 0.21865 0.17363 0.07717 0.16077 0.09325 ALDH3B2 NM_001031615 0.00643 0.29582 0.01286 0.17685 0.07074 0.24437 ZNF81 NM_007137 0.01929 0.22508 0.00000 0.27010 0.00000 0.29260 C10orf82 NM_144661 0.11576 0.09646 0.22508 0.15756 0.06431 0.14791 ENAH NM_018212 0.10289 0.05788 0.29260 0.03215 0.29904 0.02251 OR51A7 NM_001004749 0.35048 0.04180 0.19614 0.01608 0.16720 0.03859 CKAP5 NM_001008938 0.08682 0.16399 0.17685 0.07074 0.24437 0.06752 PHKA1 NM_001172436 0.00965 0.16077 0.00000 0.25402 0.01608 0.36977 RAI14 NM_001145520 0.09003 0.32797 0.03859 0.17685 0.05466 0.12219 SBSN NM_001166034 0.00643 0.16077 0.06752 0.23473 0.09646 0.24437 SHCBP1L NM_030933 0.12219 0.18650 0.11254 0.04502 0.26367 0.08039 NUDT7 NM_001243661 0.01929 0.50804 0.07717 0.06431 0.06752 0.07395 KCNIP2 NM_173193 0.11576 0.24116 0.15113 0.08360 0.10289 0.11897 CCDC84 NM_198489 0.41479 0.00322 0.18006 0.02894 0.16077 0.02572 SMIM13 NM_001135575 0.36334 0.00643 0.18971 0.00965 0.23794 0.00965 OR2T33 NM_001004695 0.05466 0.33119 0.12219 0.07395 0.16077 0.07395 DPPA5 NM_001025290 0.08039 0.04502 0.07074 0.27653 0.05466 0.28939 VDAC1 NM_003374 0.13826 0.13826 0.19614 0.04502 0.24437 0.05466 DNTTIP2 NM_014597 0.06431 0.08039 0.16077 0.10932 0.26367 0.13826 LYPLA1 NM_001279356 0.10932 0.22508 0.18971 0.04502 0.23794 0.01286 DEFB125 NM_153325 0.32154 0.03859 0.19614 0.07074 0.13183 0.06109 TEAD4 NM_003213 0.00000 0.34405 0.00322 0.18971 0.01929 0.26367 QARS NM_005051 0.00000 0.16077 0.03859 0.18650 0.14148 0.29260 SGCB NM_000232 0.00000 0.24759 0.00000 0.28296 0.00000 0.29260 YBEY NM_058181 0.12219 0.16077 0.06109 0.21543 0.05466 0.20900 TUSC5 NM_172367 0.09003 0.07717 0.19936 0.07395 0.31511 0.06752 TUSC3 NM_006765 0.11576 0.11897 0.22830 0.06431 0.25723 0.03859 SP100 NM_001206704 0.32476 0.01286 0.20900 0.02894 0.19293 0.05788 ADCK3 NM_020247 0.08360 0.16077 0.08039 0.03215 0.38264 0.08682 TCP11L1 NM_001145541 0.06752 0.22508 0.06752 0.18650 0.05466 0.22508 PODN NM_001199081 0.02251 0.29904 0.04180 0.22186 0.05466 0.18650 UBE2E1 NM_001202476 0.34405 0.01286 0.18006 0.06431 0.15113 0.07395 ZNF627 NM_145295 0.59164 0.01286 0.14148 0.02572 0.02894 0.02572 SYT15 NM_181519 0.13826 0.09646 0.19293 0.16399 0.05466 0.18006 PRMT7 NM_001290018 0.18650 0.18328 0.09646 0.11254 0.03537 0.21222 TAF6 NM_139315 0.48553 0.01286 0.17042 0.02572 0.12219 0.01286 APRT NM_000485 0.15434 0.13505 0.16720 0.09646 0.12862 0.14791 TNPO2 NM_001136195 0.42122 0.00643 0.22830 0.00000 0.17363 0.00000 Clorf100 NM_001276349 0.18328 0.33441 0.13505 0.06752 0.07074 0.03859 TMEM179 NM_001286389 0.01286 0.14469 0.03859 0.25402 0.06109 0.32154 AGPAT4 NM_020133 0.02572 0.14148 0.10611 0.16399 0.16720 0.22830 PLXDC2 NM_001282736 0.29582 0.23473 0.18006 0.02894 0.07074 0.02251 LDB3 NM_001171610 0.37299 0.19293 0.13183 0.07395 0.04823 0.01608 IER3 NM_003897 0.03859 0.09646 0.09325 0.27010 0.09968 0.24116 OR2J2 NM_030905 0.01929 0.03859 0.09646 0.16720 0.28296 0.23473 Clorf162 NM_174896 0.28296 0.05145 0.22830 0.02572 0.22508 0.02572 HBD NM_000519 0.12219 0.18328 0.07074 0.17685 0.14791 0.13826 NKIRAS2 NM_001144927 0.05466 0.24116 0.08039 0.18971 0.03859 0.23794 ADAL NM_001159280 0.06752 0.02251 0.15756 0.16720 0.24116 0.18650 PLS3 NM_001172335 0.02894 0.07717 0.10611 0.18650 0.24759 0.19614 FAM151B NM_205548 0.19293 0.17363 0.12219 0.18328 0.06109 0.10932 SH3TC1 NM_018986 0.04823 0.22508 0.03859 0.15756 0.05466 0.32154 LRP10 NM_014045 0.12540 0.07717 0.09646 0.18328 0.05466 0.30868 WARS NM_173701 0.09003 0.22508 0.10611 0.07717 0.16077 0.18650 KRT79 NM_175834 0.04823 0.07717 0.03859 0.30225 0.05788 0.32154 PRR5 NM_001017528 0.13826 0.39871 0.09325 0.06431 0.10289 0.04823 SERF2 NM_001199877 0.02572 0.29260 0.02572 0.25402 0.05466 0.19293 C9orf57 NM_001128618 0.18971 0.24759 0.05466 0.20579 0.05466 0.09646 ZNF711 NM_021998 0.00965 0.50161 0.00000 0.21543 0.00322 0.11897 PLCG1 NM_002660 0.02572 0.19614 0.15756 0.11254 0.28296 0.07395 SFRP2 NM_003013 0.25402 0.14148 0.24759 0.03215 0.15756 0.01608 TXLNA NM_175852 0.10932 0.02894 0.29582 0.02572 0.37621 0.01286 PRAC1 NM_032391 0.19293 0.20257 0.10611 0.03215 0.28939 0.02572 CNOT10 NM_001256742 0.09003 0.16720 0.13505 0.18328 0.14791 0.12862 SRY NM_003140 0.21865 0.00643 0.31190 0.04502 0.16077 0.10932 MBD2 NM_003927 0.18971 0.24759 0.18006 0.05145 0.16077 0.02251 EVL NM_016337 0.01286 0.20257 0.08039 0.22186 0.10932 0.22508 UBE4A NM_001204077 0.14791 0.11897 0.20900 0.07074 0.25402 0.05466 LAD1 NM_005558 0.08039 0.02894 0.07395 0.27653 0.08682 0.30868 REP15 NM_001029874 0.19936 0.16399 0.10611 0.12862 0.14148 0.11576 GNGT2 NM_001198754 0.03537 0.24759 0.08039 0.18006 0.07717 0.23473 IRGC NM_019612 0.38264 0.14148 0.19614 0.01608 0.10289 0.01608 TACR1 NM_001058 0.10289 0.22508 0.19293 0.15756 0.06431 0.11254 CRISP3 NM_001190986 0.03215 0.14148 0.00000 0.34084 0.01929 0.32154 POTEH NM_001136213 0.10289 0.29260 0.09968 0.14148 0.07717 0.14148 ZNF668 NM_024706 0.16720 0.19293 0.24759 0.01286 0.23151 0.00643 TACR2 NM_001057 0.03859 0.30547 0.07074 0.12862 0.18650 0.12862 FAM222B NM_001288633 0.15434 0.19614 0.10611 0.11576 0.08039 0.20579 GSDMB NM_001042471 0.28939 0.34405 0.06752 0.06431 0.04180 0.05145 ROS1 NM_002944 0.00322 0.19614 0.01286 0.29904 0.01929 0.32797 MAMSTR NM_001130915 0.08360 0.35691 0.07717 0.11254 0.09646 0.13505 SHISA5 NM_001272066 0.31833 0.09646 0.10611 0.07717 0.16077 0.10289 TRAF3IP1 NM_015650 0.07717 0.00322 0.22830 0.04502 0.37942 0.13183 PAM16 NM_016069 0.00000 0.16720 0.03859 0.24116 0.06109 0.35691 ATG4B NM_178326 0.02894 0.31511 0.03859 0.27974 0.05466 0.14791 ACKR1 NM_001122951 0.18971 0.06109 0.15756 0.14791 0.16077 0.14791 THOC7 NM_025075 0.17363 0.07717 0.20257 0.06431 0.25723 0.09003 RAB2A NM_002865 0.09325 0.24759 0.07074 0.23473 0.06109 0.16077 HNRNPF NM_001098204 0.02572 0.05788 0.09003 0.27974 0.06109 0.35370 SPRR1B NM_003125 0.36656 0.11576 0.19936 0.05145 0.06752 0.06752 RUNDC3B NM_138290 0.24437 0.28617 0.08360 0.10611 0.07717 0.07395 SPTBN2 NM_006946 0.09968 0.44373 0.04180 0.17685 0.05466 0.05466 AGK NM_018238 0.27974 0.16077 0.05788 0.15756 0.06752 0.14791 PTPRR NM_001207015 0.10932 0.08682 0.10611 0.21222 0.13826 0.21865 UGT1A9 NM_021027 0.00000 0.24759 0.04180 0.25723 0.09325 0.23473 ALPPL2 NM_031313 0.13826 0.04502 0.28617 0.07395 0.24116 0.09003 FOXI1 NM_012188 0.00000 0.37621 0.03859 0.15756 0.05145 0.25080 UHRF1BP1L NM_015054 0.03859 0.14148 0.01286 0.36977 0.03537 0.27653 EMC4 NM_001286420 0.28939 0.15756 0.15756 0.02572 0.22186 0.02251 SLC7A13 NM_138817 0.00000 0.22186 0.00643 0.28939 0.06431 0.29260 HABP4 NM_014282 0.43408 0.13183 0.19293 0.02572 0.07717 0.01608 LHX3 NM_178138 0.04502 0.18328 0.08039 0.24437 0.05466 0.27331 NREP NM_001142482 0.22830 0.10611 0.03537 0.20900 0.04180 0.26045 TAAR5 NM_003967 0.17363 0.25723 0.18971 0.07717 0.13183 0.05145 FAM69A NM_001252271 0.05466 0.24759 0.13505 0.18650 0.18650 0.07395 KDM2A NM_001256405 0.16399 0.36656 0.22830 0.04502 0.05466 0.02572 GTF2B NM_001514 0.12540 0.13826 0.16399 0.07395 0.28296 0.09968 PCDHB15 NM_018935 0.19936 0.13183 0.24759 0.00965 0.28296 0.01608 DUT NM_001025249 0.00000 0.22508 0.03859 0.28939 0.05466 0.27974 LRRC30 NM_001105581 0.30225 0.19293 0.20579 0.02251 0.14791 0.01608 NREP NM_001142483 0.29260 0.33441 0.00643 0.12862 0.00322 0.12219 KIAA0586 NM_001244189 0.34727 0.14148 0.07717 0.11897 0.05466 0.14791 AES NM_198969 0.17685 0.22508 0.10611 0.06431 0.27653 0.03859 COL11A1 NM_001190709 0.03215 0.33119 0.09646 0.13826 0.14148 0.14791 LSMEM2 NM_153215 0.13826 0.23151 0.05466 0.20257 0.05466 0.20900 CD72 NM_001782 0.15756 0.09646 0.07395 0.19614 0.22508 0.14148 IFNA10 NM_002171 0.12540 0.36334 0.08039 0.15756 0.04823 0.11897 MFSD5 NM_001170790 0.44051 0.07395 0.19293 0.00965 0.16720 0.01286 RBMXL2 NM_014469 0.10289 0.07717 0.27653 0.00965 0.42122 0.00965 OR5M3 NM_001004742 0.03859 0.36334 0.03859 0.21543 0.05466 0.18650 SCNN1G NM_001039 0.11576 0.11897 0.10611 0.25402 0.08682 0.21543 VHLL NM_001004319 0.34405 0.13183 0.06431 0.13826 0.05788 0.16077 VSIG4 NM_001100431 0.15434 0.44373 0.10611 0.07395 0.06431 0.05466 SOWAHC NM_023016 0.02251 0.13183 0.18006 0.22186 0.18650 0.15434 LMX1B NM_001174147 0.27653 0.00643 0.35048 0.00965 0.24437 0.01286 EBP NM_006579 0.05466 0.13183 0.00643 0.33441 0.01929 0.35370 NALCN NM_052867 0.06109 0.46624 0.00965 0.13826 0.01608 0.20900 WNK4 NM_032387 0.05466 0.35370 0.09646 0.13826 0.14791 0.10932 PANX1 NM_015368 0.04180 0.30547 0.03859 0.26688 0.06109 0.18650 AGPAT1 NM_032741 0.16399 0.14148 0.11576 0.10932 0.19293 0.17685 RPL26 NM_000987 0.04502 0.26688 0.04180 0.22508 0.07074 0.25402 PPP1R27 NM_001007533 0.28617 0.14148 0.15756 0.06752 0.07074 0.18006 GPBP1 NM_001127236 0.38585 0.04502 0.21543 0.02894 0.17363 0.05466 PLEC NM_201378 0.09003 0.08682 0.23473 0.10611 0.22186 0.16720 LARS NM_020117 0.30547 0.00322 0.19614 0.00965 0.37942 0.01286 HSF4 NM_001538 0.15756 0.07717 0.17685 0.10611 0.23794 0.15113 ARFGAP2 NM_032389 0.12219 0.08039 0.15434 0.17685 0.16077 0.21222 FAM96B NM_016062 0.14469 0.00643 0.29582 0.06431 0.25723 0.13826 NKX2-2 NM_002509 0.21865 0.09003 0.08039 0.19293 0.09325 0.23473 MEFV NM_001198536 0.43730 0.17042 0.17685 0.04502 0.03537 0.04502 TMEM56 NM_001199679 0.26045 0.00322 0.28617 0.06431 0.24116 0.05466 FZR1 NM_016263 0.08360 0.02251 0.21543 0.03859 0.38264 0.16720 TMEM170A NM_145254 0.32797 0.05466 0.17363 0.13826 0.09325 0.12219 OR2B2 NM_033057 0.44051 0.00322 0.28617 0.00965 0.16077 0.01286 ZNF331 NM_001079906 0.01286 0.13183 0.08039 0.27974 0.15756 0.25080 PGBD2 NM_170725 0.04823 0.30547 0.03859 0.24437 0.03859 0.23794 ARFIP2 NM_012402 0.29582 0.04502 0.19936 0.03537 0.28296 0.05466 EBF1 NM_024007 0.18971 0.24759 0.08039 0.12862 0.05466 0.21222 PRM1 NM_002761 0.00000 0.16077 0.10611 0.17363 0.35691 0.11576 ARHGAP26 NM_015071 0.22830 0.13183 0.12219 0.14148 0.15113 0.13826 AASDH NM_181806 0.15113 0.14148 0.19614 0.07395 0.29904 0.05145 CLN3 NM_001286104 0.28296 0.14148 0.17685 0.09646 0.14791 0.06752 PEX26 NM_001127649 0.00965 0.36334 0.07074 0.20257 0.14469 0.12540 ECSCR NM_001077693 0.02572 0.13183 0.17363 0.04502 0.49518 0.04502 ASGR2 NM_080913 0.38264 0.14148 0.19614 0.02572 0.12219 0.04823 MPPED2 NM_001584 0.11254 0.16077 0.19293 0.09646 0.21865 0.13505 FBXO7 NM_012179 0.05788 0.36977 0.03859 0.20257 0.03537 0.21222 CNGB3 NM_019098 0.29582 0.14148 0.08039 0.17685 0.04823 0.17363 GKAP1 NM_001135953 0.27653 0.09003 0.22830 0.04502 0.25723 0.02251 ITIH1 NM_001166434 0.15434 0.26367 0.08682 0.18006 0.09325 0.14148 C1QTNF3 NM_181435 0.01286 0.39871 0.02572 0.25402 0.05466 0.17363 FAM170A NM_182761 0.44051 0.06109 0.22830 0.05788 0.08682 0.04502 PHYHIP NM_001099335 0.14791 0.09646 0.29582 0.07395 0.20900 0.09646 PCTP NM_021213 0.10289 0.14148 0.09325 0.23151 0.13826 0.21222 OR5P2 NM_153444 0.09003 0.04502 0.32154 0.05466 0.35370 0.05788 ASIC3 NM_004769 0.08360 0.20257 0.27010 0.13183 0.17685 0.05788 SYNE3 NM_152592 0.51447 0.17685 0.12862 0.02572 0.06109 0.01608 NAT16 NM_198571 0.38264 0.07717 0.19293 0.05788 0.16077 0.05145 YOD1 NM_001276320 0.01929 0.34727 0.02572 0.20257 0.03537 0.29260 MANEA NM_024641 0.00000 0.37299 0.00000 0.25723 0.00000 0.29260 LTV1 NM_032860 0.34405 0.04502 0.26688 0.04502 0.18650 0.03859 ADAMTSL1 NM_001040272 0.02572 0.06431 0.00643 0.33762 0.01608 0.47588 AMER2 NM_152704 0.09003 0.34405 0.10611 0.08682 0.11576 0.18650 OR2W5 NM_001004698 0.24437 0.03215 0.22830 0.04502 0.34084 0.03859 PARP15 NM_001113523 0.09003 0.17042 0.03859 0.29582 0.04180 0.29260 PIK3C2G NM_001288772 0.10289 0.16399 0.08360 0.31190 0.05466 0.21222 LY6E NM_002346 0.47910 0.05145 0.29904 0.02572 0.05788 0.01608 PPT1 NM_000310 0.44373 0.03215 0.15756 0.03537 0.20257 0.05788 UPP1 NM_003364 0.12862 0.33119 0.17363 0.06431 0.19614 0.03537 ZBTB49 NM_145291 0.25080 0.22508 0.08039 0.17685 0.05466 0.14148 LOXL1 NM_005576 0.04823 0.31190 0.15756 0.11897 0.20900 0.08682 C17orf49 NM_001142798 0.39228 0.00322 0.27331 0.02572 0.18971 0.04823 DDX47 NM_016355 0.45659 0.02894 0.19936 0.00965 0.22508 0.01286 SERINC1 NM_020755 0.05788 0.22508 0.03859 0.31511 0.05788 0.23794 SP5 NM_001003845 0.03859 0.18006 0.03859 0.28939 0.05466 0.33119 FOXP3 NM_014009 0.12219 0.07717 0.17363 0.13505 0.17363 0.25080 PHF19 NM_001286843 0.08682 0.14148 0.12219 0.21543 0.20900 0.16077 SYNGR4 NM_012451 0.08682 0.46302 0.03859 0.18006 0.01286 0.15434 BTBD3 NM_014962 0.09968 0.23151 0.20579 0.08682 0.21865 0.09325 AATK NM_001080395 0.04823 0.35691 0.10611 0.15756 0.11897 0.14791 GPR128 NM_032787 0.23151 0.11576 0.08039 0.16399 0.15113 0.19293 ETFDH NM_001281738 0.02894 0.13826 0.04823 0.25723 0.06752 0.39550 ASB15 NM_080928 0.18650 0.20257 0.17363 0.07717 0.18650 0.10932 FOXP1 NM_001244808 0.15756 0.34727 0.08039 0.13826 0.06431 0.14791 CCDC34 NM_030771 0.04823 0.08682 0.28939 0.06431 0.33441 0.11576 CACFD1 NM_017586 0.12540 0.22186 0.03859 0.29260 0.04823 0.21222 RMDN1 NM_001286719 0.06431 0.21543 0.19293 0.07717 0.28296 0.10932 OPRL1 NM_000913 0.02251 0.14469 0.02572 0.28296 0.06109 0.40514 ZNF540 NM_152606 0.03859 0.36334 0.00000 0.22186 0.00000 0.32154 IQCD NM_138451 0.05145 0.56913 0.03859 0.13505 0.06752 0.08360 FAM9B NM_205849 0.11576 0.34405 0.08360 0.21222 0.08682 0.10289 ARHGAP25 NM_001166277 0.32797 0.16077 0.12540 0.14469 0.05788 0.12862 STC1 NM_003155 0.12219 0.11576 0.20579 0.02894 0.42765 0.04823 PPP2R2C NM_181876 0.34084 0.03859 0.22830 0.04502 0.24437 0.05145 CDRT1 NM_001282540 0.03859 0.39871 0.14791 0.11254 0.18971 0.06109 STK32B NM_018401 0.08682 0.19614 0.18328 0.13826 0.24437 0.09968 P2RY10 NM_014499 0.08360 0.11897 0.14791 0.24437 0.13183 0.22508 P2RX5 NM_001204519 0.01929 0.68489 0.05466 0.07395 0.10289 0.01608 B4GALT2 NM_003780 0.32797 0.08682 0.08039 0.17685 0.07717 0.20257 C16orf59 NM_025108 0.03859 0.42122 0.06752 0.18006 0.04823 0.19614 FOXD4 NM_207305 0.02251 0.32154 0.08039 0.21543 0.15113 0.16077 RPL10L NM_080746 0.06109 0.09646 0.05466 0.33762 0.02572 0.37621 PLS1 NM_001145319 0.09325 0.32797 0.03859 0.27974 0.05466 0.16077 GALE NM_001127621 0.07717 0.37942 0.03859 0.17685 0.04180 0.24116 RAB9B NM_016370 0.52090 0.00322 0.30225 0.01286 0.10289 0.01286 CREG2 NM_153836 0.37942 0.05788 0.22508 0.00322 0.28296 0.00643 MTFP1 NM_016498 0.09003 0.17042 0.19614 0.07717 0.30225 0.12219 GP1BB NM_000407 0.02251 0.35691 0.01286 0.43730 0.04823 0.08039 FLYWCH2 NM_001142499 0.17363 0.13183 0.08039 0.26367 0.04823 0.26045 MPI NM_002435 0.09003 0.16077 0.12219 0.21865 0.11576 0.25080 ZFP36L2 NM_006887 0.42444 0.03215 0.12540 0.13505 0.09325 0.14791 KCNJ15 NM_170736 0.10932 0.19293 0.08039 0.19936 0.15113 0.22508 KIF17 NM_001122819 0.02894 0.29582 0.04180 0.23473 0.06431 0.29260 SNRPB2 NM_003092 0.02894 0.32154 0.06431 0.29582 0.09968 0.14791 THBD NM_000361 0.12219 0.17042 0.15113 0.13826 0.18650 0.19293 TOMM34 NM_006809 0.00965 0.26045 0.03859 0.42444 0.06431 0.16399 PPARG NM_015869 0.11576 0.04502 0.15756 0.17363 0.30225 0.16720 GNG7 NM_052847 0.21865 0.45659 0.07395 0.07395 0.04823 0.09003 TMEM125 NM_144626 0.02251 0.30225 0.03859 0.28296 0.05466 0.26045 PSTK NM_153336 0.30225 0.13826 0.15756 0.05788 0.19614 0.10932 AMPD2 NM_001257361 0.23151 0.13183 0.18006 0.13183 0.08039 0.20900 ZNF648 NM_001009992 0.04823 0.29260 0.07395 0.25723 0.05466 0.23794 ETFA NM_001127716 0.29582 0.27010 0.12219 0.05145 0.16077 0.06431 ZMYM3 NM_001171162 0.41801 0.29582 0.09646 0.04502 0.05466 0.05466 ZNF827 NM_178835 0.06752 0.19293 0.35048 0.03215 0.28296 0.03859 SPAG8 NM_172312 0.00000 0.32797 0.00000 0.28939 0.01608 0.33119 PDIA6 NM_001282705 0.37942 0.24759 0.12540 0.07717 0.05466 0.08360 NTNG1 NM_001113228 0.34727 0.08039 0.08360 0.19614 0.04823 0.21222 SLC1A5 NM_001145145 0.10289 0.19293 0.09968 0.17042 0.24437 0.15756 ZC3H15 NM_018471 0.02894 0.01286 0.12540 0.26688 0.03537 0.50161 MRPL22 NM_014180 0.11897 0.03859 0.15434 0.27331 0.10932 0.27653 ORC6 NM_014321 0.04180 0.30547 0.03859 0.26688 0.05466 0.26367 HSPB7 NM_014424 0.09325 0.34405 0.17363 0.05145 0.29582 0.01286 IKZF4 NM_022465 0.03537 0.45659 0.17042 0.05466 0.22508 0.02894 FAM49A NM_030797 0.07717 0.23473 0.15434 0.03537 0.43087 0.03859 TBC1D16 NM_019020 0.09003 0.33441 0.19293 0.15756 0.09646 0.09968 C12orf77 NM_001101339 0.11576 0.02251 0.20900 0.15113 0.31511 0.16077 RAPGEF1 NM_198679 0.65273 0.09646 0.12540 0.03215 0.05145 0.01608 STEAP1B NM_207342 0.37621 0.16720 0.18971 0.00965 0.22186 0.00965 POLR3H NM_001018052 0.25402 0.05466 0.18006 0.11897 0.22186 0.14469 SHOC2 NM_007373 0.10289 0.16077 0.28939 0.03215 0.30225 0.08682 ECHDC2 NM_018281 0.10289 0.14148 0.14791 0.24437 0.07074 0.26688 KRTAP4-7 NM_033061 0.52090 0.14469 0.19936 0.02894 0.05466 0.02572 HELZ2 NM_033405 0.02251 0.30225 0.08039 0.18006 0.13826 0.25080 PDK2 NM_001199900 0.00965 0.04502 0.22830 0.07074 0.55949 0.06431 TBC1D21 NM_153356 0.29582 0.23151 0.13826 0.07717 0.16077 0.07395 GFPT2 NM_005110 0.02894 0.09325 0.17363 0.17685 0.25080 0.25402 MEX3A NM_001093725 0.28617 0.36013 0.03859 0.06752 0.14148 0.08682 PPP1R10 NM_002714 0.05466 0.33119 0.08039 0.23473 0.10932 0.17042 GPATCH3 NM_022078 0.38264 0.13183 0.19614 0.02894 0.20257 0.03859 SMIM14 NM_174921 0.00965 0.06752 0.03859 0.32476 0.06431 0.47588 MEF2A NM_005587 0.33762 0.22186 0.11897 0.03215 0.22186 0.04823 ZNF609 NM_015042 0.08360 0.17363 0.27010 0.07395 0.27331 0.10611 KIAA1377 NM_020802 0.37942 0.02894 0.27653 0.03215 0.24116 0.02251 RLTPR NM_001013838 0.02251 0.35691 0.04180 0.18650 0.06431 0.30868 GGA3 NM_001291642 0.27974 0.20257 0.12540 0.10611 0.16077 0.10932 ANK1 NM_001142446 0.44373 0.05145 0.31190 0.03215 0.12862 0.01608 SLC15A4 NM_145648 0.37942 0.07717 0.22186 0.00965 0.28296 0.01286 TMEM52 NM_178545 0.31833 0.22186 0.17042 0.05145 0.14791 0.07395 RTN2 NM_206900 0.42765 0.09003 0.19936 0.02894 0.22508 0.01286 RASGRP1 NM_001128602 0.06752 0.17042 0.11254 0.25723 0.14791 0.22830 YWHAZ NM_001135699 0.00965 0.33441 0.00000 0.35370 0.03537 0.25080 PRRX1 NM_006902 0.06431 0.11576 0.03859 0.40836 0.05466 0.30225 EFCAB2 NM_032328 0.37299 0.13183 0.03859 0.18650 0.06109 0.19293 ZNF185 NM_001178113 0.44695 0.07717 0.35048 0.02572 0.07395 0.00965 SP100 NM_003113 0.37621 0.36334 0.07395 0.06752 0.01608 0.09003 NCBP1 NM_002486 0.58199 0.11576 0.19293 0.01608 0.05466 0.02572 ASNSD1 NM_019048 0.31190 0.18328 0.27010 0.00965 0.20257 0.00965 SFT2D3 NM_032740 0.38264 0.07717 0.20900 0.02894 0.23794 0.05145 CYBB NM_000397 0.15756 0.22508 0.17042 0.18650 0.06109 0.18650 ST20- NM_001199760 0.29260 0.07717 0.29904 0.00965 0.29260 0.01608 MTHFS GABARAP NM_007278 0.10289 0.00322 0.36977 0.04823 0.41158 0.05145 KIF25 NM_030615 0.41158 0.22186 0.18971 0.07395 0.05466 0.03537 CNTNAP4 NM_033401 0.29260 0.02894 0.28939 0.00965 0.35370 0.01286 EPHA3 NM_182644 0.00000 0.20579 0.09325 0.27974 0.05466 0.35691 FIBP NM_004214 0.15756 0.22186 0.19293 0.11897 0.22508 0.07395 SLC7A11 NM_014331 0.10289 0.00322 0.36977 0.02894 0.43730 0.04823 MRPS17 NM_015969 0.34084 0.15113 0.14148 0.09646 0.13826 0.12219 FAM83B NM_001010872 0.09003 0.30547 0.04502 0.25402 0.04502 0.25402 BCOR NM_001123384 0.34405 0.06752 0.19936 0.13826 0.12219 0.12219 NKX3-2 NM_001189 0.42765 0.16720 0.08039 0.11254 0.06431 0.14148 CLTCL1 NM_001835 0.10289 0.08039 0.17042 0.21543 0.10289 0.32154 HOXB13 NM_006361 0.37942 0.14148 0.15756 0.07074 0.18650 0.05788 SLITRK6 NM_032229 0.01286 0.31190 0.03859 0.18006 0.05466 0.39871 VNN1 NM_004666 0.44373 0.05145 0.19293 0.07395 0.08682 0.14791 C9orf117 NM_001012502 0.04823 0.22186 0.24116 0.07717 0.33441 0.07395 RHPN1 NM_052924 0.03859 0.11576 0.03859 0.29582 0.10289 0.40514 VWA5A NM_014622 0.34405 0.00643 0.29582 0.03537 0.28939 0.02572 VEGFA NM_001171630 0.09003 0.16399 0.12540 0.32476 0.09968 0.19614 TMEM225 NM_001013743 0.10289 0.13183 0.12219 0.25402 0.14469 0.24437 INPP4B NM_003866 0.37942 0.16077 0.16399 0.04502 0.18650 0.06431 EID1 NM_014335 0.08360 0.11576 0.17685 0.11897 0.34727 0.15756 CDH19 NM_021153 0.05788 0.24759 0.10932 0.22186 0.12219 0.24116 COX6B2 NM_144613 0.12540 0.01286 0.34084 0.05788 0.42122 0.04180 SS18L1 NM_198935 0.29260 0.13183 0.13183 0.11897 0.13826 0.18650 CDKN2B NM_004936 0.14791 0.24759 0.15113 0.13826 0.22186 0.09325 ECHDC3 NM_024693 0.36656 0.08682 0.23151 0.06431 0.18971 0.06109 RIOK2 NM_018343 0.38907 0.15434 0.10611 0.06431 0.14791 0.13826 IGFBP4 NM_001552 0.27653 0.07395 0.08682 0.18971 0.09325 0.28296 TAF7L NM_024885 0.24437 0.17042 0.18971 0.11897 0.23151 0.04823 KRT83 NM_002282 0.27653 0.37299 0.08039 0.09325 0.07074 0.10932 HRH1 NM_001098212 0.44695 0.07717 0.13183 0.12862 0.06109 0.15756 PIN4 NM_001170747 0.41801 0.01286 0.19614 0.03537 0.28939 0.05145 CHRD NM_003741 0.14791 0.19293 0.20900 0.15434 0.18650 0.11254 PABPN1 NM_004643 0.18971 0.07717 0.17685 0.17685 0.21865 0.16399 TSSK3 NM_052841 0.04180 0.00322 0.45981 0.01608 0.43087 0.05466 OAF NM_178507 0.04823 0.34405 0.09325 0.27974 0.05466 0.18650 SPINK8 NM_001080525 0.28617 0.09325 0.19614 0.15756 0.09646 0.17685 CAPN1 NM_005186 0.12862 0.05145 0.29582 0.17685 0.24437 0.10932 HIGD1B NM_016438 0.02572 0.00643 0.29582 0.00965 0.65916 0.00965 TM7SF3 NM_016551 0.37621 0.20257 0.17042 0.02894 0.19293 0.03537 SYNCRIP NM_006372 0.03859 0.16077 0.13505 0.23473 0.14791 0.28939 OR4S2 NM_001004059 0.03859 0.13183 0.01286 0.38907 0.01608 0.42122 SLC2A8 NM_014580 0.28617 0.32154 0.22186 0.00965 0.16077 0.00965 MAGEB17 NM_001277307 0.13183 0.13183 0.09646 0.20579 0.28296 0.16077 PLA2G7 NM_001168357 0.37299 0.24759 0.08039 0.06752 0.04823 0.19293 PLK4 NM_001190799 0.02572 0.13505 0.03859 0.35048 0.09646 0.36334 HAUS6 NM_001270890 0.12540 0.21543 0.17685 0.11897 0.23794 0.13505 PEX3 NM_003630 0.15756 0.42122 0.15756 0.13505 0.06109 0.07717 PDXDC1 NM_001285448 0.00965 0.30547 0.04823 0.17042 0.16077 0.31833 NIPA1 NM_001142275 0.07074 0.41801 0.03859 0.22186 0.05466 0.20900 NFATC3 NM_173165 0.07074 0.30547 0.09325 0.24437 0.04823 0.25080 CAPN3 NM_173088 0.19936 0.06431 0.07395 0.25402 0.06109 0.36013 ZNF385B NM_001282725 0.03859 0.22508 0.19936 0.05466 0.43408 0.06431 ANAPC1 NM_022662 0.29260 0.13183 0.19614 0.11254 0.16077 0.12219 AKAP13 NM_001270546 0.29260 0.09646 0.04180 0.26367 0.03537 0.28617 C17orf67 NM_001085430 0.05145 0.16399 0.13183 0.25402 0.19293 0.22508 PHTF2 NM_001127358 0.04502 0.12219 0.15756 0.17685 0.24116 0.27653 SETDB2 NM_001160308 0.10289 0.33441 0.00322 0.38907 0.00322 0.18650 NBL1 NM_001278166 0.07717 0.30547 0.21543 0.06752 0.31833 0.03537 C6orf15 NM_014070 0.00000 0.53698 0.04180 0.22186 0.09646 0.12219 PLCB2 NM_001284297 0.02572 0.33441 0.18006 0.16720 0.17363 0.13826 CDK5RAP1 NM_016082 0.41801 0.13826 0.22186 0.03537 0.13826 0.06752 FBXO6 NM_018438 0.29260 0.30547 0.17042 0.05145 0.14791 0.05466 HIST1H1D NM_005320 0.46624 0.16077 0.18650 0.02894 0.12219 0.05788 FAM124B NM_024785 0.43730 0.07395 0.18971 0.06752 0.14148 0.11254 KRR1 NM_007043 0.15434 0.28617 0.01286 0.28939 0.01929 0.26045 ZNF93 NM_031218 0.22186 0.13826 0.22186 0.08682 0.22508 0.12862 ABHD13 NM_032859 0.08360 0.30547 0.13505 0.16399 0.18650 0.14791 DZIP1L NM_173543 0.69132 0.03859 0.14791 0.03537 0.06109 0.04823 HCRTR2 NM_001526 0.10611 0.00322 0.29582 0.05788 0.48553 0.07395 CUTC NM_015960 0.12540 0.22508 0.09325 0.25402 0.09325 0.23473 TRIM48 NM_024114 0.54984 0.07717 0.19614 0.02894 0.15756 0.01608 FBXO36 NM_174899 0.44051 0.16399 0.22830 0.06431 0.09003 0.03859 PIWIL2 NM_001135721 0.37621 0.19614 0.03859 0.17363 0.00000 0.24116 AKR1C1 NM_001353 0.06431 0.06431 0.15756 0.12862 0.39550 0.21543 TCP10L NM_144659 0.22186 0.22508 0.28939 0.03215 0.24437 0.01286 HNRNPL NM_001533 0.13505 0.36977 0.17685 0.07395 0.11576 0.15434 C2orf42 NM_017880 0.34084 0.13826 0.15113 0.13826 0.09968 0.15756 TMEM14B NM_001286489 0.43730 0.16399 0.19293 0.03215 0.18971 0.01286 TET2 NM_017628 0.07074 0.32154 0.12540 0.20257 0.12219 0.18650 ZNF233 NM_001207005 0.16399 0.02251 0.08039 0.31190 0.07074 0.37942 ARAP2 NM_015230 0.12219 0.14469 0.07395 0.26688 0.06752 0.35370 CCDC122 NM_144974 0.19614 0.14148 0.20900 0.07395 0.29904 0.10932 REC8 NM_001048205 0.11576 0.32476 0.00322 0.18006 0.01286 0.39550 TULP2 NM_003323 0.01929 0.23151 0.00322 0.35370 0.00000 0.42444 CD83 NM_004233 0.00965 0.49196 0.03859 0.20257 0.09646 0.19293 TAF3 NM_031923 0.12862 0.11897 0.19936 0.15756 0.28296 0.14791 TGFB1I1 NM_001042454 0.04502 0.07717 0.12219 0.11254 0.49839 0.18006 DMXL1 NM_005509 0.25080 0.16077 0.19293 0.06431 0.24437 0.12219 ART5 NM_001079536 0.04823 0.41801 0.10611 0.18650 0.07395 0.20257 URI1 NM_001252641 0.09003 0.30547 0.13505 0.14791 0.19614 0.16077 AHCYL2 NM_001130722 0.37621 0.00643 0.29582 0.05788 0.22508 0.07395 HIST1H3A NM_003529 0.01929 0.03215 0.00322 0.35370 0.06431 0.56270 KREMEN1 NM_032045 0.39871 0.10289 0.22186 0.03537 0.25402 0.02251 RB1CC1 NM_014781 0.07074 0.05466 0.23473 0.26688 0.16077 0.25080 UBA5 NM_024818 0.00000 0.24759 0.00643 0.26045 0.03537 0.48875 FAM65C NM_080829 0.01286 0.35691 0.10611 0.19936 0.15113 0.21222 ATP5A1 NM_001001937 0.28617 0.16077 0.18328 0.12862 0.20900 0.07395 UHRF1 NM_001290050 0.57235 0.01286 0.12219 0.07395 0.13183 0.12862 CPNE4 NM_153429 0.39228 0.03859 0.31833 0.03537 0.24116 0.01608 RASSF3 NM_178169 0.05466 0.20257 0.27010 0.01608 0.47267 0.02572 PARP12 NM_022750 0.07074 0.57556 0.03859 0.15756 0.05145 0.14791 CCT4 NM_001256721 0.17685 0.19293 0.16399 0.04502 0.28296 0.18006 LMNA NM_001257374 0.00000 0.14148 0.00000 0.42122 0.00000 0.47910 RPN1 NM_002950 0.17363 0.22508 0.09325 0.15756 0.14791 0.24437 ZNF718 NM_001039127 0.23151 0.09003 0.12862 0.18006 0.21865 0.19293 PLP1 NM_001128834 0.06431 0.21222 0.09646 0.30225 0.07717 0.28939 MED23 NM_001270521 0.29260 0.05466 0.32154 0.01608 0.33441 0.02572 PSMA5 NM_001199774 0.17685 0.11576 0.28617 0.04502 0.38264 0.03859 HCFC1R1 NM_001288668 0.06431 0.24437 0.10611 0.21543 0.05466 0.36013 RNF31 NM_017999 0.10289 0.16077 0.18971 0.15756 0.21543 0.21865 NTRK2 NM_001018064 0.02572 0.15434 0.13505 0.27653 0.17363 0.27974 ZIC1 NM_003412 0.06431 0.47910 0.08039 0.17363 0.06109 0.18650 MME NM_007287 0.01286 0.22508 0.18971 0.17685 0.25402 0.18650 IFIT3 NM_001289759 0.46945 0.17042 0.11897 0.09646 0.10289 0.09003 ORC4 NM_002552 0.04180 0.35691 0.18971 0.16720 0.21222 0.08039 DMD NM_004006 0.05466 0.20257 0.08039 0.32797 0.03537 0.34727 KRI1 NM_023008 0.10289 0.17042 0.20900 0.17685 0.24437 0.14469 ZNF813 NM_001004301 0.18971 0.01286 0.33119 0.03537 0.44051 0.03859 HOXA10 NM_018951 0.10289 0.14148 0.26688 0.04823 0.41801 0.07074 SEH1L NM_031216 0.53055 0.02894 0.19293 0.00965 0.26367 0.02251 COMMD9 NM_014186 0.20579 0.33441 0.16399 0.04502 0.21865 0.08360 GLYATL1 NM_001220494 0.24437 0.07717 0.19614 0.10289 0.34727 0.08360 RBBP9 NM_006606 0.38264 0.00322 0.19293 0.03537 0.34727 0.09003 AXIN1 NM_003502 0.10289 0.02894 0.02251 0.36977 0.05145 0.47588 OBSL1 NM_015311 0.05788 0.51125 0.00000 0.23151 0.00000 0.25080 HACE1 NM_020771 0.14469 0.00322 0.44695 0.00965 0.43730 0.01286 MAB21L2 NM_006439 0.02251 0.36977 0.00322 0.26367 0.00322 0.39228 SARDH NM_007101 0.07717 0.48875 0.09646 0.17042 0.06752 0.15434 HTR2B NM_000867 0.10289 0.24437 0.10611 0.25723 0.09968 0.24437 PLS1 NM_002670 0.03859 0.29904 0.11897 0.23473 0.10289 0.26045 PCP4 NM_006198 0.06431 0.17363 0.11897 0.29582 0.15113 0.25080 LRP4 NM_002334 0.15434 0.16399 0.19614 0.17363 0.26367 0.10611 ZNF432 NM_014650 0.06431 0.48232 0.17685 0.07395 0.20900 0.05145 FAM114A2 NM_018691 0.05788 0.28617 0.00322 0.36656 0.05145 0.29260 ARMC7 NM_024585 0.08360 0.09646 0.12540 0.18650 0.35370 0.21222 MFN1 NM_033540 0.07074 0.04502 0.18971 0.20257 0.28939 0.26045 C12orf74 NM_001178097 0.17363 0.02251 0.40193 0.02894 0.41801 0.01286 PTCH1 NM_000264 0.10932 0.07717 0.18006 0.17042 0.40193 0.12219 PELI1 NM_020651 0.25080 0.09003 0.20579 0.16720 0.20900 0.13826 RPS10 NM_001203245 0.08682 0.55949 0.01286 0.23151 0.01929 0.15113 ISYNA1 NM_016368 0.12540 0.20579 0.18971 0.17042 0.24437 0.12862 QRSL1 NM_018292 0.34084 0.03215 0.31190 0.01608 0.34727 0.01608 PNPLA1 NM_001145717 0.12862 0.33441 0.09646 0.17042 0.15756 0.17685 CDC42SE2 NM_001038702 0.08360 0.08039 0.24116 0.10611 0.34084 0.21222 FER1L6 NM_001039112 0.02894 0.42122 0.00322 0.27974 0.02894 0.30225 BSG NM_198589 0.00000 0.23151 0.00000 0.38907 0.00000 0.44373 KIF21B NM_001252100 0.27653 0.13505 0.11254 0.13826 0.14791 0.25402 RNF19A NM_183419 0.13505 0.21543 0.10611 0.23151 0.06431 0.31190 ZSWIM7 NM_001042698 0.16720 0.07717 0.19614 0.07717 0.43087 0.11897 KIAA0020 NM_014878 0.29582 0.13183 0.13183 0.20257 0.10289 0.20257 BCL2A1 NM_001114735 0.18971 0.03215 0.17685 0.16399 0.15113 0.35370 RBMX NM_001164803 0.00965 0.14148 0.12540 0.29904 0.12540 0.36656 ARHGEF26 NM_001251963 0.38585 0.02894 0.35691 0.02894 0.25402 0.01286 MLLT10 NM_004641 0.27653 0.07717 0.15113 0.13505 0.14791 0.27974 AGAP11 NM_133447 0.12540 0.29260 0.20900 0.18971 0.10289 0.14791 ZNF260 NM_001166037 0.42444 0.16720 0.09325 0.13505 0.09003 0.16077 SPPL2C NM_175882 0.18650 0.05145 0.27010 0.05145 0.44051 0.07074 COL8A1 NM_001850 0.08360 0.41801 0.01286 0.29260 0.01286 0.25080 RCAN1 NM_001285392 0.15434 0.17042 0.17685 0.22186 0.16077 0.18650 TNFRSF10A NM_003844 0.25723 0.13183 0.13505 0.12862 0.23151 0.18650 ERCC5 NM_000123 0.05145 0.17042 0.13183 0.27974 0.18971 0.25080 MTFR1 NM_001145839 0.29582 0.07717 0.03859 0.28296 0.01608 0.36334 MSL2 NM_001145417 0.11254 0.30547 0.19614 0.03537 0.23794 0.18650 PLAC1 NM_021796 0.39228 0.03859 0.31511 0.02572 0.28939 0.01286 MS4A6E NM_139249 0.33441 0.22508 0.20257 0.06431 0.16077 0.08682 ATP8B3 NM_138813 0.25080 0.53055 0.03859 0.07717 0.02894 0.14791 LSP1 NM_001013253 0.44373 0.00322 0.32154 0.00965 0.28617 0.01286 TNNT1 NM_003283 0.71061 0.01286 0.19293 0.00965 0.13826 0.01286 C11orf45 NM_145013 0.23794 0.07395 0.19936 0.15756 0.24437 0.16399 CRIM1 NM_016441 0.29582 0.04180 0.18006 0.15756 0.16720 0.23473 SLC35G6 NM_001102614 0.13826 0.22508 0.09003 0.28296 0.04823 0.29260 TRMT12 NM_017956 0.18650 0.29260 0.22830 0.05788 0.22508 0.08682 ADO NM_032804 0.02572 0.14791 0.07395 0.45338 0.08682 0.28939 SUPT3H NM_001261823 0.27653 0.11576 0.16077 0.17042 0.20900 0.14791 POU6F1 NM_002702 0.03537 0.05145 0.15434 0.27653 0.28296 0.27974 SLC29A1 NM_001078176 0.02894 0.16077 0.03859 0.42444 0.05466 0.37299 C1QTNF7 NM_001135170 0.04180 0.34405 0.10611 0.22186 0.07717 0.28939 ST3GAL4 NM_006278 0.12540 0.03215 0.28617 0.04823 0.42122 0.17042 OSTF1 NM_012383 0.32476 0.05145 0.03859 0.27974 0.06431 0.32476 ZNF215 NM_013250 0.06431 0.14791 0.01286 0.33762 0.16077 0.36013 DCAF15 NM_138353 0.29582 0.16077 0.20579 0.07074 0.30225 0.04823 ZFP41 NM_173832 0.08360 0.13826 0.24437 0.18650 0.24437 0.18650 GRHL3 NM_021180 0.02894 0.23151 0.03859 0.29260 0.07074 0.42122 MMS19 NM_022362 0.37299 0.05788 0.28939 0.04502 0.24437 0.07395 SMAD7 NM_001190822 0.03859 0.39871 0.08039 0.18650 0.09325 0.28939 BORA NM_001286746 0.10289 0.23473 0.20257 0.13826 0.24437 0.16399 C6orf1 NM_001287397 0.27653 0.13183 0.19936 0.13505 0.25402 0.09003 PSME2 NM_002818 0.12540 0.32476 0.15113 0.20257 0.07074 0.21222 CCL17 NM_002987 0.62701 0.20257 0.10611 0.02894 0.05466 0.06752 SYT17 NM_016524 0.00000 0.57878 0.00000 0.25723 0.00000 0.25080 FBXL19 NM_001282351 0.44695 0.13183 0.20579 0.06431 0.17363 0.06431 C2CD4C NM_001136263 0.33762 0.09003 0.29904 0.08360 0.11576 0.16399 ALDOC NM_005165 0.04823 0.31511 0.14469 0.18006 0.16720 0.23473 SDF2L1 NM_022044 0.15434 0.23151 0.22830 0.07395 0.23794 0.16399 SMIM11 NM_058182 0.27653 0.24759 0.04180 0.20257 0.09968 0.22186 MRAS NM_001085049 0.13505 0.14791 0.31190 0.03537 0.41158 0.04823 ZNF469 NM_001127464 0.06431 0.16399 0.15113 0.17685 0.38585 0.14791 KIAA0391 NM_001256678 0.14469 0.06431 0.27653 0.18328 0.28296 0.13826 HSFX2 NM_001164415 0.28617 0.17685 0.20900 0.11897 0.17363 0.12862 PSMA5 NM_001199773 0.00000 0.42765 0.00000 0.53376 0.01286 0.11897 VNN3 NM_001291702 0.03859 0.54662 0.03859 0.24116 0.06431 0.16399 WDR47 NM_014969 0.27974 0.00965 0.26688 0.07395 0.35370 0.10932 SOD1 NM_000454 0.03537 0.16077 0.19614 0.23794 0.18971 0.27331 TADA2A NM_001166105 0.15434 0.02894 0.22830 0.23473 0.25402 0.19293 SMARCA2 NM_001289396 0.08360 0.60772 0.03859 0.24437 0.01929 0.09968 FOXP1 NM_001012505 0.32797 0.17042 0.22830 0.13826 0.13826 0.09003 CAPG NM_001747 0.03537 0.02894 0.04180 0.44373 0.04823 0.49518 NAT8 NM_003960 0.02572 0.06431 0.03859 0.43730 0.04180 0.48553 TRIM52 NM_032765 0.00965 0.11576 0.17363 0.18650 0.25080 0.35691 SHANK3 NM_033517 0.02251 0.49196 0.08039 0.25723 0.05466 0.18650 ZNF92 NM_152626 0.10289 0.22508 0.04180 0.33762 0.01929 0.36656 CELF6 NM_001172684 0.08682 0.35691 0.17042 0.18006 0.18650 0.11576 MRPS30 NM_016640 0.04180 0.32476 0.15113 0.18650 0.30547 0.08682 VAMP7 NM_005638 0.15113 0.22186 0.19936 0.17685 0.16077 0.18650 SLC8A2 NM_015063 0.04180 0.16720 0.17685 0.25402 0.20257 0.25402 C10orf25 NM_001039380 0.76206 0.17042 0.08039 0.04502 0.01608 0.02572 EHHADH NM_001966 0.10289 0.24759 0.13505 0.26688 0.16077 0.18650 TIAF1 NM_004740 0.24437 0.06109 0.34084 0.03215 0.39550 0.02572 DOCK10 NM_014689 0.12862 0.26367 0.29582 0.05788 0.24437 0.10932 NTPCR NM_032324 0.10289 0.34405 0.09325 0.21865 0.19293 0.14791 ABCC12 NM_033226 0.44373 0.00643 0.34405 0.03537 0.22508 0.04502 SIRT1 NM_001142498 0.25402 0.03215 0.20257 0.03537 0.47910 0.09968 ZDHHC8 NM_013373 0.03537 0.45016 0.16077 0.17685 0.16720 0.11254 PUM2 NM_015317 0.12540 0.22186 0.15756 0.10932 0.23473 0.25402 DCDC2B NM_001099434 0.11576 0.05145 0.28939 0.09646 0.44051 0.10932 RIOK1 NM_031480 0.13826 0.09003 0.27331 0.12862 0.29904 0.17363 IFI44L NM_006820 0.14469 0.24759 0.10611 0.19614 0.20900 0.20257 TP53AIP1 NM_001195194 0.43408 0.11254 0.12540 0.20257 0.06431 0.16720 TONSL NM_013432 0.44051 0.15756 0.18971 0.00965 0.29582 0.01286 MAEL NM_001286377 0.38907 0.02251 0.28617 0.03537 0.31511 0.05788 HCRTR1 NM_001525 0.02894 0.14148 0.00000 0.40193 0.02894 0.50482 SLC7A10 NM_019849 0.15434 0.07717 0.18971 0.18650 0.19614 0.30225 C8orf33 NM_023080 0.01929 0.21543 0.10611 0.34727 0.08039 0.33762 RGS12 NM_198227 0.37942 0.14148 0.19614 0.13826 0.14148 0.10932 SPTB NM_001024858 0.03537 0.44373 0.02572 0.29904 0.04180 0.26045 LYL1 NM_005583 0.00000 0.46302 0.10611 0.24116 0.15756 0.14148 CPA1 NM_001868 0.15756 0.19614 0.19614 0.13826 0.30225 0.11897 C12orf4 NM_020374 0.41801 0.00322 0.35370 0.02572 0.28296 0.02572 NFIX NM_001271043 0.32476 0.07717 0.24759 0.04823 0.36013 0.05466

    Pharmaceutical Formulations and Administration

    [0372] Also described herein are pharmaceutical formulations that can contain an amount, effective amount, and/or least effective amount, and/or therapeutically effective amount of one or more of the small molecules, RNAi therapeutics, vectors, recombinant polypeptides, gene editing systems, conjugated-antibodies, or engineered cells as described above, or a combination thereof (which are also referred to as the primary active agent or ingredient elsewhere herein) described in greater detail elsewhere herein a pharmaceutically acceptable carrier or excipient. As used herein, pharmaceutical formulation refers to the combination of an active agent, compound, or ingredient with a pharmaceutically acceptable carrier or excipient, making the composition suitable for diagnostic, therapeutic, or preventive use in vitro, in vivo, or ex vivo. As used herein, pharmaceutically acceptable carrier or excipient refers to a carrier or excipient that is useful in preparing a pharmaceutical formulation that is generally safe, non-toxic, and is neither biologically or otherwise undesirable, and includes a carrier or excipient that is acceptable for veterinary use as well as human pharmaceutical use. A pharmaceutically acceptable carrier or excipient as used in the specification and claims includes both one and more than one such carrier or excipient. When present, the compound can optionally be present in the pharmaceutical formulation as a pharmaceutically acceptable salt.

    [0373] In some embodiments, the active ingredient is present as a pharmaceutically acceptable salt of the active ingredient. As used herein, pharmaceutically acceptable salt refers to any acid or base addition salt whose counter-ions are non-toxic to the subject to which they are administered in pharmaceutical doses of the salts. Suitable salts include, hydrobromide, iodide, nitrate, bisulfate, phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucaronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, camphorsulfonate, napthalenesulfonate, propionate, malonate, mandelate, malate, phthalate, and pamoate.

    [0374] The pharmaceutical formulations described herein can be administered to a subject in need thereof via any suitable method or route to a subject in need thereof. Suitable administration routes can include, but are not limited to auricular (otic), buccal, conjunctival, cutaneous, dental, electro-osmosis, endocervical, endosinusial, endotracheal, enteral, epidural, extra-amniotic, extracorporeal, hemodialysis, infiltration, interstitial, intra-abdominal, intra-amniotic, intra-arterial, intra-articular, intrabiliary, intrabronchial, intrabursal, intracardiac, intracartilaginous, intracaudal, intracavernous, intracavitary, intracerebral, intracisternal, intracorneal, intracoronal (dental), intracoronary, intracorporus cavernosum, intradermal, intradiscal, intraductal, intraduodenal, intradural, intraepidermal, intraesophageal, intragastric, intragingival, intraileal, intralesional, intraluminal, intralymphatic, intramedullary, intrameningeal, intramuscular, intraocular, intraovarian, intrapericardial, intraperitoneal, intrapleural, intraprostatic, intrapulmonary, intrasinal, intraspinal, intrasynovial, intratendinous, intratesticular, intrathecal, intrathoracic, intratubular, intratumor, intratympanic, intrauterine, intravascular, intravenous, intravenous bolus, intravenous drip, intraventricular, intravesical, intravitreal, iontophoresis, irrigation, laryngeal, nasal, nasogastric, occlusive dressing technique, ophthalmic, oral, oropharyngeal, other, parenteral, percutaneous, periarticular, peridural, perineural, periodontal, rectal, respiratory (inhalation), retrobulbar, soft tissue, subarachnoid, subconjunctival, subcutaneous, sublingual, submucosal, topical, transdermal, transmucosal, transplacental, transtracheal, transtympanic, ureteral, urethral, and/or vaginal administration, and/or any combination of the above administration routes, which typically depends on the disease to be treated and/or the active ingredient(s).

    [0375] Where appropriate, compounds, molecules, compositions, vectors, vector systems, cells, or a combination thereof described in greater detail elsewhere herein can be provided to a subject in need thereof as an ingredient, such as an active ingredient or agent, in a pharmaceutical formulation. As such, also described are pharmaceutical formulations containing one or more of the compounds and salts thereof, or pharmaceutically acceptable salts thereof described herein. Suitable salts include, hydrobromide, iodide, nitrate, bisulfate, phosphate, isonicotinate, lactate, salicylate, acid citrate, tartrate, oleate, tannate, pantothenate, bitartrate, ascorbate, succinate, maleate, gentisinate, fumarate, gluconate, glucaronate, saccharate, formate, benzoate, glutamate, methanesulfonate, ethanesulfonate, benzenesulfonate, p-toluenesulfonate, camphorsulfonate, napthalenesulfonate, propionate, malonate, mandelate, malate, phthalate, and pamoate.

    [0376] In some embodiments, the subject in need thereof has or is suspected of having a Type-2 Diabetes or a symptom thereof. In some embodiments, the subject in need thereof has or is suspected of having, a metabolic disease or disorder, insulin resistance, or glucose intolerance, or a combination thereof. As used herein, agent refers to any substance, compound, molecule, and the like, which can be biologically active or otherwise can induce a biological and/or physiological effect on a subject to which it is administered to. As used herein, active agent or active ingredient refers to a substance, compound, or molecule, which is biologically active or otherwise, induces a biological or physiological effect on a subject to which it is administered to. In other words, active agent or active ingredient refers to a component or components of a composition to which the whole or part of the effect of the composition is attributed. An agent can be a primary active agent, or in other words, the component(s) of a composition to which the whole or part of the effect of the composition is attributed. An agent can be a secondary agent, or in other words, the component(s) of a composition to which an additional part and/or other effect of the composition is attributed.

    Pharmaceutically Acceptable Carriers and Secondary Ingredients and Agents

    [0377] The pharmaceutical formulation can include a pharmaceutically acceptable carrier. Suitable pharmaceutically acceptable carriers include, but are not limited to water, salt solutions, alcohols, gum arabic, vegetable oils, benzyl alcohols, polyethylene glycols, gelatin, carbohydrates such as lactose, amylose or starch, magnesium stearate, talc, silicic acid, viscous paraffin, perfume oil, fatty acid esters, hydroxy methylcellulose, and polyvinyl pyrrolidone, which do not deleteriously react with the active composition.

    [0378] The pharmaceutical formulations can be sterilized, and if desired, mixed with agents, such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, flavoring and/or aromatic substances, and the like which do not deleteriously react with the active compound.

    Effective Amounts

    [0379] In some embodiments, the amount of the primary active agent and/or optional secondary agent can be an effective amount, least effective amount, and/or therapeutically effective amount. As used herein, effective amount refers to the amount of the primary and/or optional secondary agent included in the pharmaceutical formulation that achieve one or more therapeutic effects or desired effect. As used herein, least effective amount refers to the lowest amount of the primary and/or optional secondary agent that achieves the one or more therapeutic or other desired effects. As used herein, therapeutically effective amount refers to the amount of the primary and/or optional secondary agent included in the pharmaceutical formulation that achieves one or more therapeutic effects.

    [0380] The effective amount, least effective amount, and/or therapeutically effective amount of the primary and optional secondary active agent described elsewhere herein contained in the pharmaceutical formulation can range from about 0 to 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, 990, 1000 pg, ng, ?g, mg, or g or be any numerical value with any of these ranges.

    [0381] In some embodiments, the effective amount, least effective amount, and/or therapeutically effective amount can be an effective concentration, least effective concentration, and/or therapeutically effective concentration, which can each range from about 0 to 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, 990, 1000 pM, nM, ?M, mM, or M or be any numerical value with any of these ranges.

    [0382] In other embodiments, the effective amount, least effective amount, and/or therapeutically effective amount of the primary and optional secondary active agent can range from about 0 to 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260, 270, 280, 290, 300, 310, 320, 330, 340, 350, 360, 370, 380, 390, 400, 410, 420, 430, 440, 450, 460, 470, 480, 490, 500, 510, 520, 530, 540, 550, 560, 570, 580, 590, 600, 610, 620, 630, 640, 650, 660, 670, 680, 690, 700, 710, 720, 730, 740, 750, 760, 770, 780, 790, 800, 810, 820, 830, 840, 850, 860, 870, 880, 890, 900, 910, 920, 930, 940, 950, 960, 970, 980, 990, 1000 IU or be any numerical value with any of these ranges.

    [0383] In some embodiments, the primary and/or the optional secondary active agent present in the pharmaceutical formulation can range from about 0 to 0.001, 0.002, 0.003, 0.004, 0.005, 0.006, 0.007, 0.008, 0.009, 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.1, 0.11, 0.12, 0.13, 0.14, 0.15, 0.16, 0.17, 0.18, 0.19, 0.2, 0.21, 0.22, 0.23, 0.24, 0.25, 0.26, 0.27, 0.28, 0.29, 0.3, 0.31, 0.32, 0.33, 0.34, 0.35, 0.36, 0.37, 0.38, 0.39, 0.4, 0.41, 0.42, 0.43, 0.44, 0.45, 0.46, 0.47, 0.48, 0.49, 0.5, 0.51, 0.52, 0.53, 0.54, 0.55, 0.56, 0.57, 0.58, 0.59, 0.6, 0.61, 0.62, 0.63, 0.64, 0.65, 0.66, 0.67, 0.68, 0.69, 0.7, 0.71, 0.72, 0.73, 0.74, 0.75, 0.76, 0.77, 0.78, 0.79, 0.8, 0.81, 0.82, 0.83, 0.84, 0.85, 0.86, 0.87, 0.88, 0.89, 0.9, 0.91, 0.92, 0.93, 0.94, 0.95, 0.96, 0.97, 0.98, 0.9, to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.1, 99.2, 99.3, 99.4, 99.5, 99.6, 99.7, 99.8, 99.9% w/w, v/v, or w/v of the pharmaceutical formulation.

    [0384] In some embodiments where a cell population is present in the pharmaceutical formulation (e.g., as a primary and/or or secondary active agent), the effective amount of cells can range from about 2 cells to 1?10.sup.1/mL, 1?10.sup.20/mL or more, such as about 1?10.sup.1/mL, 1?10.sup.2/mL, 1?10.sup.3/mL, 1?10.sup.4/mL, 1?10.sup.5/mL, 1?10.sup.6/mL, 1?10.sup.7/mL, 1?10.sup.8/mL, 1?10.sup.9/mL, 1?10.sup.10/mL, 1?10.sup.11/mL, 1?10.sup.12/mL, 1?10.sup.13/mL, 1?10.sup.14/mL, 1?10.sup.15/mL, 1?10.sup.16/mL, 1?10.sup.17/mL, 1?10.sup.18/mL, 1?10.sup.19/mL, to/or about 1?10.sup.20/mL.

    [0385] In some embodiments, the amount or effective amount, particularly where an infective particle is being delivered (e.g. a virus particle having the primary or secondary agent as a cargo), the effective amount of virus particles can be expressed as a titer (plaque forming units per unit of volume) or as a MOI (multiplicity of infection). In some embodiments, the effective amount can be 1?10.sup.1 particles per pL, nL, ?L, mL, or L to 1?10.sup.20/particles per pL, nL, ?L, mL, or L or more, such as about 1?10.sup.1, 1?10.sup.2, 1?10.sup.3, 1?10.sup.4, 1?10.sup.5, 1?10.sup.6, 1?10.sup.7, 1?10.sup.8, 1?10.sup.9, 1?10.sup.10, 1?10.sup.11, 1?10.sup.12, 1?10.sup.13, 1?10.sup.14, 1?10.sup.15, 1?10.sup.16, 1?10.sup.17, 1?10.sup.18, 1?10.sup.19, to/or about 1?10.sup.20 particles per pL, nL, ?L, mL, or L. In some embodiments, the effective titer can be about 1?10.sup.1 transforming units per pL, nL, ?L, mL, or L to 1?10.sup.20/transforming units per pL, nL, ?L, mL, or L or more, such as about 1?10.sup.1, 1?10.sup.2, 1?10.sup.3, 1?10.sup.4, 1?10.sup.5, 1?10.sup.6, 1?10.sup.7, 1?10.sup.8, 1?10.sup.9, 1?10.sup.10, 1?10.sup.11, 1?10.sup.12, 1?10.sup.13, 1?10.sup.14, 1?10.sup.15, 1?10.sup.16, 1?10.sup.17, 1?10.sup.18, 1?10.sup.19, to/or about 1?10.sup.20 transforming units per pL, nL, ?L, mL, or L. In some embodiments, the MOI of the pharmaceutical formulation can range from about 0.1 to 10 or more, such as 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, 1.9, 2, 2.1, 2.2, 2.3, 2.4, 2.5, 2.6, 2.7, 2.8, 2.9, 3, 3.1, 3.2, 3.3, 3.4, 3.5, 3.6, 3.7, 3.8, 3.9, 4, 4.1, 4.2, 4.3, 4.4, 4.5, 4.6, 4.7, 4.8, 4.9, 5, 5.1, 5.2, 5.3, 5.4, 5.5, 5.6, 5.7, 5.8, 5.9, 6, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, 7, 7.1, 7.2, 7.3, 7.4, 7.5, 7.6, 7.7, 7.8, 7.9, 8, 8.1, 8.2, 8.3, 8.4, 8.5, 8.6, 8.7, 8.8, 8.9, 9, 9.1, 9.2, 9.3, 9.4, 9.5, 9.6, 9.7, 9.8, 9.9, 10 or more.

    [0386] In some embodiments, the amount or effective amount of the one or more of the active agent(s) described herein contained in the pharmaceutical formulation can range from about 1 ?g/kg to about 10 mg/kg based upon the bodyweight of the subject in need thereof or average bodyweight of the specific patient population to which the pharmaceutical formulation can be administered.

    [0387] In embodiments where there is a secondary agent contained in the pharmaceutical formulation, the effective amount of the secondary active agent will vary depending on the secondary agent, the primary agent, the administration route, subject age, disease, stage of disease, among other things, which will be one of ordinary skill in the art.

    [0388] When optionally present in the pharmaceutical formulation, the secondary active agent can be included in the pharmaceutical formulation or can exist as a stand-alone compound or pharmaceutical formulation that can be administered contemporaneously or sequentially with the compound, derivative thereof, or pharmaceutical formulation thereof.

    [0389] In some embodiments, the effective amount of the secondary active agent can range from about 0 to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.1, 99.2, 99.3, 99.4, 99.5, 99.6, 99.7, 99.8, 99.9% w/w, v/v, or w/v of the total secondary active agent in the pharmaceutical formulation. In additional embodiments, the effective amount of the secondary active agent can range from about 0 to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.1, 99.2, 99.3, 99.4, 99.5, 99.6, 99.7, 99.8, 99.9% w/w, v/v, or w/v of the total pharmaceutical formulation.

    Dosage Forms

    [0390] In some embodiments, the pharmaceutical formulations described herein can be provided in a dosage form. The dosage form can be administered to a subject in need thereof. The dosage form can be effective generate specific concentration, such as an effective concentration, at a given site in the subject in need thereof. As used herein, dose, unit dose, or dosage can refer to physically discrete units suitable for use in a subject, each unit containing a predetermined quantity of the primary active agent, and optionally present secondary active ingredient, and/or a pharmaceutical formulation thereof calculated to produce the desired response or responses in association with its administration. In some embodiments, the given site is proximal to the administration site. In some embodiments, the given site is distal to the administration site. In some cases, the dosage form contains a greater amount of one or more of the active ingredients present in the pharmaceutical formulation than the final intended amount needed to reach a specific region or location within the subject to account for loss of the active components such as via first and second pass metabolism.

    [0391] The dosage forms can be adapted for administration by any appropriate route. Appropriate routes include, but are not limited to, oral (including buccal or sublingual), rectal, intraocular, inhaled, intranasal, topical (including buccal, sublingual, or transdermal), vaginal, parenteral, subcutaneous, intramuscular, intravenous, internasal, and intradermal. Other appropriate routes are described elsewhere herein. Such formulations can be prepared by any method known in the art.

    [0392] Dosage forms adapted for oral administration can discrete dosage units such as capsules, pellets or tablets, powders or granules, solutions, or suspensions in aqueous or non-aqueous liquids; edible foams or whips, or in oil-in-water liquid emulsions or water-in-oil liquid emulsions. In some embodiments, the pharmaceutical formulations adapted for oral administration also include one or more agents which flavor, preserve, color, or help disperse the pharmaceutical formulation. Dosage forms prepared for oral administration can also be in the form of a liquid solution that can be delivered as a foam, spray, or liquid solution. The oral dosage form can be administered to a subject in need thereof. Where appropriate, the dosage forms described herein can be microencapsulated.

    [0393] The dosage form can also be prepared to prolong or sustain the release of any ingredient. In some embodiments, compounds, molecules, compositions, vectors, vector systems, cells, or a combination thereof described herein can be the ingredient whose release is delayed. In some embodiments the primary active agent is the ingredient whose release is delayed. In some embodiments, an optional secondary agent can be the ingredient whose release is delayed. Suitable methods for delaying the release of an ingredient include, but are not limited to, coating or embedding the ingredients in material in polymers, wax, gels, and the like. Delayed release dosage formulations can be prepared as described in standard references such as Pharmaceutical dosage form tablets, eds. Liberman et. al. (New York, Marcel Dekker, Inc., 1989), RemingtonThe science and practice of pharmacy, 20th ed., Lippincott Williams & Wlkins, Baltimore, M D, 2000, and Pharmaceutical dosage forms and drug delivery systems, 6th Edition, Ansel et al., (Media, PA: Wlliams and Wlkins, 1995). These references provide information on excipients, materials, equipment, and processes for preparing tablets and capsules and delayed release dosage forms of tablets and pellets, capsules, and granules. The delayed release can be anywhere from about an hour to about 3 months or more.

    [0394] Examples of suitable coating materials include, but are not limited to, cellulose polymers such as cellulose acetate phthalate, hydroxypropyl cellulose, hydroxypropyl methylcellulose, hydroxypropyl methylcellulose phthalate, and hydroxypropyl methylcellulose acetate succinate; polyvinyl acetate phthalate, acrylic acid polymers and copolymers, and methacrylic resins that are commercially available under the trade name EUDRAGIT? (Roth Pharma, Westerstadt, Germany), zein, shellac, and polysaccharides.

    [0395] Coatings may be formed with a different ratio of water-soluble polymer, water insoluble polymers, and/or pH dependent polymers, with or without water insoluble/water soluble non-polymeric excipient, to produce the desired release profile. The coating is either performed on the dosage form (matrix or simple) which includes, but is not limited to, tablets (compressed with or without coated beads), capsules (with or without coated beads), beads, particle compositions, ingredient as is formulated as, but not limited to, suspension form or as a sprinkle dosage form.

    [0396] Where appropriate, the dosage forms described herein can be a liposome. In these embodiments, primary active ingredient(s), and/or optional secondary active ingredient(s), and/or pharmaceutically acceptable salt thereof where appropriate are incorporated into a liposome. In embodiments where the dosage form is a liposome, the pharmaceutical formulation is thus a liposomal formulation. The liposomal formulation can be administered to a subject in need thereof.

    [0397] Dosage forms adapted for topical administration can be formulated as ointments, creams, suspensions, lotions, powders, solutions, pastes, gels, sprays, aerosols, or oils. In some embodiments for treatments of the eye or other external tissues, for example the mouth or the skin, the pharmaceutical formulations are applied as a topical ointment or cream. When formulated in an ointment, a primary active ingredient, optional secondary active ingredient, and/or pharmaceutically acceptable salt thereof where appropriate can be formulated with a paraffinic or water-miscible ointment base. In other embodiments, the primary and/or secondary active ingredient can be formulated in a cream with an oil-in-water cream base or a water-in-oil base. Dosage forms adapted for topical administration in the mouth include lozenges, pastilles, and mouth washes.

    [0398] Dosage forms adapted for nasal or inhalation administration include aerosols, solutions, suspension drops, gels, or dry powders. In some embodiments, a primary active ingredient, optional secondary active ingredient, and/or pharmaceutically acceptable salt thereof where appropriate can be in a dosage form adapted for inhalation is in a particle-size-reduced form that is obtained or obtainable by micronization. In some embodiments, the particle size of the size reduced (e.g. micronized) compound or salt or solvate thereof, is defined by a D50 value of about 0.5 to about 10 microns as measured by an appropriate method known in the art. Dosage forms adapted for administration by inhalation also include particle dusts or mists. Suitable dosage forms wherein the carrier or excipient is a liquid for administration as a nasal spray or drops include aqueous or oil solutions/suspensions of an active (primary and/or secondary) ingredient, which may be generated by various types of metered dose pressurized aerosols, nebulizers, or insufflators. The nasal/inhalation formulations can be administered to a subject in need thereof.

    [0399] In some embodiments, the dosage forms are aerosol formulations suitable for administration by inhalation. In some of these embodiments, the aerosol formulation contains a solution or fine suspension of a primary active ingredient, secondary active ingredient, and/or pharmaceutically acceptable salt thereof where appropriate and a pharmaceutically acceptable aqueous or non-aqueous solvent. Aerosol formulations can be presented in single or multi-dose quantities in sterile form in a sealed container. For some of these embodiments, the sealed container is a single dose or multi-dose nasal or an aerosol dispenser fitted with a metering valve (e.g. metered dose inhaler), which is intended for disposal once the contents of the container have been exhausted.

    [0400] Where the aerosol dosage form is contained in an aerosol dispenser, the dispenser contains a suitable propellant under pressure, such as compressed air, carbon dioxide, or an organic propellant, including but not limited to a hydrofluorocarbon. The aerosol formulation dosage forms in other embodiments are contained in a pump-atomizer. The pressurized aerosol formulation can also contain a solution or a suspension of a primary active ingredient, optional secondary active ingredient, and/or pharmaceutically acceptable salt thereof. In further embodiments, the aerosol formulation also contains co-solvents and/or modifiers incorporated to improve, for example, the stability and/or taste and/or fine particle mass characteristics (amount and/or profile) of the formulation. Administration of the aerosol formulation can be once daily or several times daily, for example 2, 3, 4, or 8 times daily, in which 1, 2, 3 or more doses are delivered each time. The aerosol formulations can be administered to a subject in need thereof.

    [0401] For some dosage forms suitable and/or adapted for inhaled administration, the pharmaceutical formulation is a dry powder inhalable-formulations. In addition to a primary active agent, optional secondary active ingredient, and/or pharmaceutically acceptable salt thereof where appropriate, such a dosage form can contain a powder base such as lactose, glucose, trehalose, manitol, and/or starch. In some of these embodiments, a primary active agent, secondary active ingredient, and/or pharmaceutically acceptable salt thereof where appropriate is in a particle-size reduced form. In further embodiments, a performance modifier, such as L-leucine or another amino acid, cellobiose octaacetate, and/or metals salts of stearic acid, such as magnesium or calcium stearate. In some embodiments, the aerosol formulations are arranged so that each metered dose of aerosol contains a predetermined amount of an active ingredient, such as the one or more of the compositions, compounds, vector(s), molecules, cells, and combinations thereof described herein.

    [0402] Dosage forms adapted for vaginal administration can be presented as pessaries, tampons, creams, gels, pastes, foams, or spray formulations. Dosage forms adapted for rectal administration include suppositories or enemas. The vaginal formulations can be administered to a subject in need thereof.

    [0403] Dosage forms adapted for parenteral administration and/or adapted for injection can include aqueous and/or non-aqueous sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, solutes that render the composition isotonic with the blood of the subject, and aqueous and non-aqueous sterile suspensions, which can include suspending agents and thickening agents. The dosage forms adapted for parenteral administration can be presented in a single-unit dose or multi-unit dose containers, including but not limited to sealed ampoules or vials. The doses can be lyophilized and re-suspended in a sterile carrier to reconstitute the dose prior to administration. Extemporaneous injection solutions and suspensions can be prepared in some embodiments, from sterile powders, granules, and tablets. The parenteral formulations can be administered to a subject in need thereof.

    [0404] For some embodiments, the dosage form contains a predetermined amount of a primary active agent, secondary active ingredient, and/or pharmaceutically acceptable salt thereof where appropriate per unit dose. In an embodiment, the predetermined amount of primary active agent, secondary active ingredient, and/or pharmaceutically acceptable salt thereof where appropriate can be an effective amount, a least effect amount, and/or a therapeutically effective amount. In other embodiments, the predetermined amount of a primary active agent, secondary active agent, and/or pharmaceutically acceptable salt thereof where appropriate, can be an appropriate fraction of the effective amount of the active ingredient.

    Co-Therapies and Combination Therapies

    [0405] In some embodiments, the pharmaceutical formulation(s) described herein can be part of a combination treatment or combination therapy. The combination treatment can include the pharmaceutical formulation described herein and an additional treatment modality. The additional treatment modality can be a chemotherapeutic, a biological therapeutic, surgery, radiation, diet modulation, environmental modulation, a physical activity modulation, and combinations thereof.

    Administration of the Pharmaceutical Formulations

    [0406] The pharmaceutical formulations or dosage forms thereof described herein can be administered one or more times hourly, daily, monthly, or yearly (e.g. 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, or more times hourly, daily, monthly, or yearly). In some embodiments, the pharmaceutical formulations or dosage forms thereof described herein can be administered continuously over a period of time ranging from minutes to hours to days. Devices and dosages forms are known in the art and described herein that are effective to provide continuous administration of the pharmaceutical formulations described herein. In some embodiments, the first one or a few initial amount(s) administered can be a higher dose than subsequent doses. This is typically referred to in the art as a loading dose or doses and a maintenance dose, respectively. In some embodiments, the pharmaceutical formulations can be administered such that the doses over time are tapered (increased or decreased) overtime so as to wean a subject gradually off of a pharmaceutical formulation or gradually introduce a subject to the pharmaceutical formulation.

    [0407] As previously discussed, the pharmaceutical formulation can contain a predetermined amount of a primary active agent, secondary active agent, and/or pharmaceutically acceptable salt thereof where appropriate. In some of these embodiments, the predetermined amount can be an appropriate fraction of the effective amount of the active ingredient. Such unit doses may therefore be administered once or more than once a day, month, or year (e.g. 1, 2, 3, 4, 5, 6, or more times per day, month, or year). Such pharmaceutical formulations may be prepared by any of the methods well known in the art.

    [0408] Where co-therapies or multiple pharmaceutical formulations are to be delivered to a subject, the different therapies or formulations can be administered sequentially or simultaneously. Sequential administration is administration where an appreciable amount of time occurs between administrations, such as more than about 15, 20, 30, 45, 60 minutes or more. The time between administrations in sequential administration can be on the order of hours, days, months, or even years, depending on the active agent present in each administration. Simultaneous administration refers to administration of two or more formulations at the same time or substantially at the same time (e.g. within seconds or just a few minutes apart), where the intent is that the formulations be administered together at the same time.

    Viral Vector Formulation, Dosage, and Delivery

    [0409] Compositions of the invention may be formulated for delivery to human subjects, as well as to animals for veterinary purposes (e.g. livestock (cattle, pigs, others)), and other non-human mammalian subjects. The dosage of the formulation can be measured or calculated as viral particles or as genome copies (GC)/viral genomes (vg). Any method known in the art can be used to determine the genome copy (GC) number of the viral compositions of the invention. In one example embodiment, the viral compositions can be formulated in dosage units to contain an amount of viral vectors that is in the range of about 1.0?10.sup.9 GC to about 1.0?10.sup.15 GC (to treat an average subject of 70 kg in body weight), and preferably 1.0?10.sup.12 GC to 1.0?10.sup.14 GC for a human patient. Preferably, the dose of virus in the formulation is 1.0?10.sup.9 GC, 5.0?10.sup.9 GC, 1.0?10.sup.10 GC, 5.0?10.sup.10 GC, 1.0?10.sup.11GC, 5.0?10.sup.11 GC, 1.0?10.sup.12 GC, 5.0?10.sup.12 GC, or 1.0?10.sup.13 GC, 5.0?10.sup.13 GC, 1.0?10.sup.14 GC, 5.0?10.sup.14 GC, or 1.0?10.sup.15 GC.

    [0410] The viral vectors can be formulated in a conventional manner using one or more physiologically acceptable carriers or excipients. The viral vectors may be formulated for parenteral administration by injection (e.g. by bolus injection or continuous infusion). Formulations for injection may be presented in unit dosage form (e.g. in ampoules or in multi-dose containers) with an added preservative. The viral compositions may take such forms as suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain formulatory agents such as suspending, stabilizing, or dispersing agents. Liquid preparations of the viral vector formulations may be prepared by conventional means with pharmaceutically acceptable additives such as suspending agents (e.g. sorbitol syrup, cellulose derivatives or hydrogenated edible fats), emulsifying agents (e.g. lecithin or acacia), non-aqueous vehicles (e.g. almond oil, oily esters, ethyl alcohol or fractionated vegetable oils), and preservatives (e.g. methyl or propyl-p-hydroxybenzoates or sorbic acid). The preparations may also contain buffer salts. Alternatively, the compositions may be in powder form for constitution with a suitable vehicle (e.g. sterile pyrogen-free water) before use.

    Recombinant Protein Formulation, Dosage, and Delivery

    [0411] In one example embodiment, virus like particles (VLPs) are used to facilitate intracellular recombinant protein therapy (see, e.g., WO2020252455A1, U.S. Ser. No. 10/577,397B2). In certain embodiments, VLPs include a Gag-COBLL1 fusion protein. The Gag-COBLL1 fusion protein may include a matrix protein, a capsid protein, and/or a nucleocapsid protein covalently linked to COBLL1. In certain embodiments, the VLPs include a membrane comprising a phospholipid bilayer with one or more human endogenous retrovirus (HERV) derived ENV/glycoprotein(s) on the external side; a HERV-derived GAG protein in the VLP core, and a COBLL1 fusion protein on the inside of the membrane, wherein COBLL1 is fused to a human-endogenous GAG or other plasma membrane recruitment domain (see, e.g., WO2020252455A1). Fusion proteins can be obtained using standard recombinant protein technology.

    [0412] In one example embodiment, cell-penetrating peptides (CPPs) are used to facilitate intracellular recombinant protein therapy (see, e.g., Dinca A, Chien W-M, Chin M T. Intracellular Delivery of Proteins with Cell-Penetrating Peptides for Therapeutic Uses in Human Disease. International Journal of Molecular Sciences. 2016; 17(2):263). In certain embodiments, cell-penetrating peptides can be conjugated to COBLL1, for example, using standard recombinant protein technology. In certain embodiments, cell-penetrating peptides can be concurrently delivered with recombinant COBLL1.

    [0413] In one example embodiment, nanocarriers are used to facilitate intracellular recombinant protein therapy (see, e.g., Lee Y W, Luther D C, Kretzmann J A, Burden A, Jeon T, Zhai S, Rotello V M. Protein Delivery into the Cell Cytosol using Non-Viral Nanocarriers. Theranostics 2019; 9(11):3280-3292). Non-limiting nanocarriers include, but are not limited to nanoparticles (e.g., silica, gold), polymers, lipid based (e.g., cationic lipid within a polymer shell, lipid-like nanoparticles).

    [0414] The pharmaceutical composition of the invention may be administered locally or systemically. In a preferred embodiment, the pharmaceutical composition is administered near the tissue whose cells are to be transduced. In a particular embodiment, the pharmaceutical composition of the invention is administered locally to the subcutaneous adipose tissue, which is composed of varying amounts of the two different types of adipose tissue: white adipose tissue (WAT) that stores energy in the form of triacylglycerol (TAG) and brown adipose tissue (BAT) that dissipates energy as heat, burning fatty acids to maintain body temperature. In one example embodiment, the pharmaceutical composition of the invention is administered in the white adipose tissue (WAT) and/or in the brown adipose tissue (BAT) by intra-WAT or intra-BAT injection. In another preferred embodiment, the pharmaceutical composition of the invention is administered systemically.

    [0415] The adeno-associated virus (AAV) can be formulated with a physiologically acceptable carrier for use in gene transfer and gene therapy applications. The dosage of the formulation can be measured or calculated as viral particles or as genome copies (GC)/viral genomes (vg). Any method known in the art can be used to determine the genome copy (GC) number of the viral compositions of the invention. One method for performing AAV GC number titration is as follows: purified AAV vector samples are first treated with DNase to eliminate un-encapsulated AAV genome DNA or contaminating plasmid DNA from the production process. The DNase resistant particles are then subjected to heat treatment to release the genome from the capsid. The released genomes are then quantitated by real-time PCR using primer/probe sets targeting specific region of the viral genome.

    [0416] In any of the described methods the one or more vectors may be comprised in a delivery system. In any of the described methods the vectors may be delivered via liposomes, particles (e.g., nanoparticles), exosomes, microvesicles, a gene-gun. In any of the described methods viral vectors may be delivered by transduction of viral particles. The delivery systems may be administered systemically or by localized administration (e.g., direct injection). The term systemically administered and systemic administration, as used herein, means that the polynucleotides, vectors, polypeptides, or pharmaceutical compositions of the invention are administered to a subject in a non-localized manner. The systemic administration of the polynucleotides, vectors, polypeptides, or pharmaceutical compositions of the invention may reach several organs or tissues throughout the body of the subject or may reach specific organs or tissues of the subject. For example, the intravenous administration of a pharmaceutical composition of the invention may result in the transduction of more than one tissue or organ in a subject. The term transduce or transduction, as used herein, refers to the process whereby a foreign nucleotide sequence is introduced into a cell via a viral vector. The term transfection, as used herein, refers to the introduction of DNA into a recipient eukaryotic cell.

    [0417] Recombinant protein compositions described herein may be administered systemically (e.g., intravenously) or administered locally to adipose tissue (e.g., injection). In preferred embodiments, the recombinant protein compositions are administered with an appropriate carrier to be administered to a mammal, especially a human, preferably a pharmaceutically acceptable composition. A pharmaceutically acceptable composition refers to a non-toxic semisolid, liquid, or aerosolized filler, diluent, encapsulating material, colloidal suspension or formulation auxiliary of any type. Preferably, this composition is suitable for injection. These may be in particular isotonic, sterile, saline solutions (monosodium or disodium phosphate, sodium, potassium, calcium or magnesium chloride and similar solutions or mixtures of such salts), or dry, especially freeze-dried compositions which upon addition, depending on the case, of sterilized water or physiological saline, permit the constitution of injectable solutions.

    CRISPR-Cas Delivery

    [0418] The CRISPR-Cas systems disclosed herein may be delivered using vectors comprising polynucleotides encoding the Cas polypeptide and the guide molecule. For HDR based embodiments, the donor template may also be encoded on a vector. Vectors, dosages, and adipocyte-specific configurations suitable for delivery of these components include those discussed above.

    [0419] The vector(s) can include regulatory element(s), e.g., promoter(s). The vector(s) can comprise Cas encoding sequences, and/or a single, but possibly also can comprise at least 3 or 8 or 16 or 32 or 48 or 50 guide RNA(s) (e.g., sgRNAs) encoding sequences, such as 1-2, 1-3, 1-4 1-5, 3-6, 3-7, 3-8, 3-9, 3-10, 3-8, 3-16, 3-30, 3-32, 3-48, 3-50 RNA(s) (e.g., sgRNAs). In a single vector there can be a promoter for each RNA (e.g., sgRNA), advantageously when there are up to about 16 RNA(s); and, when a single vector provides for more than 16 RNA(s), one or more promoter(s) can drive expression of more than one of the RNA(s), e.g., when there are 32 RNA(s), each promoter can drive expression of two RNA(s), and when there are 48 RNA(s), each promoter can drive expression of three RNA(s). By simple arithmetic and well-established cloning protocols and the teachings in this disclosure one skilled in the art can readily practice the invention as to the RNA(s) for a suitable exemplary vector such as AAV, and a suitable promoter such as the U6 promoter. For example, the packaging limit of AAV is ?4.7 kb. The length of a single U6-gRNA (plus restriction sites for cloning) is 361 bp. Therefore, the skilled person can readily fit about 12-16, e.g., 13 U6-gRNA cassettes in a single vector. This can be assembled by any suitable means, such as a golden gate strategy used for TALE assembly (genome-engineering.org/taleffectors/). The skilled person can also use a tandem guide strategy to increase the number of U6-gRNAs by approximately 1.5 times, e.g., to increase from 12-16, e.g., 13 to approximately 18-24, e.g., about 19 U6-gRNAs. Therefore, one skilled in the art can readily reach approximately 18-24, e.g., about 19 promoter-RNAs, e.g., U6-gRNAs in a single vector, e.g., an AAV vector. A further means for increasing the number of promoters and RNAs in a vector is to use a single promoter (e.g., U6) to express an array of RNAs separated by cleavable sequences. And an even further means for increasing the number of promoter-RNAs in a vector is to express an array of promoter-RNAs separated by cleavable sequences in the intron of a coding sequence or gene; and, in this instance, it is advantageous to use a polymerase II promoter, which can have increased expression and enable the transcription of long RNA in a tissue specific manner. (See, e.g., Chung K H, Hart C C, Al-Bassam S, et al. Polycistronic RNA polymerase II expression vectors for RNA interference based on BIC/miR-155. Nucleic Acids Res. 2006; 34(7):e53). In an advantageous embodiment, AAV may package U6 tandem gRNA targeting up to about 50 genes. Accordingly, from the knowledge in the art and the teachings in this disclosure the skilled person can readily make and use vector(s), e.g., a single vector, expressing multiple RNAs or guides under the control or operatively or functionally linked to one or more promoters, especially as to the numbers of RNAs or guides discussed herein, without any undue experimentation.

    [0420] The Cas polypeptide and guide molecule (and donor) may also be delivered as a pre-formed ribonucleoprotein complex (RNP). Delivery methods for delivery RNPs include virus like particles, cell-penetrating peptides, and nanocarriers discussed above.

    [0421] Delivery mechanisms for CRISPRa systems include virus like particles, cell-penetrating peptides, and nanocarriers discussed above for CRISPR-Cas systems.

    Base Editing Delivery

    [0422] Base editing systems may deliver on one or more vectors encoding the Cas-nucleobase deaminase and guide sequence. Vector systems suitable for this purpose includes those discussed above. Alternatively, base editing systems may be delivered as pre-complex Ribonucleoprotein complex (RNP. Systems for delving RNPs include the protein delivery systems: virus like particles; cell-penetrating peptides; and nanocarriers, discuss above.

    [0423] A further example method for delivery of base-editing systems may include use of a split-intein approach to divide CBE and ABE into reconstitutable halves, is described in Levy et al. Nature Biomedical Engineering doi.org/10.1038/s41441-019-0505-5 (2019), which is incorporated herein by reference.

    Diagnostic and Theranostic Methods

    Methods of Predicting Response to Immunotherapy

    [0424] Provided herein are methods for determining if a subject will be responsive to an immunotherapy comprising detecting expression of one or more biomarkers from Table 2. Table 2 includes the list of 576 candidate genes and Gene Refseq accession numbers for each candidate gene. The candidate genes were enriched in the top 1% across at least two screening replicates for the MAGeCK (Table 1) and FDR (Table 3) analyses in either the acute or chronic screens. The biomarkers in Table 2 were identified as having increased expression in tumors that did not respond to immunotherapy. As used herein, the term responder refers to a subject that receives a benefit from an immunotherapy. As used herein, the term non-responder refers to a subject that does not receive a benefit from an immunotherapy. Responders and non-responders can also be determined based on progression (non-responder) or regression (responder) of a tumor in response to an immunotherapy. Responders and non-responders can be based on radiologic tumor assessments of progression or regression. Responders and non-responders can also be determined based on RECIST criteria: complete response (CR) and partial response (PR) for responders, or stable disease (SD) and progressive disease (PD) for non-responders (see, e.g., Eisenhauer, E. A. et al., 2009, New response evaluation criteria in solid tumours: revised RECIST guideline (version 1.1). Eur J Cancer 45, 228-247). Immunotherapy in this context is as defined at to above. Biomarkers in the context of the present invention encompasses, without limitation nucleic acids, proteins, reaction products, and metabolites, together with their polymorphisms, mutations, variants, modifications, subunits, fragments, and other analytes or sample-derived measures. In certain embodiments, biomarkers include the signature genes or signature gene products, and/or cells as described herein. By means of further explanation and without limitation the term diagnosis generally refers to the process or act of recognizing, deciding on or concluding on a disease or condition in a subject on the basis of symptoms and signs and/or from results of various diagnostic procedures (such as, for example, from knowing the presence, absence and/or quantity of one or more biomarkers characteristic of the diagnosed disease or condition).

    [0425] The terms prognosing or prognosis generally refer to an anticipation on the progression of a disease or condition and the prospect (e.g., the probability, duration, and/or extent) of recovery. A good prognosis of the diseases or conditions taught herein may generally encompass anticipation of a satisfactory partial or complete recovery from the diseases or conditions, preferably within an acceptable time period. A good prognosis of such may more commonly encompass anticipation of not further worsening or aggravating of such, preferably within a given time period. A poor prognosis of the diseases or conditions as taught herein may generally encompass anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or to substantially no recovery or even further worsening of such. In the context of the embodiments disclosed herein, the prognosis may refer to whether the subject will be a responder or non-responder.

    [0426] Applicants have identified that MCL1, BCL2A1, JUNB, B3GNT2 increase in expression in response to an immunotherapy. In an example embodiment, MCL1, BCL2A1, JUNB, B3GNT2 and/or alternate immune evasion targets in Table 2 increase in expression upon treatment with an immunotherapy and can be used to monitor the efficacy of an immunotherapy. The increased expression may indicate that the tumor is evading an anti-tumor immune response and the tumor may not respond to further immunotherapy. Thus, in certain embodiments, one or more of the targets is used as a biomarker for monitoring the efficacy of an immunotherapy and guiding further treatment as described herein. An increase in expression can be determined by comparing expression from samples obtained from a subject before and during treatment.

    [0427] In an example embodiment, is disclosed a method determining if a subject is an immunotherapy responder and non-responder comprises detecting in a tumor obtained from the subject the expression or activity of 576 genes, of 500 to 575 genes, of 400 to 500 genes, of 300 to 400 genes, of 200 to 300 genes, of 100 to 200 genes, of 50 to 100 genes, of 25 to 50 genes, of 10 to 25 genes, of 5 to 10 genes or of 1 to 5 genes selected from candidate genes in Table 2, wherein if the expression of the genes is higher than a reference value the subject is an immunotherapy non-responder and if the one or more genes is lower than a reference value then the subject is an immunotherapy responder; and treating the subject, wherein if the subject is a responder, administering an immunotherapy. In preferred embodiments, one or more of B3GNT2, MCL1, BCL2A, and/or JUNB is detected, wherein elevated expression relative to a reference value indicates the subject is an immunotherapy non-responder.

    [0428] The reference value may be indicated inter alia as an absolute value, range or statistics, or may be indicated relative to a suitable control subject or subject population (such as, e.g., relative to a general, normal or healthy subject or subject population). Hence, the probability, that a subject will be an immunotherapy responder or non-responder may be advantageously indicated as increased or decreased, or as fold-increased or fold-decreased relative to a suitable control subject or subject population. Methods may rely on comparing the quantity of biomarkers, or gene or gene product signatures measured in samples from patients with reference values, wherein said reference values represent known predictions, diagnoses and/or prognoses of diseases or conditions as taught herein.

    [0429] For example, distinct reference values may represent the prediction of a risk (e.g., an abnormally elevated risk) of having a given disease or condition as taught herein vs. the prediction of no or normal risk of having said disease or condition. In another example, distinct reference values may represent predictions of differing degrees of risk of having such disease or condition.

    [0430] Such comparison may generally include any means to determine the presence or absence of at least one difference and optionally of the size of such difference between values being compared. A comparison may include a visual inspection, an arithmetical or statistical comparison of measurements. Such statistical comparisons include, but are not limited to, applying a rule.

    [0431] Reference values may be established according to known procedures previously employed for other cell populations, biomarkers and gene or gene product signatures. For example, a reference value may be established in an individual or a population of individuals characterized by a particular diagnosis, prediction and/or prognosis of responding to an immunotherapy or not responding to immunotherapy (i.e., for whom said diagnosis, prediction and/or prognosis of the disease or condition holds true). Such population may comprise without limitation 2 or more, 10 or more, 100 or more, or even several hundred or more individuals.

    [0432] In one example embodiment, a reference value can be determined by the evaluation of the expression of candidate genes listed in Table 2 in an annotated database of tumor samples that provides gene expression and clinical outcome. For example, by analyzing the transcriptomes of 310 patients collected prior to immune checkpoint blockade therapy and determining whether the subject was responsive or non-responsive a reference value can be established. Example databases have been described (see, e.g., Auslander et al., 2018; Braun et al., 2020; Gide et al., 2019; Hugo et al., 2016; Pender et al., 2021; Riaz et al., 2017 and the Cancer Genome Atlas website (www.genome.gov/Funded-Programs-Projects/Cancer-Genome-Atlas)).

    [0433] A deviation of a first value from a second value may generally encompass any direction (e.g., increase: first value>second value; or decrease: first value<second value) and any extent of alteration.

    [0434] For example, a deviation may encompass a decrease in a first value by, without limitation, at least about 10% (about 0.9-fold or less), or by at least about 20% (about 0.8-fold or less), or by at least about 30% (about 0.7-fold or less), or by at least about 40% (about 0.6-fold or less), or by at least about 50% (about 0.5-fold or less), or by at least about 60% (about 0.4-fold or less), or by at least about 70% (about 0.3-fold or less), or by at least about 80% (about 0.2-fold or less), or by at least about 90% (about 0.1-fold or less), relative to a second value with which a comparison is being made.

    [0435] For example, a deviation may encompass an increase of a first value by, without limitation, at least about 10% (about 1.1-fold or more), or by at least about 20% (about 1.2-fold or more), or by at least about 30% (about 1.3-fold or more), or by at least about 40% (about 1.4-fold or more), or by at least about 50% (about 1.5-fold or more), or by at least about 60% (about 1.6-fold or more), or by at least about 70% (about 1.7-fold or more), or by at least about 80% (about 1.8-fold or more), or by at least about 90% (about 1.9-fold or more), or by at least about 100% (about 2-fold or more), or by at least about 150% (about 2.5-fold or more), or by at least about 200% (about 3-fold or more), or by at least about 500% (about 6-fold or more), or by at least about 700% (about 8-fold or more), or like, relative to a second value with which a comparison is being made.

    [0436] Preferably, a deviation may refer to a statistically significant observed alteration. For example, a deviation may refer to an observed alteration which falls outside of error margins of reference values in a given population (as expressed, for example, by standard deviation or standard error, or by a predetermined multiple thereof, e.g., ?1?SD or ?2?SD or ?3?SD, or ?1?SE or ?2?SE or ?3?SE). Deviation may also refer to a value falling outside of a reference range defined by values in a given population (for example, outside of a range which comprises ?40%, ?50%, ?60%, ?70%, ?75% or ?80% or ?85% or ?90% or ?95% or even ?100% of values in said population).

    [0437] In a further embodiment, a deviation may be concluded if an observed alteration is beyond a given threshold or cut-off. Such threshold or cut-off may be selected as generally known in the art to provide for a chosen sensitivity and/or specificity of the prediction methods, e.g., sensitivity and/or specificity of at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 85%, or at least 90%, or at least 95%.

    [0438] For example, receiver-operating characteristic (ROC) curve analysis can be used to select an optimal cut-off value of the quantity of a given immune cell population, biomarker or gene or gene product signatures, for clinical use of the present diagnostic tests, based on acceptable sensitivity and specificity, or related performance measures which are well-known per se, such as positive predictive value (PPV), negative predictive value (NPV), positive likelihood ratio (LR+), negative likelihood ratio (LR), Youden index, or similar.

    Theranostic Methods

    [0439] Methods of determining if a subject is an immunotherapy responder or non-responder may also be integrated into method of treatments to guide appropriate treatment regimens. In one example embodiment, a method of treating cancer comprising determining if the subject is an immunotherapy non-responder or an immunotherapy responder as described above, and treating the subject with one or more of the methods of enhancing anti-tumor immunity described in the sections above, if the subject is an immune non-responder, and treating the subject with an immunotherapy if the subject is an immunotherapy responder.

    Detection of Biomarkers

    [0440] In one embodiment, the signature genes, biomarkers, and/or cells expressing biomarkers may be detected or isolated by immunofluorescence, immunohistochemistry (IHC), fluorescence activated cell sorting (FACS), mass spectrometry (MS), mass cytometry (CyTOF), sequencing, WGS (described herein), WES (described herein), RNA-seq, single cell RNA-seq (described herein), quantitative RT-PCR, single cell qPCR, FISH, RNA-FISH, MERFISH (multiplex (in situ) RNA FISH) and/or by in situ hybridization. Other methods including absorbance assays and colorimetric assays are known in the art and may be used herein. Detection may comprise primers and/or probes or fluorescently bar-coded oligonucleotide probes for hybridization to RNA (see e.g., Geiss G K, et al., Direct multiplexed measurement of gene expression with color-coded probe pairs. Nat Biotechnol. 2008 March; 26(3):317-25). In certain embodiments, cancer is diagnosed, prognosed, or monitored. For example, a tissue sample may be obtained and analyzed for specific cell markers (IHC) or specific transcripts (e.g., RNA-FISH). In one embodiment, tumor cells are stained for cell subtype specific signature genes (e.g., responder or non-responder). In one embodiment, the cells are fixed. In another embodiment, the cells are formalin fixed and paraffin embedded. Not being bound by a theory, the presence of the tumor subtypes indicate outcome and personalized treatments.

    [0441] The present invention also may comprise a kit with a detection reagent that binds to one or more biomarkers or can be used to detect one or more biomarkers.

    MS Methods

    [0442] Biomarker detection may also be evaluated using mass spectrometry methods. A variety of configurations of mass spectrometers can be used to detect biomarker values. Several types of mass spectrometers are available or can be produced with various configurations. In general, a mass spectrometer has the following major components: a sample inlet, an ion source, a mass analyzer, a detector, a vacuum system, and instrument-control system, and a data system. Difference in the sample inlet, ion source, and mass analyzer generally define the type of instrument and its capabilities. For example, an inlet can be a capillary-column liquid chromatography source or can be a direct probe or stage such as used in matrix-assisted laser desorption. Common ion sources are, for example, electrospray, including nanospray and microspray or matrix-assisted laser desorption. Common mass analyzers include a quadrupole mass filter, ion trap mass analyzer and time-of-flight mass analyzer. Additional mass spectrometry methods are well known in the art (see Burlingame et al., Anal. Chem. 70:647 R-716R (1998); Kinter and Sherman, New York (2000)).

    [0443] Protein biomarkers and biomarker values can be detected and measured by any of the following: electrospray ionization mass spectrometry (ESI-MS), ESI-MS/MS, ESI-MS/(MS)n, matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS), surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF-MS), desorption/ionization on silicon (DIOS), secondary ion mass spectrometry (SIMS), quadrupole time-of-flight (Q-TOF), tandem time-of-flight (TOF/TOF) technology, called ultraflex III TOF/TOF, atmospheric pressure chemical ionization mass spectrometry (APCI-MS), APCI-MS/MS, APCI-(MS).sup.N, atmospheric pressure photoionization mass spectrometry (APPI-MS), APPI-MS/MS, and APPI-(MS).sup.N, quadrupole mass spectrometry, Fourier transform mass spectrometry (FTMS), quantitative mass spectrometry, and ion trap mass spectrometry.

    [0444] Sample preparation strategies are used to label and enrich samples before mass spectroscopic characterization of protein biomarkers and determination biomarker values. Labeling methods include but are not limited to isobaric tag for relative and absolute quantitation (iTRAQ) and stable isotope labeling with amino acids in cell culture (SILAC). Capture reagents used to selectively enrich samples for candidate biomarker proteins prior to mass spectroscopic analysis include but are not limited to aptamers, antibodies, nucleic acid probes, chimeras, small molecules, an F(ab).sub.2 fragment, a single chain antibody fragment, an Fv fragment, a single chain Fv fragment, a nucleic acid, a lectin, a ligand-binding receptor, affibodies, nanobodies, ankyrins, domain antibodies, alternative antibody scaffolds (e.g. diabodies etc.) imprinted polymers, avimers, peptidomimetics, peptoids, peptide nucleic acids, threose nucleic acid, a hormone receptor, a cytokine receptor, and synthetic receptors, and modifications and fragments of these.

    Immunoassays

    [0445] Immunoassay methods are based on the reaction of an antibody to its corresponding target or analyte and can detect the analyte in a sample depending on the specific assay format. To improve specificity and sensitivity of an assay method based on immunoreactivity, monoclonal antibodies are often used because of their specific epitope recognition. Polyclonal antibodies have also been successfully used in various immunoassays because of their increased affinity for the target as compared to monoclonal antibodies Immunoassays have been designed for use with a wide range of biological sample matrices Immunoassay formats have been designed to provide qualitative, semi-quantitative, and quantitative results.

    [0446] Quantitative results may be generated through the use of a standard curve created with known concentrations of the specific analyte to be detected. The response or signal from an unknown sample is plotted onto the standard curve, and a quantity or value corresponding to the target in the unknown sample is established.

    [0447] Numerous immunoassay formats have been designed. ELISA or EIA can be quantitative for the detection of an analyte/biomarker. This method relies on attachment of a label to either the analyte or the antibody and the label component includes, either directly or indirectly, an enzyme. ELISA tests may be formatted for direct, indirect, competitive, or sandwich detection of the analyte. Other methods rely on labels such as, for example, radioisotopes (I.sup.125) or fluorescence. Additional techniques include, for example, agglutination, nephelometry, turbidimetry, Western blot, immunoprecipitation, immunocytochemistry, immunohistochemistry, flow cytometry, Luminex assay, and others (see ImmunoAssay: A Practical Guide, edited by Brian Law, published by Taylor & Francis, Ltd., 2005 edition).

    [0448] Exemplary assay formats include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay, fluorescent, chemiluminescence, and fluorescence resonance energy transfer (FRET) or time resolved-FRET (TR-FRET) immunoassays. Examples of procedures for detecting biomarkers include biomarker immunoprecipitation followed by quantitative methods that allow size and peptide level discrimination, such as gel electrophoresis, capillary electrophoresis, planar electrochromatography, and the like.

    [0449] Methods of detecting and/or quantifying a detectable label or signal generating material depend on the nature of the label. The products of reactions catalyzed by appropriate enzymes (where the detectable label is an enzyme; see above) can be, without limitation, fluorescent, luminescent, or radioactive or they may absorb visible or ultraviolet light. Examples of detectors suitable for detecting such detectable labels include, without limitation, x-ray film, radioactivity counters, scintillation counters, spectrophotometers, colorimeters, fluorometers, luminometers, and densitometers.

    [0450] Any of the methods for detection can be performed in any format that allows for any suitable preparation, processing, and analysis of the reactions. This can be, for example, in multi-well assay plates (e.g., 96 wells or 384 wells) or using any suitable array or microarray. Stock solutions for various agents can be made manually or robotically, and all subsequent pipetting, diluting, mixing, distribution, washing, incubating, sample readout, data collection and analysis can be done robotically using commercially available analysis software, robotics, and detection instrumentation capable of detecting a detectable label.

    Hybridization Assays

    [0451] Such applications are hybridization assays in which a nucleic acid that displays probe nucleic acids for each of the genes to be assayed/profiled in the profile to be generated is employed. In these assays, a sample of target nucleic acids is first prepared from the initial nucleic acid sample being assayed, where preparation may include labeling of the target nucleic acids with a label, e.g., a member of a signal producing system. Following target nucleic acid sample preparation, the sample is contacted with the array under hybridization conditions, whereby complexes are formed between target nucleic acids that are complementary to probe sequences attached to the array surface. The presence of hybridized complexes is then detected, either qualitatively or quantitatively. Specific hybridization technology which may be practiced to generate the expression profiles employed in the subject methods includes the technology described in U.S. Pat. Nos. 5,143,854; 5,288,644; 5,324,633; 5,432,049; 5,470,710; 5,492,806; 5,503,980; 5,510,270; 5,525,464; 5,547,839; 5,580,732; 5,661,028; 5,800,992; the disclosures of which are herein incorporated by reference; as well as WO 95/21265; WO 96/31622; WO 97/10365; WO 97/27317; EP 373 203; and EP 785 280. In these methods, an array of probe nucleic acids that includes a probe for each of the biomarkers whose expression is being assayed is contacted with target nucleic acids as described above. Contact is carried out under hybridization conditions, e.g., stringent hybridization conditions as described above, and unbound nucleic acid is then removed. The resultant pattern of hybridized nucleic acids provides information regarding expression for each of the biomarkers that have been probed, where the expression information is in terms of whether or not the gene is expressed and, typically, at what level, where the expression data, i.e., expression profile, may be both qualitative and quantitative.

    [0452] Optimal hybridization conditions will depend on the length (e.g., oligomer vs. polynucleotide greater than 200 bases) and type (e.g., RNA, DNA, PNA) of labeled probe and immobilized polynucleotide or oligonucleotide. General parameters for specific (i.e., stringent) hybridization conditions for nucleic acids are described in Sambrook et al., supra, and in Ausubel et al., Current Protocols in Molecular Biology, Greene Publishing and Wiley-interscience, NY (1987), which is incorporated in its entirety for all purposes. When the cDNA microarrays are used, typical hybridization conditions are hybridization in 5?SSC plus 0.2% SDS at 65C for 4 hours followed by washes at 25? C. in low stringency wash buffer (1?SSC plus 0.2% SDS) followed by 10 minutes at 25? C. in high stringency wash buffer (0.1SSC plus 0.2% SDS) (see Shena et al., Proc. Natl. Acad. Sci. USA, Vol. 93, p. 10614 (1996)). Useful hybridization conditions are also provided in, e.g., Tijessen, Hybridization With Nucleic Acid Probes, Elsevier Science Publishers B.V. (1993) and Kricka, Nonisotopic DNA Probe Techniques, Academic Press, San Diego, Calif. (1992).

    [0453] In certain embodiments, a subject can be categorized based on signature genes or gene programs expressed by a tissue sample obtained from the subject. In certain embodiments, the tissue sample is analyzed by bulk sequencing. In certain embodiments, subtypes can be determined by determining the percentage of specific cell subtypes expressing the identified interacting genetic variants in the sample that contribute to the phenotype. In certain embodiments, gene expression associated with the cells are determined from bulk sequencing reads by deconvolution of the sample. For example, deconvoluting bulk gene expression data obtained from a tumor containing both malignant and non-malignant cells can include defining the relative frequency of a set of cell types in the tumor from the bulk gene expression data using cell type specific gene expression (e.g., cell types may be T cells, fibroblasts, macrophages, mast cells, B/plasma cells, endothelial cells, myocytes and dendritic cells); and defining a linear relationship between the frequency of the non-malignant cell types and the expression of a set of genes, wherein the set of genes comprises genes highly expressed by malignant cells and at most two non-malignant cell types, wherein the set of genes are derived from gene expression analysis of single cells in the tumor or the same tumor type, and wherein the residual of the linear relationship defines the malignant cell-specific (MCS) expression profile (see, e.g., WO 2018/191553; and Puram et al., Cell. 2017 Dec. 14; 171(7):1611-1624.e24).

    Sequencing

    [0454] In certain embodiments, sequencing is used to identify expression of genes or transcriptomes in single cells. In certain embodiments, sequencing comprises high-throughput (formerly next-generation) technologies to generate sequencing reads. Methods for constructing sequencing libraries are known in the art (see, e.g., Head et al., Library construction for next-generation sequencing: Overviews and challenges. Biotechniques. 2014; 56(2): 61-77). A library or fragment library may be a collection of nucleic acid molecules derived from one or more nucleic acid samples, in which fragments of nucleic acid have been modified, generally by incorporating terminal adapter sequences comprising one or more primer binding sites and identifiable sequence tags. In certain embodiments, the library members (e.g., cDNA) may include sequencing adaptors that are compatible with use in, e.g., Illumina's reversible terminator method, long read nanopore sequencing, Roche's pyrosequencing method (454), Life Technologies' sequencing by ligation (the SOLID platform) or Life Technologies' Ion Torrent platform. Examples of such methods are described in the following references: Margulies et al (Nature 2005 437: 376-80); Schneider and Dekker (Nat Biotechnol. 2012 Apr. 10; 30(4):326-8); Ronaghi et al (Analytical Biochemistry 1996 242: 84-9); Shendure et al (Science 2005 309: 1728-32); Imelfort et al (Brief Bioinform. 2009 10:609-18); Fox et al (Methods Mol. Biol. 2009; 553:79-108); Appleby et al (Methods Mol. Biol. 2009; 513:19-39); and Morozova et al (Genomics. 2008 92:255-64), which are incorporated by reference for the general descriptions of the methods and the particular steps of the methods, including all starting products, reagents, and final products for each of the steps.

    [0455] As used herein the term transcriptome refers to the set of transcript molecules. In some embodiments, transcript refers to RNA molecules, e.g., messenger RNA (mRNA) molecules, small interfering RNA (siRNA) molecules, transfer RNA (tRNA) molecules, ribosomal RNA (rRNA) molecules, and complimentary sequences, e.g., cDNA molecules. In some embodiments, a transcriptome refers to a set of mRNA molecules. In some embodiments, a transcriptome refers to a set of cDNA molecules. In some embodiments, a transcriptome refers to one or more of mRNA molecules, siRNA molecules, tRNA molecules, rRNA molecules, in a sample, for example, a single cell or a population of cells. In some embodiments, a transcriptome refers to cDNA generated from one or more of mRNA molecules, siRNA molecules, tRNA molecules, rRNA molecules, in a sample, for example, a single cell or a population of cells. In some embodiments, a transcriptome refers to 25%, 50%, 55, 60, 65, 70, 75, 80, 85, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 99.9, or 100% of transcripts from a single cell or a population of cells. In some embodiments, transcriptome not only refers to the species of transcripts, such as mRNA species, but also the amount of each species in the sample. In some embodiments, a transcriptome includes each mRNA molecule in the sample, such as all the mRNA molecules in a single cell.

    [0456] In certain embodiments, the invention involves single cell RNA sequencing (see, e.g., Kalisky, T., Blainey, P. & Quake, S. R. Genomic Analysis at the Single-Cell Level. Annual review of genetics 45, 431-445, (2011); Kalisky, T. & Quake, S. R. Single-cell genomics. Nature Methods 8, 311-314 (2011); Islam, S. et al. Characterization of the single-cell transcriptional landscape by highly multiplex RNA-seq. Genome Research, (2011); Tang, F. et al. RNA-Seq analysis to capture the transcriptome landscape of a single cell. Nature Protocols 5, 516-535, (2010); Tang, F. et al. mRNA-Seq whole-transcriptome analysis of a single cell. Nature Methods 6, 377-382, (2009); Ramskold, D. et al. Full-length mRNA-Seq from single-cell levels of RNA and individual circulating tumor cells. Nature Biotechnology 30, 777-782, (2012); and Hashimshony, T., Wagner, F., Sher, N. & Yanai, I. CEL-Seq: Single-Cell RNA-Seq by Multiplexed Linear Amplification. Cell Reports, Cell Reports, Volume 2, Issue 3, p666-673, 2012).

    [0457] In certain embodiments, the present invention involves single cell RNA sequencing (scRNA-seq). In certain embodiments, the invention involves plate based single cell RNA sequencing (see, e.g., Picelli, S. et al., 2014, Full-length RNA-seq from single cells using Smart-seq2 Nature protocols 9, 171-181, doi: 10.1038/nprot.2014.006).

    [0458] In certain embodiments, the invention involves high-throughput single-cell RNA-seq where the RNAs from different cells are tagged individually, allowing a single library to be created while retaining the cell identity of each read. In this regard reference is made to Macosko et al., 2015, Highly Parallel Genome-wide Expression Profiling of Individual Cells Using Nanoliter Droplets Cell 161, 1202-1214; International patent application number PCT/US2015/049178, published as WO2016/040476 on Mar. 17, 2016; Klein et al., 2015, Droplet Barcoding for Single-Cell Transcriptomics Applied to Embryonic Stem Cells Cell 161, 1187-1201; International patent application number PCT/US2016/027734, published as WO2016168584A1 on Oct. 20, 2016; Zheng, et al., 2016, Haplotyping germline and cancer genomes with high-throughput linked-read sequencing Nature Biotechnology 34, 303-311; Zheng, et al., 2017, Massively parallel digital transcriptional profiling of single cells Nat. Commun. 8, 14049 doi: 10.1038/ncomms14049; International patent publication number WO2014210353A2; Zilionis, et al., 2017, Single-cell barcoding and sequencing using droplet microfluidics Nat Protoc. January; 12(1):44-73; Cao et al., 2017, Comprehensive single cell transcriptional profiling of a multicellular organism by combinatorial indexing bioRxiv preprint first posted online Feb. 2, 2017, doi: dx.doi.org/10.1101/104844; Rosenberg et al., 2017, Scaling single cell transcriptomics through split pool barcoding bioRxiv preprint first posted online Feb. 2, 2017, doi: dx.doi.org/10.1101/105163; Rosenberg et al., Single-cell profiling of the developing mouse brain and spinal cord with split-pool barcoding Science 15 Mar. 2018; Vitak, et al., Sequencing thousands of single-cell genomes with combinatorial indexing Nature Methods, 14(3):302-308, 2017; Cao, et al., Comprehensive single-cell transcriptional profiling of a multicellular organism. Science, 357(6352):661-667, 2017; Gierahn et al., Seq-Well: portable, low-cost RNA sequencing of single cells at high throughput Nature Methods 14, 395-398 (2017); and Hughes, et al., Highly Efficient, Massively-Parallel Single-Cell RNA-Seq Reveals Cellular States and Molecular Features of Human Skin Pathology bioRxiv 689273; doi: doi.org/10.1101/689273, all the contents and disclosure of each of which are herein incorporated by reference in their entirety.

    [0459] In certain embodiments, the invention involves single nucleus RNA sequencing. In this regard reference is made to Swiech et al., 2014, In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9 Nature Biotechnology Vol. 33, pp. 102-106; Habib et al., 2016, Div-Seq: Single-nucleus RNA-Seq reveals dynamics of rare adult newborn neurons Science, Vol. 353, Issue 6302, pp. 925-928; Habib et al., 2017, Massively parallel single-nucleus RNA-seq with DroNc-seq Nat Methods. 2017 October; 14(10):955-958; International Patent Application No. PCT/US2016/059239, published as WO2017164936 on Sep. 28, 2017; International Patent Application No. PCT/US2018/060860, published as WO/2019/094984 on May 16, 2019; International Patent Application No. PCT/US2019/055894, published as WO/2020/077236 on Apr. 16, 2020; and Drokhlyansky, et al., The enteric nervous system of the human and mouse colon at a single-cell resolution, bioRxiv 746743; doi: doi.org/10.1101/746743, which are herein incorporated by reference in their entirety.

    Methods for Screening for Agents Capable of Decreasing Poly-LacNac on Tumor Surface

    [0460] A further aspect of the invention relates to a method for identifying an agent capable of decreasing poly-lacnac on the tumor surface, comprising: contacting a population of tumor cells having upregulated B3GNT2 with an agent; and detecting binding of one or more proteins to the tumor cells selected from the group consisting of CD2, 4-1BB, TREML2 (TLT2), NKG2D, and an antibody specific for an HLA class I bound tumor antigen, wherein increased binding indicates reduced poly-LacNAc. Applicants further describe changes in binding of these proteins to cells dependent upon glycosylation (see, examples). In a specific embodiment, the assay uses one or more of the proteins, such that the proteins are labeled with a detectable marker. Thus, in certain embodiments, the screen can be a high throughput assay. The detectable marker can be any fluorescent marker known in the art.

    [0461] Further embodiments are illustrated in the following Examples, which are given for illustrative purposes only and are not intended to limit the scope of the invention.

    EXAMPLES

    Example 1Identification of Novel Checkpoint Inhibitor Targets Using a CRISPR Activation Screen

    [0462] Applicants first established a T cell cytotoxicity assay for measuring immunotherapy resistance. Applicants transduced human primary CD4.sup.+ and CD8.sup.+ T cells with a T cell receptor (TCR) specific for the NY-ESO-1 antigen (NY-ESO-1:157-165 epitope) presented in an HLA-A*02-restricted manner (ESO T cells) (Robbins et al., 2008). When A375 (NY-ESO-1.sup.+, HLA-A2.sup.+) human melanoma cells were exposed to ESO T cells, Applicants observed cytotoxicity that was specific to the presence of the NY-ESO-1 antigen and NY-ESO-1 TCR (FIG. 1a-c). Cytotoxicity correlated with the effector to target (E:T) ratio (FIG. 1b-c). Applicants then transduced A375 cells with a genome-scale CRISPRa single-guide RNA (sgRNA) library consisting of 70,290 sgRNAs targeting every coding isoform from the RefSeq database (23,430 isoforms) to systematically identify genes that enable tumors to evade T cell killing upon upregulation (Konermann et al., 2015). Applicants tested two T cell exposure strategies: acute (E:T ratio of 3 for 18 hours) and chronic (E:T ratio of 2 for 3 days with 3 rounds of screening selection), in independent screens (FIG. 2a). Applicants deep sequenced the sgRNA library distribution in the surviving cells with or without ESO T cell exposure (FIG. 1d,g). In the chronic exposure screen, Applicants observed that the skew of the distribution increased after each round of screening selection (FIG. 1e,g).

    [0463] Applicants performed MAGeCK (Li et al., 2014) and FDR analyses to identify candidate genes that were enriched in cells cultured with ESO T cells relative to control (FIG. 2b, and Tables 1-3). Pathway analysis on 576 genes prioritized by MAGeCK (top 1% of multiple screening replicates combining the acute and chronic screens) revealed pathways were significantly enriched (FDR<0.05) within these top candidates, including some that have been previously shown to be important for tumor immune evasion, such as lipopolysaccharide response, extrinsic apoptosis signaling, NF-?B activation, JAK-STAT signaling, and antigen presentation (Lawson et al., 2020; Manguso et al., 2017; Pan et al., 2018; Patel et al., 2017; Vredevoogd et al., 2019) (FIG. 2c and Table 4). This analysis also highlighted pathways with previously underappreciated roles in regulating tumor response to T cell cytotoxicity, including glycosaminoglycan metabolism and Wnt signaling, perhaps due to the different screening perturbation (FIG. 2c and Table 4). To assess whether expression of these candidate genes was associated with local immune cytolytic activity in patient tumors (quantified using granzyme A and perforin bulk transcriptome data) (Patel et al., 2017; Rooney et al., 2015), Applicants analyzed gene expression of 33 tumor types from The Cancer Genome Atlas (TCGA). Applicants found that expression of many candidate genes positively correlated (FDR<0.05) with cytolytic activity across tumor types, similar to known immunotherapy resistance mediators, as high cytolytic activity selects for emergence of evading tumor subclones (FIG. 2d, FIG. 3a-d) (Rooney et al., 2015). MAGeCK analysis for genes that generally affect A375 cell growth in the absence of ESO T cell co-culture showed that the MYC pathway governs growth, with MYC and its antagonist MXI1 as the top genes promoting growth and death respectively (FIG. 3e-f). Out of 576 candidate genes, 5 generally drive A375 cell growth and 19 repress it (ranking in the top 1%).

    [0464] Applicants sought to evaluate whether expression of candidate genes is associated with clinical outcome by analyzing 310 patient transcriptomes collected prior to immune checkpoint blockade therapy (Auslander et al., 2018; Braun et al., 2020; Gide et al., 2019; Hugo et al., 2016; Pender et al., 2021; Riaz et al., 2017). In this analysis, Applicants found expression of candidate genes was significantly higher in non-responders (FIG. 2e).

    [0465] FIG. 2f. shows the cell survival of A375 cells transduced with ORFs encoding candidate genes against ESO T cell cytotoxicity at different effector to target (E:T) ratios. Cell survival was measured using a luminescent cell viability assay and normalized to paired control cells that were not cultured with T cells. T cells were derived from donors used in the CRISPRa screen.

    [0466] To narrow the focus for further analysis, Applicants selected the two most enriched genes from each screening strategy: CD274 and MCL1 from the acute screen, and JUNB and B3GNT2 from the chronic exposure screen (FIG. 1j-k). Of these four candidates, CD274 (PD-L1) is known to play a role in immune evasion, and it is currently the focus of immune checkpoint blockade therapies, supporting the design of this study (Reck et al., 2016). Applicants validated the four candidate genes by individually expressing three sgRNAs targeting each gene in A375 cells. For each candidate gene, at least two sgRNAs significantly increased survival against ESO T cells (P<0.05; FIG. 4g-h), verifying the screening results. For JUNB and B3GNT2, sgRNAs that produced higher target gene expression were more enriched in the screen and conferred more resistance, suggesting that these genes are dose-dependent (FIG. 4g-h). Overexpression of ORFs encoding each of the four candidate genes increased survival against T cell cytotoxicity, excluding the possibility of potential CRISPRa off-target genes contributing to resistance (FIG. 5e).

    [0467] Applicants sought to assess the clinical relevance of candidate genes by examining patient tumor samples from TCGA. Applicants found that expression of B3GNT2 was significantly higher than matched normal samples for 9 out of 31 types of cancer (FIG. 6a). Copy number gain of MCL1 and B3GNT2 occurred more frequently than losses, in 95% and 81% of total cases respectively (FIG. 4b). In melanoma patients treated with PD-1 immunotherapy, higher B3GNT2 expression was associated with poorer clinical response (FIG. 4c) (Hugo et al., 2016). A different patient cohort showed that expression of CD274 and MCL1 significantly increased after treatment in patients that did not respond to immunotherapy (FIG. 4d) (Riaz et al., 2017). Expression of all four candidate genes significantly correlated with cytolytic activity (FIG. 4e) (Riaz et al., 2017). Together, these results suggest that the effects of MCL1 and B3GNT2 overexpression on immune evasion may be more common and clinically relevant than that of JUNB.

    [0468] Next, Applicants evaluated whether the screening results were generalizable to other contexts by testing different T cells and co-culture conditions. Overexpression of all candidate genes in A375 cells conferred resistance against ESO T cells from two additional donors that were not used in the CRISPRa screens (FIG. 6a). Applicants verified that candidate gene overexpression promoted resistance over time in an alternative T cell cytotoxicity assay based on secreted Gaussia luciferase (FIG. 6b). In the absence of T cell cytotoxicity, upregulation of candidate genes did not consistently affect cell proliferation across the two cytotoxicity assays (FIG. 6c-d). Applicants investigated how expression level affects resistance by titrating the expression of candidate genes and found that expression correlated with resistance at lower levels of induction (FIG. 6e). The expression threshold above which Applicants observed increased resistance corresponded to the baseline expression of 5-31% of cell lines from the Cancer Cell Line Encyclopedia (Barretina et al., 2012), which suggested that the expression threshold for resistance is physiologically relevant (FIG. 6f). Applicants tested whether resistance conferred by candidate genes was specific to CD4.sup.+ or CD8.sup.+ T cells and found that candidate genes conferred resistance to both types of T cells (FIG. 6g). To determine whether resistance against T cells expressing the NY-ESO-1 TCR also applies to those expressing chimeric antigen receptors (CARs), Applicants introduced candidate gene ORFs into A375 (AXL.sup.+) cells and co-cultured the cells with AXL-targeting CAR T cells (Cho et al., 2018). Overexpression of each of the four candidate genes increased resistance against AXL-targeting CAR T cell cytotoxicity (FIG. 6h). These results show that candidate genes confer resistance against different cytotoxic T cells and across co-culture conditions.

    [0469] Next, Applicants evaluated whether the screening results were generalizable to other types of cancers. Applicants assayed candidate genes in 7 additional cancer cell lines derived from 5 additional tissues [H1793 (NY-ESO-1.sup.+, HLA-A2.sup.?) and H1299 (NY-ESO-1.sup.+, HLA-A2.sup.?) non-small cell lung carcinomas, SW1417 (NY-ESO-1.sup.?, HLA-A2.sup.?) colorectal adenocarcinoma, OAW28 (NY-ESO-1.sup.+, HLA-A2.sup.?) ovarian cystadenocarcinoma, A2058 (NY-ESO-1.sup.?, HLA-A2.sup.?) melanoma, LN-18 (NY-ESO-1.sup.+, HLA-A2.sup.+) glioblastoma, and SK-N-AS (NY-ESO-1.sup.+, HLA-A2.sup.?) neuroblastoma]. Five of these cell lines expressed the NY-ESO-1 antigen endogenously, at varying levels (FIG. 7a), and those that did not naturally express HLA-A2 or NY-ESO-1 were transduced with the appropriate expression vectors. Applicants found that ORF overexpression of all four candidate genes significantly increased survival against T cell cytotoxicity in at least two additional cancer types (FIG. 5a-b and FIG. 7b-h). Overexpression of CD274 was not universally protective and did not confer resistance in cell lines with higher baseline expression, despite robust upregulation (FIG. 5b and FIG. 7h). The effects of MCL1 and B3GNT2 overexpression could be generalized to 6 and 7 of the additional cell lines respectively, demonstrating the broad applicability of these candidate genes to other cancer types and supporting the patient tumor analyses (FIG. 4a-b).

    [0470] To test the relevance of candidate genes for immunotherapy in vivo, Applicants transduced A375 melanoma cells with dox-inducible candidate genes and subcutaneously engrafted these cells in immunocompromised NSG mice (FIG. 5c). At 2 days after subcutaneous tumor injection, Applicants induced overexpression of candidate genes, and at 7 days Applicants treated A375 xenografts with adoptive transfer of ESO T cells (FIG. 5c). In untreated control mice, Applicants did not observe significant differences in tumor growth or host survival between the candidate genes and GFP control (FIG. 7i-j). However, in mice treated with ESO T cells, overexpression of all four candidate genes significantly diminished the efficacy of adoptive cell transfer as measured by tumor growth and host survival (FIG. 5d-e). JUNB overexpression resulted in largely ineffective treatment, as JUNB-overexpressing xenografts displayed similar growth kinetics with and without ESO T cell treatment (FIG. 5d-e and FIG. 7i-j).

    [0471] Applicants proceeded to investigate the mechanisms by which the candidate genes conferred resistance. As CD274 has been extensively studied (Reck et al., 2016), Applicants focused the mechanistic studies on the other three candidate genes. MCL1 is a BCL-2 family protein that inhibits apoptosis by regulating mitochondrial outer membrane permeabilization, and MCL1 overexpression is generally correlated with poor prognosis and resistance to most cancer therapeutics (Czabotar et al., 2014; Xiang et al., 2018). JUNB is a transcription factor that has been previously shown to downregulate an NKG2D ligand and mediate resistance against natural killer cells in mice (Nausch et al., 2006). B3GNT2 is a beta-1,3-N-acetylglucosaminyltransferase involved in poly-N-acetyllactosamine (poly-LacNAc) synthesis that has been suggested to glycosylate PD-1 in T cells to affect T cell activation (Sun et al., 2020). Moreover, B3GNT2 knockout mice have lower poly-LacNAc on B and T cells, resulting in hyperactivity (Togayachi et al., 2010). To begin to understand the pathways related to each candidate gene, Applicants performed RNA sequencing (RNA-seq) on A375 cells overexpressing each gene to characterize transcriptome changes. JUNB overexpression resulted in 632 differentially expressed genes with an absolute log fold change >1, compared to <15 genes for the other candidate genes, which is consistent with the role of JUNB in transcriptional regulation (FIG. 8a and Table 5). As the targets of JUNB and B3GNT2 are relatively unknown compared to MCL1, Applicants generated FLAG-tagged ORFs of both genes for immunoprecipitation assays (FIG. 8b). Chromatin immunoprecipitation sequencing (ChIP-seq) of JUNB and co-immunoprecipitation (co-IP) of B3GNT2 followed by mass spectrometry nominated 3,517 and 414 targets, respectively (Tables 6 and 7).

    [0472] To narrow down the possible pathways to those that affect tumor immune evasion, Applicants assayed the effects of candidate gene overexpression on secretion and sensing of various cytokines involved in T cell cytotoxicity. Applicants quantified IFN? released by T cells in the cytotoxicity assay using ELISA and found that upregulation of CD274 and B3GNT2 reduced IFN? secretion by T cells (FIG. 8c). Overexpression of CD274 reduced the tumor response to IFN?, as indicated by phosphorylation of STAT1, potentially resulting from a negative feedback mechanism (FIG. 8d) (Garcia-Diaz et al., 2017). Applicants challenged A375 cells overexpressing each of the candidate genes with cytokines that mediate cytotoxicity, FasL, TRAIL, or TNF?. Applicants found that MCL1 and JUNB overexpression significantly increased survival against FasL- and TRAIL-induced cell death (FIG. 9a and FIG. 10a-b).

    [0473] Applicants examined components of the FasL and TRAIL signaling pathways that could contribute to MCL1- and JUNB-mediated resistance. For MCL1, the potential interaction partners involved in FasL and TRAIL resistance have been identified in previous studies (Czabotar et al., 2014). Applicants induced expression of these interaction partners in MCL1-overexpressing A375 cells and measured survival against T cell cytotoxicity. Induction of genes that more directly interact with MCL1, such as BID, PMAIP1 (NOXA), and BAX, could offset resistance conferred by MCL1 (FIG. 9b and FIG. 10c). For JUNB, the extensive list of target genes overlapping the ChIP- and RNA-seq datasets (Table 6) suggests there could be multiple components involved, necessitating a more systematic approach. Applicants first assayed cell surface expression of FasL and TRAIL receptors and found that JUNB overexpression significantly reduced expression of both receptors, FAS and TNFRSF10B (FIG. 9c). Applicants found that the JUNB target gene BCL2A1, an anti-apoptotic BCL-2 family protein that operates in parallel to MCL1 (Czabotar et al., 2014), was upregulated 45-fold and enriched in the set of 576 candidate genes from the CRISPRa screen, suggesting that BCL2A1 may also contribute to FasL and TRAIL resistance (Tables 2 and 6). CRISPR inhibition (CRISPRi) knockdown of BCL2A1 in JUNB-overexpressing cells significantly decreased survival against cytotoxicity induced by FasL, TRAIL, and T cells (FIG. 9d and FIG. 10d-f). In addition, JUNB alters expression of many different genes to activate the NF-?B pathway, including components of the NF-?B complex (RELA, RELB, NEKB1, and NFKB2), NF-?B activators (IKBKB and IKBKE), and NF-?B inhibitors (IFRD1) (Hoesel and Schmid, 2013; Liu et al., 2017; Tummers et al., 2015) (FIG. 9e). Perturbation of these genes by JI/NB results in activation of the NF-?B pathway, as indicated by phosphorylation of p65 (RELA) (FIG. 9f). Similar to JUNB, NF-?B activation upregulates BCL2A1, thus creating a feed forward loop for BCL2A1 upregulation (Grumont et al., 1999; Zong et al., 1999). The results show that MCL1 and JUNB counteract FasL- and TRAIL-induced cell death by inhibiting the mitochondrial apoptosis pathway, further supporting the importance of the death receptor signaling pathway in immunotherapy (Dufva et al., 2020; Singh et al., 2020) (FIG. 9g).

    [0474] Next, Applicants turned to the resistance mechanism for B3GNT2. B3GNT2 overexpression in A375 cells increased intra- and extra-cellular poly-LacNAc as measured by tomato lectin staining (FIG. 11a). Pretreating cells with either N- or O-linked glycosylation inhibitors, kifunensine or benzyl-2-acetamido-2-deoxy-?-D-galactopyranoside (BAG) respectively, reduced poly-LacNAc added by B3GNT2 in a dosage-dependent manner (FIG. 11a). As T cells that were co-cultured with B3GNT2-overexpressing A375 cells secreted less IFN? (FIG. 8c), Applicants tested whether glycosylation inhibition could restore T cell activation. Applicants found that pretreating B3GNT2-overexpressing A375 cells with both glycosylation inhibitors reversed the effects of B3GNT2 overexpression, resulting in increased T cell IFN? secretion and reduced A375 survival, with kifunensine having a stronger effect (FIG. 12a and FIG. 11b). As interaction between T cell and tumor cell surface ligands and receptors triggers IFN? secretion, Applicants assayed the ligands and receptors that were highly expressed in A375 for modifications by B3GNT2. Applicants found that many of these proteins showed higher and broader ranges of molecular weights on Western blots, potentially indicating increased presence of poly-LacNAc (FIG. 11c-d). Enzymatic deglycosylation of the proteins confirmed that the increased molecular weights represented glycosylation, not other post-translational modifications (FIG. 11d). Pretreating A375 cells overexpressing B3GNT2 with either kifunensine or BAG showed that the 10 ligands and receptors modified by B3GNT2 (CD276, CD70, CD58, NECTIN2, HLA-A, TNFRSF1A, IFNGR2, FAS, IFNAR1, MICB) are primarily N-glycosylated, aligning with the finding that kifunensine treatment had a stronger effect on T cell IFN? secretion and tumor cell survival (FIG. 12b). Applicants found that these 10 ligands and receptors had increased presence of poly-LacNAc at baseline in SW1417 colorectal adenocarcinoma cells, which express higher levels of endogenous B3GNT2 than A375 cells (FIG. 11e). Co-IP of B3GNT2 verified that these ligands and receptors are B3GNT2 targets (FIG. 11f).

    [0475] Applicants sought to determine whether increased poly-LacNAc on the B3GNT2 targets affected ligand-receptor interactions between tumor and T cells that facilitate T cell activation and subsequent cytotoxicity. By measuring binding of a panel of 10 recombinant T cell proteins to A375 cells overexpressing B3GNT2, Applicants found that binding of 5 T cell proteins [CD2, 4-1BB, TREML2 (TLT2), NKG2D, and an antibody specific for HLA-A2:NY-ESO-1] was significantly reduced (FIG. 13a). Treating B3GNT2-overexpressing A375 cells with kifunensine or BAG rescued the reduction in T cell protein binding (FIG. 12c). In the case of HLA-A2:NY-ESO-1 antibody binding, kifunensine further reduced binding, potentially because antigen presentation was disrupted (FIG. 13b). For T cell proteins CD2, NKG2D, and HLA-A2:NY-ESO-1 antibody, Applicants have demonstrated that their known tumor interaction partners, CD58, MICB, and HLA-A respectively, are B3GNT2 target proteins (Shaw et al., 1986; Steinle et al., 2001) (FIG. 12b-c and FIG. 14c). However, for 4-1BB, the mechanism was not immediately clear because its known interaction partner, 4-1BBL, was not modified by B3GNT2 (Alderson et al., 1994) (FIG. 14b). Applicants confirmed that that 4-1BB bound to 4-1BBL in the assay using CRISPR knockout (FIG. 13c-e). These results suggest two possibilities: 1) increased poly-LacNAc on other cell surface ligands and receptors targeted by B3GNT2 disrupts the 4-1BB/4-1BBL binding; 2) 4-1BB binds to other unknown ligands that are targeted by B3GNT2. For TREML2, though some studies have suggested that TREML2 interacts with the B3GNT2 target protein CD276 (Hashiguchi et al., 2008), CRISPR knockdown of CD276 did not affect binding to TREML2 (FIG. 13f-h). The finding aligns with a previous study showing that the interaction between TREML2 and CD276 does not occur in humans (Leitner et al., 2009). Taken together, Applicants have shown that B3GNT2 mediates resistance to T cell cytotoxicity by adding poly-LacNAc on numerous proteins to interfere with ligand-receptor interactions between tumor and T cells (FIG. 12d).

    [0476] To test whether inhibition of candidate genes could produce the opposite effect and render tumors more susceptible to T cell cytotoxicity, Applicants designed CRISPR sgRNAs to knock down or knock out the four candidate genes and measured tumor survival against T cell killing (FIG. 13a-b). In SW1417 colorectal adenocarcinoma cells, which express relatively high levels of the candidate genes (FIG. 13a), knockdown of all four candidate genes significantly decreased cell survival when cells were co-cultured with HER2 CAR or ESO T cells (FIG. 15 and FIG. 13c). In A375 melanoma cells, knockdown of CD274, MCL1, and JUNB decreased cell survival, and in OAW28 ovarian cystadenocarcinoma cells, knockdown of MCL1 and JUNB decreased cell survival (FIG. 10d-e). Knockdown of B3GNT2 did not affect survival in A375 and OAW28 cell lines, potentially because B3GNT2 is expressed at relatively low levels in these cell lines (FIG. 13a). Applicants observed comparable results for candidate gene knockout in SW1417 and A375 cells (FIG. 13f-h). In addition to CRISPR perturbation, Applicants tested chemical inhibition of MCL1 and B3GNT2. Selective MCL1 inhibitors are already undergoing testing in clinical trials (Xiang et al., 2018) and the dosage of these inhibitors could be adjusted to preferentially target MCL1-dependent tumor cells. The resistance mechanism of B3GNT2 suggests that inhibition of extracellular poly-LacNAc could bolster immunotherapy. Applicants therefore inhibited MCL1 using selective small molecule inhibitors and B3GNT2 using kifunensine to generally inhibit N-linked glycosylation. Both chemical inhibition approaches reduced survival of A375 and SW1417 cells, as well as primary patient-derived melanoma and pancreatic adenocarcinoma models, against T cell cytotoxicity (FIG. 15b-e and FIG. 13i-j). The CRISPR and chemical inhibition results indicate that inhibition of candidate genes in tumor cells enhances T cell killing and can be combined with current immunotherapy strategies to improve efficacy.

    [0477] More generally, the results suggest that inhibition of B3GNT2 and BCL-2 family proteins, MCL1 and BCL2A1, could enhance the efficacy of immunotherapy and improve patient response. The high cross-validation rate of MCL1 and B3GNT2 across different cancer cell types and their frequency in patient tumor types suggest that the resistance effects are relatively cell type independent. The distinct pathways of the candidate genes may have contributed to their respective differences in resistance to TCR and CAR T cell cytotoxicity. MCL1 and JUNB overexpression may result in higher resistance against CAR-expressing T cell cytotoxicity because CAR-mediated killing may rely more on the mitochondrial apoptosis pathway for cytotoxicity (Dufva et al., 2020; Singh et al., 2020). By contrast, B3GNT2 overexpression produces higher resistance against T cells expressing TCR than CAR because B3GNT2 confers resistance by disrupting interactions between tumor and T cells to reduce T cell activation. As the CAR design includes multiple intracellular co-stimulatory domains that promote T cell activation (Cho et al., 2018), CAR function is not as affected by these disruptions. Characterizing resistance mechanisms thus helps inform the choice between TCR- and CAR-based immunotherapy.

    CONCLUSIONS

    [0478] Applicants have shown that genome-scale, gain-of-function genetic screens can discover genes involved in different biological processes that confer resistance to T cell cytotoxicity. Overexpression of candidate genes conferred resistance in diverse types of cancers. Mechanistic investigation revealed that MCL1 and JUNB overexpression mediate resistance to FasL- and TRAIL-induced cell death through the mitochondrial apoptosis pathway. JUNB downregulates FasL and TRAIL receptors, upregulates BCL2A1, and activates the NF-?B pathway. B3GNT2 promotes resistance through an orthogonal pathway by increasing poly-LacNAc on at least 10 tumor ligands and receptors to reduce T cell activation, highlighting the importance of poly-LacNAc in immuno-oncology. Furthermore, inhibition of these genes sensitized both tumor cell lines and primary patient-derived tumor models to T cell killing. This study complements results from previous loss-of-function screens and advances our understanding of the pathways that govern tumor immunotherapy.

    TABLE-US-00007 TABLE 4 Pathway analysis of the 576 candidate genes. Pathways were ranked by FDR and pathways that overlapped (>30% of genes) with another pathway that had lower FDR were removed to identify distinct pathways. negative.sub. log10_of.sub. adjusted.sub. adjusted.sub. term.sub. intersection.sub. term_name term_id p_value p_value size size intersections nucleic acid phosphodiester GO:0090305 3.52E?07 6.453115912 151 12 NOL9,HMGB2,CDKN2A,EXOSC9,RPA1, bond hydrolysis POP7,OGG1,RPS27A,RFC2,XRN1, negative regulation of Wnt GO:0030178 2.93349E?05 4.532615968 194 11 APC, PRICKLE1, NFATC1, AMER1, signaling pathway TMEM170B, TLE3, TLE2, MDK, DKK2, DAB2IP, PSMF1 glycosaminoglycan metabolic GO:0030203 5.21503E?05 4.282743425 132 9 DSEL, LYVE1, B3GAT1, DCN, B3GNT2, process SDC2, CHST13, SLC9A1, HMMR negative regulation of cellular GO:1903363 7.63E?05 4.117475546 75 7 TRIM39, CDKN2A, UBE2J1, FURIN, protein catabolic process DAB2IP, EFNA1, PSMF1 cell-matrix adhesion GO:0007160 0.000101361 3.994127445 183 10 LYVE1, CD36, ADAMTS13, ADAMTS12, SRC, CDKN2A, PTK2, SLC9A1, SEMA3E, MAP4K4 response to lipopolysaccharide GO:0032496 0.000188756 3.724099352 198 10 HMGB2, CD36, JUNB, CD14, IL1A, TNIP2, TNIP3, CD274, IFNAR1, DAB2IP cytokinesis GO:0000910 0.000208771 3.680328845 160 9 APC, CALM1, FLCN, EFHC1, SPTBN1, CDC14A, FSD1, STAMBP, SEPTIN9 carbohydrate catabolic process GO:0016052 0.000293472 3.532433089 168 9 PGM2L1, PRKAG1, CALM1, ENO2, FUT6, ARNT, FUT10, GALK2, TREH establishment or maintenance GO:0007163 0.00033168 3.479280796 171 9 CD3G, FSCN3, LMNA, PTK2, FLOT2, of cell polarity CDC42BPB, AQP1, SLC9A1, ARFGEF1 negative regulation of cellular GO:0090288 0.000577538 3.238419431 144 8 TGFBR2, DCN, ADAMTS12, NBL1, response to growth factor VEPH1, RBPMS2, RPS27A, DAB2IP stimulus cellular response to hypoxia GO:0071456 0.001132026 2.946143415 161 8 LMNA, SUV39H1, ARNT, AQP1, TERT, RPS27A, NFE2L2, PSMF1 epithelial tube morphogenesis GO:0060562 0.001218181 2.914288095 163 8 TGFBR2, ADAMTS12, PRICKLE1, BMP5, SETDB2, SEMA3E, HES1, MDK extrinsic apoptotic signaling GO:0097191 0.001357028 2.867411158 166 8 BCL2A1, SRC, BMP5, MCL1, IL1A, pathway TERT, GABARAP, DAB2IP negative regulation of GO:2001251 0.001685043 2.773388953 130 7 CTBP1, APC, SRC, CDC20, BCOR, chromosome organization TERF2IP, XRN1 cell-cell adhesion via plasma- GO:0098742 0.002463362 2.608471773 184 8 TGFBR2, BSG, CLDN14, CLDN17, membrane adhesion molecules MPZL2, CLDN8, ATP2C1, CDH18 cold-induced thermogenesis GO:0106106 0.002878731 2.540798977 144 7 APC, CD36, FLCN, ACSL1, ESRRG, TLE3, TSHR calcium-mediated signaling GO:0019722 0.00303933 2.517222177 191 8 ATP2A2, CALM1, P2RX5, NFATC1, SLC9A1, RCAN2, MCU, CCR4 positive regulation of GO:0050679 0.003822073 2.417700976 152 7 HMGB2, BMP5, NME1, NME2, ARNT, epithelial cell proliferation GATA2, MDK cellular response to radiation GO:0071478 0.003947548 2.403672563 153 7 CALM1, INO80, CDKN1A, AQP1, XRCC6, POLD3, GNGT1 spindle organization GO:0007051 0.004197215 2.377038798 155 7 EFHC1, INO80, HAUS4, NEK6, MAPRE2, FSD1, DCTN2 protein complex GO:0051259 0.004745874 2.323683798 159 7 ITLN1, TIFA, SLC9A1, MPP2, ACACA, oligomerization TDO2, MCU mitochondrial gene expression GO:0140053 0.00503924 2.297634934 161 7 IARS2, RPUSD4, MRPL15, MRPL53, WARS2, FASTKD2, CHCHD10 regulation of signal GO:1901796 0.005838568 2.233693662 167 7 PRKAG1, MAPK11, PTTG1IP, RPA1, transduction by p53 class RBBP8, RFC2, L3MBTL1 mediator platelet degranulation GO:0002576 0.006328537 2.198696707 124 6 CHID1, CD36, CALM1, ISLR, PCYOX1L, APLP2 positive regulation of I- GO:0043123 0.006472052 2.188957982 171 7 IL1A, TERF2IP, NEK6, TIFA, TNIP2, kappaB kinase/NF-kappaB ATP2C1, PLEKHG5 signaling chromatin assembly GO:0031497 0.007366838 2.132718855 176 7 HMGB2, MBD3L2, MBD3L3, CDKN2A, SETDB2, HIST1H2BB, SUV39H1 translational initiation GO:0006413 0.007741206 2.111191367 178 7 YTHDF3, RPLP1, EIF4G3, RPL6, RPL15, EIF2B3, RPS27A negative regulation of binding GO:0051100 0.008240855 2.084027708 133 6 ATP2A2, ARHGAP28, PCSK9, CDKN1A, BTAF1, PLN activation of innate immune GO:0002218 0.009265525 2.033129953 137 6 PQBP1, SRC, KRAS, PRKACB, XRCC6, response PSMF1 negative regulation of GO:1901343 0.01079629 1.966725447 192 7 COL4A3, DCN, NFATC1, ANGPTL7, vasculature development CARD10, SEMA3E, DAB2IP potassium ion transmembrane GO:0071805 0.011311093 1.946495423 194 7 KCNH6, KCNF1, NEDD4L, KCNQ2, transport SLC9A1, SLC12A6, ABCC8 receptor signaling pathway via GO:0007259 0.011348946 1.945044479 144 6 SOCS2, GHR, STAMBP, IFNAR1, HES1, JAK-STAT IFNA7 transcription initiation from GO:0006367 0.01157489 1.936483114 195 7 TCF4, CCNC, ESRRG, CDKNIA, RXRG, RNA polymerase II promoter RXRA, TEAD4 keratinization GO:0031424 0.01237825 1.907340752 198 7 KLK14, KRTAP5-6, KRT31, KRT17, KRT14, FURIN, KRTAP20-2 protein acylation GO:0043543 0.012702172 1.896122014 199 7 CTBP1, CLIP3, FLCN, TERF2IP, HHATL, CDYL, YEATS4 cellular response to external GO:0071496 0.012959226 1.887420931 200 7 FLCN, PDK2, PCSK9, CDKN1A, AQP1, stimulus SLC9A1, GABARAP nucleotide biosynthetic GO:0009165 0.012959226 1.887420931 200 7 FLCN, PDK2, ACSL1, VPS9D1, ACACA, process RNLS, DUT protein import GO:0017038 0.015216647 1.817681045 155 6 PAM16, PRICKLE1, PTTG1IP, IPO7, TNPO2, NXT2 phosphatidylinositol metabolic GO:0046488 0.017834966 1.748727716 162 6 PIGO, PIGZ, SOCS2, TPTE2, BMX, DPM3 process response to steroid hormone GO:0048545 0.023257859 1.633430274 174 6 SRC, CATSPERG, UBA5, GRIP1, AQP1, STRN3 regulation of protein GO:0032271 0.028341083 1.547583559 183 6 CLIP3, ARHGAP28, ACTR2, IQGAP2, polymerization ARFGEF1, PLEKHG2 antigen processing and GO:0048002 0.031622848 1.499999013 189 6 CD36, AP1B1, TAPBPL, DCTN2, PSMF1, presentation of peptide antigen PDIA3

    TABLE-US-00008 TABLE 5 RNA-seq analysis of differentially expressed genes for candidate ORF overexpression. Genes with > 1-fold change shown. JUNB Genes Isoform Fold Pval Padj Isoform Fold Pval Padj Isoform Fold Pval Padj LCE1F 279.05 1.63E?10 9.33E?07 NOMO2 1.46 3.75E?05 2.80E?04 BTBD7 1.25 5.63E?04 1.85E?03 LRRC38 161.85 2.04E?10 9.33E?07 TRIM58 1.74 3.77E?05 2.81E?04 DAAM2 1.19 5.63E?04 1.85E?03 LRFN5 25.73 1.58E?09 3.61E?06 COPA 1.17 3.82E?05 2.84E?04 ANKRD10 1.52 5.63E?04 1.85E?03 CD24 29.87 2.02E?09 3.69E?06 ZNF385A 1.53 3.84E?05 2.85E?04 SLC18B1 1.64 5.64E?04 1.85E?03 KRT6B 9.32 3.71E?09 4.23E?06 GNB2 1.15 3.98E?05 2.91E?04 ADCY7 1.35 5.65E?04 1.85E?03 TGFBI 7.91 3.47E?09 4.23E?06 SYT11 2.01 3.98E?05 2.91E?04 ZDHHC9 1.35 5.65E?04 1.85E?03 CYB5R2 5.20 8.57E?09 7.11E?06 PCSK1N 2.14 4.00E?05 2.91E?04 DAB2IP 1.27 5.72E?04 1.87E?03 PPIF 1.79 8.05E?09 7.11E?06 ARHGEF12 1.24 4.03E?05 2.92E?04 PPP2R1B 1.41 5.77E?04 1.88E?03 HAS2 47.21 1.47E?08 8.56E?06 PLS1 2.23 4.08E?05 2.95E?04 LRFN4 1.43 5.78E?04 1.89E?03 ACAN 46.27 1.70E?08 8.62E?06 MICA 1.20 4.10E?05 2.96E?04 CSNK1A1 1.16 5.78E?04 1.89E?03 JUNB 33.09 1.89E?08 8.62E?06 RASD2 6.50 4.10E?05 2.96E?04 KCTD5 1.17 5.83E?04 1.90E?03 COL22A1 72.60 2.62E?08 9.89E?06 OSBPL3 1.39 4.12E?05 2.97E?04 STX6 1.42 5.83E?04 1.90E?03 FERMT1 38.24 2.46E?08 9.89E?06 PTPRU 1.64 4.12E?05 2.97E?04 IFFO2 1.38 5.87E?04 1.91E?03 MSN 1.66 2.71E?08 9.89E?06 SQRDL 3.91 4.16E?05 2.99E?04 BACH1 1.26 5.88E?04 1.91E?03 ARNTL2 6.30 3.14E?08 1.05E?05 GPR158 3.44 4.20E?05 3.00E?04 OBFC1 1.36 5.91E?04 1.92E?03 HLA-B 1.95 3.45E?08 1.05E?05 RASSF3 1.30 4.20E?05 3.00E?04 ARHGAP1 1.33 5.93E?04 1.92E?03 LAMB3 7.45 3.19E?08 1.05E?05 SLC38A2 1.41 4.22E?05 3.01E?04 RAPGEF1 1.27 5.94E?04 1.92E?03 PDPN 110.29 3.36E?08 1.05E?05 RIPK4 1.85 4.23E?05 3.01E?04 KIF16B 1.35 5.97E?04 1.93E?03 MAST4 13.70 3.67E?08 1.08E?05 SALL1 1.37 4.22E?05 3.01E?04 PAFAH2 1.08 5.97E?04 1.93E?03 S100A16 2.51 3.80E?08 1.08E?05 HBEGF 2.76 4.28E?05 3.04E?04 C16orf58 1.09 6.00E?04 1.93E?03 NREP 3.21 4.18E?08 1.16E?05 ZMAT3 1.38 4.29E?05 3.04E?04 OSTF1 1.49 6.04E?04 1.95E?03 ALK 6.65 6.04E?08 1.25E?05 SULT1B1 15.01 4.31E?05 3.04E?04 DNAJC10 1.27 6.10E?04 1.97E?03 ANPEP 3.38 6.64E?08 1.25E?05 FAM168A 1.46 4.36E?05 3.07E?04 RPS3 1.08 6.15E?04 1.98E?03 BMP6 11.58 6.45E?08 1.25E?05 ASAH1 1.57 4.37E?05 3.08E?04 HAPLN3 1.58 6.16E?04 1.98E?03 CD59 2.39 5.19E?08 1.25E?05 TRIM21 2.00 4.37E?05 3.08E?04 CHMP5 1.27 6.19E?04 1.99E?03 ESM1 22.77 6.42E?08 1.25E?05 MAPKBP1 1.40 4.43E?05 3.10E?04 ERRFI1 1.13 6.36E?04 2.03E?03 FURIN 1.86 6.48E?08 1.25E?05 CANX 1.08 4.65E?05 3.22E?04 KLHL36 1.25 6.37E?04 2.03E?03 GAP43 5.92 6.04E?08 1.25E?05 ENDOD1 2.38 4.66E?05 3.23E?04 DALRD3 1.15 6.38E?04 2.03E?03 HLA-A 2.24 7.14E?08 1.25E?05 RPS20 1.08 4.70E?05 3.25E?04 KLHL5 1.48 6.38E?04 2.03E?03 IGFBP3 7.10 6.57E?08 1.25E?05 SSR3 1.18 4.73E?05 3.26E?04 WASF2 1.14 6.40E?04 2.04E?03 INHBA 7.51 6.79E?08 1.25E?05 TCAF1 1.25 4.73E?05 3.26E?04 ERCC5 1.38 6.45E?04 2.05E?03 JAG1 3.94 5.88E?08 1.25E?05 ZBTB38 1.33 4.73E?05 3.26E?04 SLK 1.24 6.45E?04 2.05E?03 KIAA0040 9.87 5.99E?08 1.25E?05 SAT1 2.51 4.76E?05 3.26E?04 MNT 1.25 6.46E?04 2.05E?03 KLHL21 2.48 7.01E?08 1.25E?05 SERPIND1 3.83 4.76E?05 3.27E?04 ZPR1 1.20 6.54E?04 2.07E?03 STRA6 2.68 7.38E?08 1.25E?05 FXYD5 1.32 4.78E?05 3.27E?04 TAP1 1.32 6.58E?04 2.08E?03 TAGLN2 1.82 5.22E?08 1.25E?05 XIAP 1.25 4.80E?05 3.27E?04 MGST1 1.24 6.59E?04 2.08E?03 VCAN 14.73 5.96E?08 1.25E?05 RAB22A 1.43 4.81E?05 3.28E?04 PBXIP1 1.31 6.63E?04 2.09E?03 ZNF611 3.71 6.53E?08 1.25E?05 AKAP13 1.19 4.87E?05 3.31E?04 FBXW4 1.27 6.67E?04 2.10E?03 KCNG1 3.26 8.83E?08 1.37E?05 LINC00623 1.81 4.88E?05 3.31E?04 YKT6 1.17 6.69E?04 2.11E?03 FLRT2 10.17 9.30E?08 1.41E?05 RGS19 1.73 4.92E?05 3.32E?04 C16orf45 1.23 6.75E?04 2.12E?03 ATP6V0A4 9.02 9.76E?08 1.41E?05 TLDC1 2.10 4.91E?05 3.32E?04 CREG1 1.15 6.79E?04 2.13E?03 RHOC 1.90 1.19E?07 1.62E?05 TRAPPC1 1.30 4.91E?05 3.32E?04 INTS7 1.15 6.79E?04 2.13E?03 S100A10 1.83 1.17E?07 1.62E?05 NAGK 1.61 5.00E?05 3.36E?04 SLC33A1 1.52 6.80E?04 2.13E?03 CDYL2 3.29 1.24E?07 1.67E?05 SLFN5 2.56 5.03E?05 3.38E?04 ZC3HAV1 1.24 6.90E?04 2.15E?03 BTBD11 16.62 1.29E?07 1.69E?05 PDE4A 1.47 5.05E?05 3.38E?04 FKBP9 1.16 6.93E?04 2.16E?03 LEMD1 6.37 1.37E?07 1.69E?05 QSOX1 1.46 5.09E?05 3.40E?04 ANXA4 1.34 6.98E?04 2.17E?03 PAPSS2 3.19 1.37E?07 1.69E?05 DNAJC5 1.13 5.20E?05 3.46E?04 CYLD 1.38 6.99E?04 2.17E?03 PI3 45.17 1.36E?07 1.69E?05 EEF2 1.21 5.30E?05 3.50E?04 SMIM3 1.94 6.99E?04 2.17E?03 STEAP3 2.33 1.34E?07 1.69E?05 MAP4K4 1.13 5.30E?05 3.50E?04 TMEM208 1.17 7.01E?04 2.18E?03 TFPI2 4.76 1.30E?07 1.69E?05 ATXN10 1.23 5.36E?05 3.53E?04 LOC102723724 1.24 7.02E?04 2.18E?03 ACOT7 1.71 1.59E?07 1.73E?05 KYNU 1.35 5.37E?05 3.54E?04 RALGPS2 1.49 7.05E?04 2.19E?03 CDKN1A 1.95 1.48E?07 1.73E?05 CDIPT 1.32 5.39E?05 3.55E?04 FLT3LG 1.66 7.06E?04 2.19E?03 COL6A3 4.73 1.53E?07 1.73E?05 RNF182 2.34 5.39E?05 3.55E?04 LIX1L 1.21 7.07E?04 2.19E?03 IL24 4.20 1.59E?07 1.73E?05 MED13 1.46 5.40E?05 3.55E?04 PLPPR2 1.28 7.07E?04 2.19E?03 OPTN 2.90 1.49E?07 1.73E?05 SETD7 1.34 5.52E?05 3.61E?04 COX6B1 1.14 7.09E?04 2.19E?03 CD55 3.45 1.66E?07 1.75E?05 MGST3 2.15 5.53E?05 3.61E?04 TMEM245 1.17 7.10E?04 2.19E?03 RPS4X 1.25 1.65E?07 1.75E?05 RRM2B 1.38 5.61E?05 3.65E?04 PYGL 1.13 7.14E?04 2.20E?03 C1orf21 3.83 1.75E?07 1.82E?05 ARPC5L 1.17 5.65E?05 3.67E?04 TMEM259 1.13 7.14E?04 2.20E?03 SERPINB2 41.26 1.78E?07 1.83E?05 SQSTM1 1.27 5.69E?05 3.69E?04 TMEM102 1.53 7.15E?04 2.20E?03 DUSP5 3.01 1.82E?07 1.84E?05 TNIP1 1.63 5.70E?05 3.69E?04 IKBKE 1.31 7.17E?04 2.21E?03 NRP1 3.02 1.90E?07 1.88E?05 SNX8 1.28 5.71E?05 3.70E?04 EHBP1L1 1.13 7.18E?04 2.21E?03 TTPAL 1.49 1.96E?07 1.92E?05 DNER 8.39 5.72E?05 3.70E?04 PRDX5 1.27 7.20E?04 2.21E?03 CHMP4C 4.70 2.01E?07 1.95E?05 PPP1R14B 1.42 5.78E?05 3.73E?04 ISG20 1.11 7.21E?04 2.21E?03 MMP14 2.79 2.12E?07 2.02E?05 FRMD3 2.09 5.84E?05 3.76E?04 GRIPAP1 1.27 7.25E?04 2.22E?03 B3GNT2 2.68 2.22E?07 2.06E?05 DNM3 2.38 5.86E?05 3.76E?04 ZBED1 1.36 7.25E?04 2.22E?03 PDZRN3 9.28 2.20E?07 2.06E?05 LRRC8A 1.24 5.87E?05 3.76E?04 ZFAND1 1.33 7.25E?04 2.22E?03 MCL1 1.53 2.30E?07 2.12E?05 NDUFB8 1.35 5.87E?05 3.76E?04 MICAL1 1.41 7.27E?04 2.23E?03 TMCC2 6.66 2.33E?07 2.12E?05 ARPC5 1.24 5.94E?05 3.80E?04 ATRAID 1.08 7.28E?04 2.23E?03 AMOTL1 2.17 2.42E?07 2.12E?05 KLF5 1.65 5.96E?05 3.81E?04 NSMAF 1.18 7.28E?04 2.23E?03 KDM6B 2.19 2.44E?07 2.12E?05 FLOT1 1.46 5.97E?05 3.81E?04 CBFB 1.21 7.33E?04 2.24E?03 FBXO27 2.95 2.52E?07 2.13E?05 ANKRD13A 1.35 6.04E?05 3.84E?04 NR3C1 1.32 7.35E?04 2.24E?03 TAGLN3 7.21 2.52E?07 2.13E?05 EAF1 1.21 6.06E?05 3.85E?04 UFC1 1.30 7.37E?04 2.25E?03 BCL2A1 32.36 2.56E?07 2.14E?05 ATP6V1G1 1.24 6.07E?05 3.86E?04 NBPF14 1.24 7.40E?04 2.25E?03 PMEPA1 2.22 2.61E?07 2.15E?05 LINC01057 1.62 6.08E?05 3.86E?04 LINC00504 1.15 7.42E?04 2.26E?03 ITGA2 7.39 2.71E?07 2.17E?05 DLX2 2.24 6.13E?05 3.88E?04 FAM114A1 1.26 7.46E?04 2.27E?03 PLEKHG5 3.50 2.66E?07 2.17E?05 VEGFB 1.28 6.17E?05 3.89E?04 DGCR2 1.13 7.47E?04 2.27E?03 SCEL 26.37 2.71E?07 2.17E?05 EFL1 1.57 6.18E?05 3.90E?04 RPS28 1.07 7.50E?04 2.28E?03 TMEM158 15.72 2.78E?07 2.17E?05 KIF13A 1.88 6.39E?05 3.99E?04 SLC1A1 1.60 7.56E?04 2.29E?03 CLMP 7.17 3.15E?07 2.21E?05 COL9A3 1.31 6.44E?05 4.01E?04 FRMD4A 1.20 7.57E?04 2.29E?03 CXCL14 33.95 3.13E?07 2.21E?05 RNF213 1.23 6.45E?05 4.02E?04 PARP12 1.73 7.68E?04 2.32E?03 LAMC1 1.40 3.10E?07 2.21E?05 APLP1 2.35 6.47E?05 4.03E?04 CEP170 1.15 7.70E?04 2.32E?03 MMP1 16.55 3.04E?07 2.21E?05 EDNRB 2.41 6.54E?05 4.06E?04 STX2 1.34 7.72E?04 2.32E?03 MYH9 1.87 2.98E?07 2.21E?05 FHOD1 1.17 6.55E?05 4.07E?04 MAGED2 1.33 7.75E?04 2.33E?03 MYO1D 3.73 2.93E?07 2.21E?05 CACNB3 1.46 6.57E?05 4.07E?04 CERCAM 1.27 7.78E?04 2.34E?03 NRCAM 4.15 2.99E?07 2.21E?05 GLRX 1.62 6.59E?05 4.07E?04 MIR100HG 1.19 7.80E?04 2.34E?03 PHLDB3 2.49 3.01E?07 2.21E?05 FAM127A 1.48 6.60E?05 4.07E?04 CLDND1 1.25 7.81E?04 2.34E?03 RTL1 7.42 3.08E?07 2.21E?05 NIPA1 1.22 6.67E?05 4.11E?04 TM9SF3 1.25 7.83E?04 2.35E?03 S100A6 1.71 2.87E?07 2.21E?05 MROH1 1.76 6.77E?05 4.17E?04 PNPLA8 1.22 7.90E?04 2.37E?03 MMP10 43.42 3.22E?07 2.25E?05 MFHAS1 1.55 6.83E?05 4.18E?04 LGMN 1.67 7.97E?04 2.38E?03 NTSR1 4.74 3.48E?07 2.29E?05 SNX29 1.35 6.83E?05 4.18E?04 IL10RB 1.21 7.99E?04 2.38E?03 TRPV2 2.00 3.46E?07 2.29E?05 DBN1 1.42 6.84E?05 4.19E?04 PLK3 1.32 8.01E?04 2.39E?03 CTSS 15.14 3.65E?07 2.32E?05 TPBG 1.42 6.84E?05 4.19E?04 DNAJC4 1.27 8.07E?04 2.40E?03 S100A1 2.18 3.64E?07 2.32E?05 RAI14 1.60 6.89E?05 4.21E?04 CHIC2 1.26 8.14E?04 2.41E?03 SDC1 3.19 3.67E?07 2.32E?05 RAP2B 2.06 6.89E?05 4.21E?04 TIPARP 1.25 8.23E?04 2.44E?03 SETBP1 4.44 3.68E?07 2.32E?05 IFI30 1.43 7.03E?05 4.26E?04 IL1RAPL1 1.61 8.27E?04 2.44E?03 TMEM2 3.18 3.68E?07 2.32E?05 MORF4L2 1.13 7.04E?05 4.26E?04 ZBTB4 1.25 8.29E?04 2.45E?03 NR4A1 2.01 3.78E?07 2.35E?05 MYSM1 1.62 7.05E?05 4.26E?04 ACO1 1.12 8.31E?04 2.45E?03 WNT5A 2.66 3.75E?07 2.35E?05 RCN1 1.33 7.05E?05 4.26E?04 TMEM258 1.24 8.33E?04 2.46E?03 ERGIC1 2.14 3.91E?07 2.36E?05 SHROOM4 1.70 7.04E?05 4.26E?04 NOL9 1.27 8.35E?04 2.46E?03 KIAA1549L 2.41 3.87E?07 2.36E?05 SVIL 1.50 7.05E?05 4.26E?04 TMEM127 1.28 8.51E?04 2.50E?03 SLC1A6 50.01 3.92E?07 2.36E?05 CD96 1.33 7.11E?05 4.29E?04 C6orf1 1.19 8.56E?04 2.51E?03 NCAM1 6.18 4.02E?07 2.40E?05 FSCN1 1.22 7.14E?05 4.30E?04 PLEC 1.21 8.56E?04 2.51E?03 ABHD2 1.95 4.44E?07 2.46E?05 SOX10 1.30 7.15E?05 4.30E?04 ARL4C 1.49 8.60E?04 2.52E?03 ABR 1.63 4.46E?07 2.46E?05 SERINCS 2.02 7.19E?05 4.31E?04 GOLT1B 1.27 8.60E?04 2.52E?03 BRINP2 14.54 4.41E?07 2.46E?05 PPP1R26 1.29 7.26E?05 4.33E?04 STT3A 1.08 8.60E?04 2.52E?03 CCL3 26.58 4.30E?07 2.46E?05 KCNN4 1.69 7.27E?05 4.34E?04 ZCCHC6 1.31 8.62E?04 2.52E?03 FYN 1.65 4.48E?07 2.46E?05 RAB11FIP1 1.47 7.48E?05 4.44E?04 KMT2D 1.09 8.63E?04 2.52E?03 NMNAT2 2.95 4.47E?07 2.46E?05 LIMS1 1.28 7.50E?05 4.44E?04 POPDC3 1.30 8.67E?04 2.53E?03 TBX2 3.15 4.39E?07 2.46E?05 PLD3 1.53 7.50E?05 4.44E?04 YAP1 1.25 8.68E?04 2.53E?03 ATOX1 1.90 4.62E?07 2.47E?05 LOC101929959 1.14 7.55E?05 4.46E?04 ARF4 1.17 8.77E?04 2.56E?03 FHL2 2.54 4.63E?07 2.47E?05 SH2D2A 3.93 7.61E?05 4.48E?04 TRIM11 1.15 8.84E?04 2.57E?03 NT5E 2.78 4.65E?07 2.47E?05 MARVELD1 1.38 7.65E?05 4.50E?04 MAPKAPK2 1.26 8.84E?04 2.57E?03 ULK1 3.14 4.60E?07 2.47E?05 SCAF11 1.09 7.70E?05 4.52E?04 RANGAP1 1.12 8.93E?04 2.59E?03 CDCP1 13.40 4.68E?07 2.47E?05 ZFYVE16 1.71 7.76E?05 4.55E?04 NTM 1.81 8.95E?04 2.60E?03 PFDN2 1.41 4.76E?07 2.50E?05 DPP3 1.23 7.80E?05 4.57E?04 STUB1 1.14 8.96E?04 2.60E?03 ADAM19 2.25 4.84E?07 2.51E?05 SLC52A2 1.38 7.80E?05 4.57E?04 LAMB2 1.25 8.97E?04 2.60E?03 LYPD1 3.41 4.97E?07 2.53E?05 DSG2 1.26 7.83E?05 4.58E?04 FAM222B 1.17 9.00E?04 2.61E?03 MYL6 1.58 4.94E?07 2.53E?05 SRPK1 1.07 7.91E?05 4.61E?04 ENC1 1.15 9.02E?04 2.61E?03 MET 1.88 5.12E?07 2.56E?05 GNB1 1.19 7.93E?05 4.61E?04 FBXO28 1.20 9.03E?04 2.62E?03 PKIA 3.71 5.07E?07 2.56E?05 PDGFC 2.62 7.95E?05 4.62E?04 IDUA 1.52 9.04E?04 2.62E?03 S100A2 3.12 5.24E?07 2.60E?05 FAM89B 1.49 8.05E?05 4.66E?04 DYNLRB1 1.10 9.11E?04 2.63E?03 PTGFRN 2.01 5.52E?07 2.68E?05 PRKCDBP 2.28 8.05E?05 4.66E?04 NORAD 1.13 9.37E?04 2.70E?03 LPXN 3.52 5.61E?07 2.68E?05 SLC35C1 1.51 8.12E?05 4.68E?04 FMN2 1.59 9.43E?04 2.71E?03 PLA2G4A 8.02 5.58E?07 2.68E?05 TATDN2 1.27 8.17E?05 4.71E?04 TAX1BP3 1.23 9.43E?04 2.71E?03 DSP 3.92 5.79E?07 2.71E?05 PARP3 1.51 8.18E?05 4.71E?04 PNPLA2 1.14 9.43E?04 2.71E?03 SLAMF9 16.53 6.00E?07 2.78E?05 PPTC7 1.42 8.22E?05 4.72E?04 HIST1H2AC 1.97 9.47E?04 2.72E?03 LCE1E 290.24 6.29E?07 2.84E?05 TLE3 1.38 8.28E?05 4.75E?04 SAGE1 1.25 9.48E?04 2.72E?03 NFKB2 2.35 6.28E?07 2.84E?05 IGSF8 1.90 8.30E?05 4.75E?04 NOV 1.63 9.51E?04 2.73E?03 TIMP3 2.06 6.27E?07 2.84E?05 AES 1.25 8.38E?05 4.79E?04 LOC102723728 1.36 9.55E?04 2.74E?03 MPZL1 1.46 6.34E?07 2.85E?05 ARRDC2 1.38 8.45E?05 4.83E?04 TMEM64 1.27 9.57E?04 2.74E?03 LGALS1 1.30 6.37E?07 2.85E?05 IMPDH1 1.28 8.48E?05 4.84E?04 XBP1 1.15 9.66E?04 2.76E?03 TIMP1 4.53 6.45E?07 2.87E?05 AKR1C2 2.34 8.56E?05 4.87E?04 REEP5 1.19 9.70E?04 2.77E?03 CXCL8 8.05 6.64E?07 2.93E?05 PORCN 2.11 8.57E?05 4.88E?04 RELT 1.52 9.70E?04 2.77E?03 WSCD1 6.36 6.76E?07 2.95E?05 FOXN2 1.59 8.63E?05 4.90E?04 RPRD1A 1.50 9.77E?04 2.79E?03 KCNS3 3.22 6.82E?07 2.97E?05 FAM107B 2.32 8.70E?05 4.93E?04 CHMP3 1.24 9.78E?04 2.79E?03 A4GALT 6.11 6.97E?07 3.00E?05 PICALM 1.30 8.78E?05 4.96E?04 PGPEP1 1.43 9.86E?04 2.81E?03 DUSP1 10.47 6.96E?07 3.00E?05 GALNT7 1.53 8.79E?05 4.97E?04 HM13 1.10 9.96E?04 2.84E?03 BIRC2 2.89 7.23E?07 3.07E?05 LOC105372663 6.01 8.83E?05 4.98E?04 YIPF5 1.26 9.98E?04 2.84E?03 LIF 4.55 7.21E?07 3.07E?05 TBX3 1.36 8.97E?05 5.05E?04 PLPP5 1.32 1.00E?03 2.85E?03 ANXA2 1.58 7.31E?07 3.07E?05 VPS9D1 1.25 8.98E?05 5.05E?04 EPN2 1.29 1.00E?03 2.85E?03 HIVEP2 2.16 7.42E?07 3.09E?05 HIGD1A 1.20 9.02E?05 5.07E?04 SHARPIN 1.23 1.01E?03 2.86E?03 FN1 1.36 7.50E?07 3.10E?05 RELA 1.39 9.06E?05 5.08E?04 SDE2 1.21 1.01E?03 2.87E?03 USP43 6.71 7.66E?07 3.12E?05 RRAS 1.66 9.07E?05 5.08E?04 ABAT 1.51 1.01E?03 2.87E?03 AKAP12 1.74 7.74E?07 3.13E?05 TTC14 1.31 9.09E?05 5.08E?04 POGK 1.24 1.01E?03 2.87E?03 S100A13 1.54 7.96E?07 3.17E?05 CD82 1.95 9.13E?05 5.10E?04 DAPK3 1.23 1.02E?03 2.87E?03 LCE3E 106.45 8.10E?07 3.19E?05 TMEM8A 1.69 9.13E?05 5.10E?04 PITPNM2 1.56 1.02E?03 2.87E?03 BMP2 12.05 8.50E?07 3.30E?05 GLIS3 1.68 9.14E?05 5.10E?04 ADGRES 1.17 1.02E?03 2.88E?03 BIRC3 10.78 8.77E?07 3.39E?05 ATP6V1A 1.17 9.16E?05 5.11E?04 NADSYN1 1.38 1.02E?03 2.88E?03 MBOAT2 3.19 8.95E?07 3.43E?05 RAB7A 1.26 9.23E?05 5.14E?04 EEF2KMT 1.25 1.03E?03 2.89E?03 AGTRAP 1.57 9.66E?07 3.63E?05 LOC101927120 12.44 9.24E?05 5.14E?04 TMEM189 1.14 1.03E?03 2.90E?03 ETHE1 3.10 9.66E?07 3.63E?05 MSL2 1.18 9.27E?05 5.15E?04 TRPM4 1.57 1.03E?03 2.91E?03 KLF7 3.68 9.90E?07 3.66E?05 CRCT1 15.56 9.29E?05 5.16E?04 C14orf159 1.62 1.04E?03 2.93E?03 NFASC 3.74 9.89E?07 3.66E?05 H6PD 1.28 9.29E?05 5.16E?04 RNF13 1.15 1.04E?03 2.93E?03 CST1 186.40 1.06E?06 3.86E?05 UCA1 2.72 9.37E?05 5.20E?04 WFS1 1.26 1.05E?03 2.94E?03 EPAS1 10.90 1.07E?06 3.88E?05 TCF7L2 1.51 9.53E?05 5.27E?04 SLC9B2 1.32 1.05E?03 2.95E?03 FAM19A2 7.06 1.09E?06 3.92E?05 AP1B1 1.18 9.55E?05 5.27E?04 ZNF707 1.16 1.05E?03 2.95E?03 ANGPTL2 3.13 1.11E?06 3.95E?05 FBN1 1.38 9.60E?05 5.29E?04 LMF2 1.41 1.05E?03 2.95E?03 OPRL1 18.22 1.13E?06 3.98E?05 FEM1C 1.30 9.62E?05 5.29E?04 LOC100507377 1.33 1.06E?03 2.97E?03 GEM 4.40 1.19E?06 4.10E?05 10-Sep 1.30 9.61E?05 5.29E?04 TSPAN3 1.32 1.06E?03 2.97E?03 MYADM 1.68 1.20E?06 4.11E?05 TM4SF19 1.71 9.60E?05 5.29E?04 DENNDSA 1.29 1.07E?03 2.98E?03 STC1 5.09 1.20E?06 4.11E?05 CYFIP2 1.98 9.62E?05 5.29E?04 PPP2R5B 1.29 1.07E?03 3.00E?03 ALDH1A3 1.30 1.23E?06 4.17E?05 IRS2 1.36 9.63E?05 5.29E?04 CDC37 1.07 1.08E?03 3.00E?03 PITPNC1 3.14 1.28E?06 4.28E?05 HS3ST3B1 5.60 9.66E?05 5.30E?04 TSHZ1 1.25 1.08E?03 3.00E?03 TMBIM1 2.26 1.28E?06 4.28E?05 NFE2L1 1.14 9.82E?05 5.37E?04 ATP6V0B 1.15 1.09E?03 3.02E?03 SPANXB1 3.12 1.29E?06 4.29E?05 RNF215 1.57 9.82E?05 5.37E?04 TCEAL1 2.07 1.10E?03 3.04E?03 IFNGR1 2.14 1.31E?06 4.29E?05 VIM 1.18 9.83E?05 5.37E?04 NECAP2 1.23 1.12E?03 3.09E?03 TPM4 1.42 1.30E?06 4.29E?05 CYTH2 1.31 9.86E?05 5.37E?04 TMEM63B 1.28 1.12E?03 3.09E?03 CIT 2.60 1.38E?06 4.42E?05 TRPS1 1.66 9.89E?05 5.38E?04 ZFP36 1.52 1.12E?03 3.10E?03 NRP2 1.96 1.36E?06 4.42E?05 STARD13 1.70 1.00E?04 5.45E?04 CDR2L 1.51 1.13E?03 3.11E?03 SPOCK1 2.78 1.36E?06 4.42E?05 STEAP1B 1.42 1.01E?04 5.48E?04 MAPKAP1 1.18 1.13E?03 3.11E?03 ST3GAL1 2.10 1.37E?06 4.42E?05 SPAG9 1.44 1.01E?04 5.48E?04 EMC10 1.48 1.13E?03 3.12E?03 ITGAS 2.24 1.39E?06 4.43E?05 SYVN1 1.38 1.01E?04 5.48E?04 SDF2 1.16 1.13E?03 3.13E?03 PERP 1.86 1.40E?06 4.43E?05 ARAP1 1.33 1.02E?04 5.51E?04 EEF1A1 1.08 1.14E?03 3.13E?03 TMBIM6 1.16 1.39E?06 4.43E?05 MAFG 1.50 1.02E?04 5.53E?04 B3GAT3 1.22 1.15E?03 3.15E?03 WNT9A 8.21 1.40E?06 4.43E?05 GADD45B 1.80 1.02E?04 5.54E?04 CD164 1.20 1.16E?03 3.18E?03 FAT3 5.84 1.46E?06 4.60E?05 DMKN 2.57 1.03E?04 5.54E?04 DPP9 1.11 1.16E?03 3.18E?03 HMOX1 4.62 1.49E?06 4.62E?05 C7orf43 1.36 1.03E?04 5.54E?04 PGRMC1 1.14 1.16E?03 3.19E?03 LCE1C 79.96 1.49E?06 4.62E?05 DUSP7 1.29 1.04E?04 5.60E?04 WDFY2 1.61 1.16E?03 3.19E?03 RNF19B 3.91 1.49E?06 4.62E?05 UBA6-AS1 1.78 1.05E?04 5.60E?04 PPP4R1 1.42 1.18E?03 3.22E?03 TOMM34 1.90 1.49E?06 4.62E?05 GALNT6 2.73 1.05E?04 5.61E?04 FAM199X 1.12 1.18E?03 3.23E?03 ADIPOR1 1.45 1.55E?06 4.67E?05 KCNC4 4.83 1.06E?04 5.64E?04 BCAS3 1.67 1.18E?03 3.23E?03 BPGM 3.63 1.53E?06 4.67E?05 PLOD1 1.26 1.06E?04 5.64E?04 C6orf89 1.17 1.18E?03 3.23E?03 TM4SF1 3.11 1.56E?06 4.67E?05 SZT2 1.16 1.06E?04 5.64E?04 NDN 1.25 1.18E?03 3.23E?03 DIP2B 3.61 1.60E?06 4.74E?05 MMP9 6.53 1.06E?04 5.65E?04 GPN1 1.26 1.19E?03 3.24E?03 CD93 11.75 1.62E?06 4.75E?05 CALCOCO1 1.42 1.07E?04 5.65E?04 PAQR4 1.20 1.19E?03 3.24E?03 SREK1IP1 2.09 1.61E?06 4.75E?05 UBL3 1.52 1.07E?04 5.65E?04 SLCO4A1-AS1 1.47 1.19E?03 3.24E?03 STIM1 2.05 1.62E?06 4.75E?05 SLC20A1 1.19 1.08E?04 5.68E?04 UHMK1 1.19 1.19E?03 3.24E?03 TLN2 3.95 1.63E?06 4.75E?05 MLXIP 1.40 1.09E?04 5.74E?04 YIPF3 1.12 1.19E?03 3.24E?03 GRB10 3.48 1.66E?06 4.77E?05 ABI1 1.39 1.09E?04 5.75E?04 PAFAH1B2 1.25 1.19E?03 3.24E?03 GPRC5A 1.95 1.70E?06 4.78E?05 TMEM87A 1.37 1.10E?04 5.76E?04 SMAD7 2.17 1.20E?03 3.27E?03 LRIG1 4.18 1.69E?06 4.78E?05 CEP170B 1.57 1.10E?04 5.78E?04 C11orf68 1.39 1.21E?03 3.28E?03 PFKFB4 2.37 1.68E?06 4.78E?05 LOC102724122 1.61 1.10E?04 5.78E?04 C9orf72 1.70 1.21E?03 3.28E?03 PLAUR 2.45 1.67E?06 4.78E?05 ITM2B 1.11 1.11E?04 5.78E?04 TPM3 1.11 1.21E?03 3.28E?03 HMGA2 2.09 1.71E?06 4.79E?05 HES1 1.72 1.11E?04 5.80E?04 TRIM35 1.55 1.22E?03 3.29E?03 ACPP 24.20 1.72E?06 4.80E?05 MAGEA10 1.69 1.11E?04 5.81E?04 COX1 1.16 1.24E?03 3.34E?03 TMSB10 1.60 1.73E?06 4.82E?05 CCNDBP1 1.58 1.11E?04 5.81E?04 RNASEK 1.31 1.24E?03 3.35E?03 MYD88 3.03 1.74E?06 4.83E?05 ZNF267 1.85 1.12E?04 5.82E?04 TMEM134 1.42 1.25E?03 3.37E?03 CCDC71L 1.84 1.76E?06 4.85E?05 B2M 1.29 1.12E?04 5.82E?04 ZFAND6 1.20 1.26E?03 3.39E?03 GALNT9 13.43 1.78E?06 4.85E?05 AHRR 1.39 1.12E?04 5.82E?04 HLA-F 1.82 1.26E?03 3.39E?03 KRTAP2-3 6.40 1.78E?06 4.85E?05 CALD1 1.39 1.12E?04 5.82E?04 MEX3C 1.18 1.26E?03 3.40E?03 PHLDA1 1.58 1.77E?06 4.85E?05 SMAP1 1.25 1.12E?04 5.82E?04 BET1L 1.12 1.27E?03 3.41E?03 ACTG1 1.35 1.78E?06 4.85E?05 MAN2B1 1.40 1.13E?04 5.83E?04 FBXO11 1.19 1.29E?03 3.45E?03 RGMB 3.23 1.79E?06 4.85E?05 MDGA1 5.88 1.14E?04 5.87E?04 PCBD1 1.30 1.29E?03 3.46E?03 ACOT9 1.92 1.81E?06 4.89E?05 FGFR1 1.43 1.15E?04 5.89E?04 BHLHE40 1.39 1.29E?03 3.46E?03 PTPRZ1 33.73 1.85E?06 4.95E?05 FLOT2 1.38 1.15E?04 5.89E?04 GNAI1 1.47 1.30E?03 3.47E?03 TRNP1 2.20 1.85E?06 4.95E?05 NPDC1 1.90 1.15E?04 5.89E?04 NDEL1 1.22 1.32E?03 3.51E?03 FEZ1 1.50 1.97E?06 5.14E?05 CENPM 1.65 1.15E?04 5.89E?04 SMIM19 1.23 1.32E?03 3.52E?03 SMTN 2.09 1.97E?06 5.14E?05 ABLIM1 1.93 1.15E?04 5.91E?04 UHRF2 1.42 1.33E?03 3.54E?03 C1orf198 3.14 2.07E?06 5.32E?05 GAK 1.40 1.16E?04 5.91E?04 PTTG1IP 1.18 1.34E?03 3.57E?03 KPRP 54.25 2.06E?06 5.32E?05 CTHRC1 2.10 1.17E?04 5.98E?04 SMARCA2 1.27 1.34E?03 3.57E?03 NUP50 1.87 2.07E?06 5.32E?05 RPL10 1.12 1.17E?04 5.98E?04 DPY19L3 1.33 1.34E?03 3.57E?03 IGF2R 1.16 2.17E?06 5.42E?05 TERF2IP 1.18 1.17E?04 5.98E?04 HYAL3 1.59 1.35E?03 3.57E?03 NUAK2 7.22 2.15E?06 5.42E?05 ZNF275 1.62 1.17E?04 5.98E?04 HS3ST3A1 1.22 1.35E?03 3.58E?03 SEL1L3 2.22 2.15E?06 5.42E?05 MYO10 1.78 1.19E?04 6.06E?04 PRCP 1.27 1.35E?03 3.58E?03 GRN 1.61 2.19E?06 5.45E?05 DHRS1 1.81 1.21E?04 6.12E?04 FAM134C 1.17 1.37E?03 3.61E?03 MAP1B 2.08 2.20E?06 5.45E?05 EIF1 1.20 1.21E?04 6.13E?04 ADO 1.40 1.37E?03 3.62E?03 TMCC3 2.82 2.24E?06 5.50E?05 CTSB 1.24 1.22E?04 6.16E?04 SP100 1.47 1.37E?03 3.62E?03 LINC00941 3.78 2.28E?06 5.53E?05 SLC2A13 2.67 1.23E?04 6.22E?04 ZNF444 1.20 1.37E?03 3.62E?03 ATG101 1.23 2.30E?06 5.55E?05 NOP9 1.14 1.24E?04 6.24E?04 SLC35F2 1.39 1.38E?03 3.63E?03 S100A11 1.85 2.36E?06 5.67E?05 ARHGEF4 2.31 1.24E?04 6.26E?04 NENF 1.14 1.38E?03 3.63E?03 JOSD1 1.67 2.37E?06 5.68E?05 ENTPD7 1.57 1.25E?04 6.27E?04 EDEM3 1.17 1.38E?03 3.64E?03 GAS6 1.81 2.39E?06 5.70E?05 KIF1C 1.15 1.25E?04 6.27E?04 SLC4A3 1.39 1.38E?03 3.64E?03 ARPC1B 1.61 2.41E?06 5.74E?05 RAB6A 1.33 1.25E?04 6.27E?04 EDEM2 1.17 1.39E?03 3.65E?03 LRRFIP1 1.73 2.48E?06 5.82E?05 REST 1.27 1.25E?04 6.28E?04 MYO1E 1.12 1.39E?03 3.66E?03 MVP 1.81 2.48E?06 5.82E?05 ACTB 1.08 1.25E?04 6.29E?04 FAM214A 1.23 1.39E?03 3.66E?03 PSAP 1.61 2.48E?06 5.82E?05 MAP3K4 1.43 1.26E?04 6.30E?04 INSIG1 1.21 1.39E?03 3.66E?03 ZNF536 3.88 2.46E?06 5.82E?05 POLD4 1.48 1.27E?04 6.32E?04 ELK4 1.31 1.40E?03 3.66E?03 MAP1S 1.79 2.49E?06 5.83E?05 VAT1L 1.78 1.27E?04 6.32E?04 ARPP19 1.15 1.40E?03 3.67E?03 ARSB 5.08 2.52E?06 5.85E?05 CSRP1 1.33 1.27E?04 6.34E?04 KRT15 1.38 1.41E?03 3.69E?03 HGS 1.41 2.52E?06 5.85E?05 ALDH9A1 1.23 1.27E?04 6.34E?04 LGALS3BP 1.14 1.41E?03 3.69E?03 PDLIM7 2.22 2.54E?06 5.86E?05 PDLIM4 1.24 1.27E?04 6.35E?04 ARHGAP31 1.39 1.42E?03 3.71E?03 HLA-C 1.34 2.55E?06 5.86E?05 CAP1 1.18 1.28E?04 6.36E?04 CSTB 1.26 1.43E?03 3.75E?03 CDK5R1 1.75 2.63E?06 5.95E?05 SEC61A1 1.14 1.28E?04 6.37E?04 FAM234A 1.17 1.44E?03 3.77E?03 PRRT4 15.52 2.66E?06 5.99E?05 GALNT1 1.32 1.28E?04 6.37E?04 KDELC1 1.31 1.45E?03 3.78E?03 CCDC80 2.95 2.69E?06 6.02E?05 GM2A 1.41 1.28E?04 6.37E?04 CMAS 1.23 1.45E?03 3.78E?03 UBA1 1.17 2.74E?06 6.08E?05 ISCA1 1.48 1.30E?04 6.42E?04 PDPK1 1.19 1.47E?03 3.82E?03 WLS 1.53 2.77E?06 6.11E?05 NDFIP1 1.23 1.30E?04 6.42E?04 SLC25A4 1.14 1.47E?03 3.82E?03 GIPC1 1.30 2.79E?06 6.13E?05 PRR12 1.12 1.31E?04 6.46E?04 EIF2AK1 1.16 1.48E?03 3.85E?03 BLACAT1 2.56 2.80E?06 6.14E?05 MAFK 1.66 1.31E?04 6.47E?04 MGC72080 1.31 1.48E?03 3.85E?03 USP11 1.53 2.84E?06 6.19E?05 RASAL2 1.22 1.32E?04 6.50E?04 SIK3 1.32 1.48E?03 3.85E?03 GALNT12 9.13 2.85E?06 6.19E?05 ANKRA2 1.63 1.34E?04 6.56E?04 UHRF1BP1L 1.22 1.48E?03 3.85E?03 CD9 2.43 2.89E?06 6.19E?05 COPZ2 1.62 1.34E?04 6.57E?04 WIPI1 1.36 1.49E?03 3.86E?03 CUEDC1 1.41 2.87E?06 6.19E?05 FRYL 1.38 1.34E?04 6.57E?04 STXBP3 1.25 1.50E?03 3.90E?03 LCE1D 183.66 2.88E?06 6.19E?05 PRKCD 1.36 1.35E?04 6.61E?04 CD81 1.18 1.51E?03 3.91E?03 NPC1 1.52 2.90E?06 6.19E?05 SLC1A4 1.42 1.36E?04 6.66E?04 PTRH1 1.50 1.53E?03 3.95E?03 PNP 1.84 2.89E?06 6.19E?05 CORO1B 1.22 1.36E?04 6.66E?04 BLOC1S6 1.13 1.53E?03 3.96E?03 ND3 1.26 2.91E?06 6.19E?05 C7orf73 1.34 1.37E?04 6.68E?04 IFI27L2 1.59 1.54E?03 3.97E?03 G3BP1 1.23 2.96E?06 6.25E?05 ICAM1 1.43 1.37E?04 6.68E?04 DYRK3 1.16 1.54E?03 3.97E?03 ID1 2.35 2.96E?06 6.25E?05 PIKFYVE 1.36 1.38E?04 6.72E?04 SNX30 1.29 1.55E?03 4.00E?03 CXCL1 3.12 3.01E?06 6.32E?05 DNAJB9 1.67 1.40E?04 6.79E?04 SIRPB1 2.12 1.55E?03 4.00E?03 MYO5A 2.62 3.03E?06 6.34E?05 PLPP4 1.87 1.40E?04 6.79E?04 HTT 1.11 1.56E?03 4.01E?03 CCND1 1.23 3.05E?06 6.38E?05 KLF6 1.82 1.41E?04 6.81E?04 GZF1 1.80 1.56E?03 4.01E?03 FBXO32 2.47 3.08E?06 6.38E?05 LTBP3 1.20 1.41E?04 6.81E?04 RAB18 1.31 1.57E?03 4.05E?03 MELTF 1.81 3.08E?06 6.38E?05 WBP1L 1.42 1.41E?04 6.82E?04 UBL5 1.07 1.59E?03 4.08E?03 PIEZO1 1.60 3.09E?06 6.38E?05 ELK3 1.07 1.42E?04 6.82E?04 ATG13 1.05 1.60E?03 4.09E?03 CAPN1 1.58 3.13E?06 6.44E?05 PTPRM 2.41 1.42E?04 6.82E?04 DNASE1L1 1.54 1.60E?03 4.10E?03 AREG 9.92 3.14E?06 6.45E?05 TUBB3 1.27 1.42E?04 6.82E?04 CLPTM1 1.10 1.61E?03 4.10E?03 ARIDSA 3.00 3.14E?06 6.45E?05 BCAS4 1.51 1.42E?04 6.84E?04 LKAAEAR1 7.81 1.60E?03 4.10E?03 SLC39A6 1.74 3.20E?06 6.54E?05 HIST1H2BK 2.47 1.43E?04 6.84E?04 KCTD11 1.52 1.62E?03 4.12E?03 RHOB 1.83 3.23E?06 6.57E?05 GRINA 1.23 1.44E?04 6.89E?04 FAM50A 1.12 1.62E?03 4.13E?03 PARP4 1.31 3.25E?06 6.59E?05 ANKRD36BP1 1.78 1.44E?04 6.89E?04 RCAN3 1.35 1.62E?03 4.13E?03 BTG1 1.49 3.28E?06 6.63E?05 PHKA1 1.52 1.44E?04 6.90E?04 TEX30 1.51 1.63E?03 4.15E?03 SORBS2 2.08 3.31E?06 6.64E?05 PTHLH 2.23 1.45E?04 6.91E?04 LOC100506548 1.28 1.63E?03 4.15E?03 CYBA 1.41 3.35E?06 6.68E?05 PSEN2 1.55 1.45E?04 6.94E?04 ACTR3 1.12 1.65E?03 4.18E?03 C3orf67 3.51 3.39E?06 6.69E?05 GPR161 1.80 1.46E?04 6.95E?04 MAVS 1.11 1.65E?03 4.18E?03 PYGB 1.29 3.38E?06 6.69E?05 TBC1D9B 1.11 1.48E?04 7.05E?04 DUSP23 1.23 1.66E?03 4.20E?03 TWF1 1.88 3.39E?06 6.69E?05 TBC1D9 1.88 1.49E?04 7.08E?04 SLCO4A1 1.28 1.66E?03 4.22E?03 LCE3D 107.08 3.43E?06 6.75E?05 VPS13C 1.31 1.49E?04 7.09E?04 RPS6KA4 1.18 1.67E?03 4.24E?03 PARM1 5.09 3.46E?06 6.77E?05 RECQL 1.21 1.50E?04 7.10E?04 BICD1 1.23 1.68E?03 4.24E?03 IL1A 4.03 3.69E?06 7.09E?05 TNFRSF25 2.66 1.50E?04 7.12E?04 PCGF3 1.09 1.68E?03 4.25E?03 OXSR1 1.62 3.71E?06 7.10E?05 RNF149 3.14 1.50E?04 7.12E?04 ZNF598 1.16 1.68E?03 4.25E?03 UCN2 3.37 3.77E?06 7.17E?05 IL11 1.55 1.51E?04 7.14E?04 WDR13 1.22 1.71E?03 4.30E?03 HMCN2 35.09 3.88E?06 7.29E?05 ZCCHC14 1.53 1.52E?04 7.17E?04 NOMO1 1.15 1.71E?03 4.31E?03 PMP22 1.36 4.12E?06 7.62E?05 ANKS6 1.49 1.52E?04 7.18E?04 ITPKB 1.44 1.71E?03 4.31E?03 FKBP10 1.41 4.18E?06 7.69E?05 LINC00467 1.22 1.53E?04 7.23E?04 SETD1B 1.11 1.73E?03 4.34E?03 PROSER2 3.15 4.21E?06 7.71E?05 IFT80 1.52 1.54E?04 7.24E?04 TRPC4AP 1.07 1.73E?03 4.34E?03 CDK17 2.28 4.23E?06 7.73E?05 SERGEF 1.49 1.54E?04 7.26E?04 SLC6A8 1.05 1.73E?03 4.34E?03 IRAK2 3.73 4.32E?06 7.81E?05 FAM134A 1.34 1.56E?04 7.33E?04 TGOLN2 1.05 1.73E?03 4.35E?03 FKBP1A 1.28 4.47E?06 7.96E?05 CNKSR3 1.69 1.58E?04 7.37E?04 DECR1 1.44 1.74E?03 4.36E?03 HIST2H2AA3 2.63 4.46E?06 7.96E?05 TACC1 1.25 1.58E?04 7.37E?04 DOCK7 1.34 1.74E?03 4.37E?03 HIST2H2AA4 2.63 4.46E?06 7.96E?05 GDNF 2.20 1.58E?04 7.38E?04 NCSTN 1.12 1.75E?03 4.37E?03 IKZF2 6.86 4.50E?06 7.98E?05 KRT14 1.21 1.58E?04 7.38E?04 GMIP 1.28 1.75E?03 4.38E?03 SYNJ2 2.13 4.50E?06 7.98E?05 SGK1 1.40 1.59E?04 7.39E?04 ZNFX1 1.25 1.76E?03 4.40E?03 TAC1 20.39 4.49E?06 7.98E?05 HGSNAT 1.30 1.59E?04 7.40E?04 AHNAK 1.16 1.77E?03 4.41E?03 NDRG1 1.73 4.54E?06 8.01E?05 SPSB1 1.96 1.60E?04 7.42E?04 NUDT22 1.24 1.77E?03 4.42E?03 ETS1 2.42 4.67E?06 8.19E?05 SYNGR2 1.37 1.60E?04 7.43E?04 PELI1 1.40 1.77E?03 4.42E?03 LOC100996740 2.10 4.69E?06 8.19E?05 PBX3 1.24 1.60E?04 7.44E?04 MESDC1 1.40 1.78E?03 4.42E?03 TRIO 1.77 4.69E?06 8.19E?05 RGP1 1.19 1.62E?04 7.50E?04 MTAP 1.06 1.78E?03 4.43E?03 RNF144A 1.72 4.82E?06 8.31E?05 TMEM54 1.57 1.62E?04 7.51E?04 AIG1 1.59 1.79E?03 4.45E?03 TRPV4 1.89 4.81E?06 8.31E?05 UBE2Z 1.27 1.63E?04 7.54E?04 UGGT1 1.06 1.79E?03 4.45E?03 PTGS2 14.30 4.90E?06 8.38E?05 GNAI2 1.36 1.65E?04 7.60E?04 LINC00622 1.75 1.80E?03 4.47E?03 PRNP 1.92 4.92E?06 8.40E?05 MYL12A 1.31 1.65E?04 7.62E?04 CHTF8 1.06 1.80E?03 4.47E?03 ADGRE2 2.23 4.94E?06 8.43E?05 TAPBP 1.51 1.65E?04 7.62E?04 CD47 1.20 1.81E?03 4.49E?03 FAS 2.13 4.96E?06 8.44E?05 APOD 2.35 1.66E?04 7.63E?04 MKRN1 1.16 1.82E?03 4.50E?03 ADK 2.22 5.09E?06 8.59E?05 TAF4B 1.41 1.66E?04 7.63E?04 UBE2L6 1.22 1.84E?03 4.53E?03 TRIB1 1.61 5.09E?06 8.59E?05 NR1D2 1.31 1.66E?04 7.64E?04 SESN2 1.21 1.84E?03 4.54E?03 BTBD10 1.57 5.11E?06 8.61E?05 SKAP2 1.46 1.67E?04 7.65E?04 CPTP 1.48 1.85E?03 4.56E?03 RAPH1 3.40 5.15E?06 8.65E?05 AGPAT2 1.35 1.67E?04 7.67E?04 TMEM184B 1.15 1.86E?03 4.59E?03 PLD5 18.93 5.18E?06 8.67E?05 SMG7 1.26 1.68E?04 7.71E?04 PLEKHA3 1.27 1.88E?03 4.63E?03 ITGB1 1.33 5.24E?06 8.68E?05 MFSD1 1.30 1.69E?04 7.71E?04 PLBD2 1.26 1.89E?03 4.64E?03 LRP10 1.56 5.24E?06 8.68E?05 TPT1 1.14 1.69E?04 7.73E?04 CITED4 1.43 1.89E?03 4.65E?03 DBNDD1 2.02 5.30E?06 8.71E?05 RNF14 1.13 1.70E?04 7.74E?04 EXOC2 1.17 1.90E?03 4.67E?03 PLOD3 1.24 5.40E?06 8.78E?05 ADD2 1.59 1.70E?04 7.75E?04 ACBD5 1.28 1.91E?03 4.69E?03 RASA3 1.66 5.39E?06 8.78E?05 NUCB1 1.16 1.70E?04 7.75E?04 P4HB 1.05 1.92E?03 4.71E?03 CORO1C 1.88 5.48E?06 8.84E?05 RNASET2 1.45 1.71E?04 7.77E?04 TRIM24 1.17 1.94E?03 4.73E?03 MXRA7 1.93 5.52E?06 8.88E?05 SGPL1 1.36 1.71E?04 7.77E?04 PTPN12 1.12 1.98E?03 4.81E?03 ADAMTS1 2.65 5.56E?06 8.93E?05 SLC11A2 1.33 1.71E?04 7.77E?04 CDK16 1.11 1.98E?03 4.82E?03 SASH1 1.79 5.67E?06 9.09E?05 PLEKHM1 1.33 1.71E?04 7.78E?04 ASNS 1.26 1.98E?03 4.82E?03 MANBA 2.24 5.70E?06 9.11E?05 FYCO1 1.47 1.72E?04 7.79E?04 CC2D1B 1.15 1.99E?03 4.83E?03 DLGAP4 1.83 5.76E?06 9.19E?05 AIDA 1.55 1.72E?04 7.79E?04 CRIPT 1.29 1.99E?03 4.85E?03 TJP1 1.76 5.83E?06 9.25E?05 GPAT3 1.26 1.72E?04 7.79E?04 HEBP2 1.49 2.01E?03 4.88E?03 CAMK1 6.99 5.93E?06 9.35E?05 TMEM120A 1.30 1.74E?04 7.85E?04 SLC22A4 1.58 2.02E?03 4.90E?03 UBE2R2 1.36 5.99E?06 9.38E?05 NPR2 1.26 1.75E?04 7.88E?04 TBC1D19 1.65 2.05E?03 4.95E?03 RPS6KA2 3.55 6.02E?06 9.41E?05 ARG2 2.24 1.75E?04 7.89E?04 SNAPC2 1.38 2.06E?03 4.97E?03 DSTYK 1.45 6.20E?06 9.53E?05 CASC10 1.83 1.75E?04 7.89E?04 HPS6 1.24 2.06E?03 4.98E?03 LYPD3 12.82 6.18E?06 9.53E?05 OS9 1.28 1.76E?04 7.89E?04 MAEA 1.15 2.08E?03 5.00E?03 HSPG2 2.20 6.23E?06 9.56E?05 SND1 1.18 1.76E?04 7.92E?04 MXD4 1.39 2.08E?03 5.01E?03 DCBLD2 1.50 6.33E?06 9.68E?05 SMARCAL1 1.13 1.78E?04 7.96E?04 ADCK2 1.20 2.08E?03 5.01E?03 SPRY2 1.61 6.35E?06 9.68E?05 MAN2B2 1.70 1.79E?04 7.99E?04 MAFF 1.42 2.09E?03 5.02E?03 ZEB1 1.48 6.35E?06 9.68E?05 MTMR1 1.56 1.81E?04 8.06E?04 COG3 1.31 2.09E?03 5.03E?03 SATB1 2.61 6.37E?06 9.68E?05 RGS20 2.62 1.81E?04 8.06E?04 TFRC 1.12 2.11E?03 5.07E?03 GK 7.46 6.51E?06 9.85E?05 MMP16 1.27 1.82E?04 8.08E?04 MARK2 1.09 2.11E?03 5.08E?03 RAB11FIP5 1.97 6.52E?06 9.85E?05 CREM 2.19 1.82E?04 8.11E?04 PIP4K2C 1.24 2.12E?03 5.09E?03 SH3PXD2B 1.83 6.58E?06 9.89E?05 ADAMTS15 2.02 1.85E?04 8.20E?04 TLCD1 1.39 2.12E?03 5.09E?03 PLAT 3.65 6.65E?06 9.96E?05 BMP2K 2.08 1.85E?04 8.21E?04 CYSTM1 1.58 2.12E?03 5.10E?03 TRAM2 1.57 6.71E?06 1.00E?04 KIFAP3 1.46 1.86E?04 8.24E?04 SLC39A8 1.54 2.12E?03 5.10E?03 ADAMTSL1 6.17 7.10E?06 1.05E?04 NR1H2 1.20 1.87E?04 8.26E?04 RTCB 1.10 2.15E?03 5.16E?03 PARVB 1.46 7.30E?06 1.07E?04 MGAT4B 1.26 1.87E?04 8.26E?04 LOC107985004 1.45 2.16E?03 5.16E?03 IL13RA1 1.90 7.37E?06 1.08E?04 GNB5 1.14 1.89E?04 8.32E?04 PEA15 1.05 2.16E?03 5.16E?03 PRR9 587.37 7.42E?06 1.08E?04 SERINC1 1.33 1.89E?04 8.33E?04 PMAIP1 1.24 2.16E?03 5.16E?03 IL4R 2.76 7.46E?06 1.08E?04 LINC00869 1.99 1.90E?04 8.35E?04 SPCS3 1.19 2.16E?03 5.16E?03 NFKBIZ 2.08 7.46E?06 1.08E?04 RAET1L 7.06 1.91E?04 8.38E?04 VIMP 1.33 2.16E?03 5.17E?03 ABRACL 1.73 7.53E?06 1.09E?04 ELMOD1 4.19 1.93E?04 8.44E?04 HTR7 1.29 2.17E?03 5.18E?03 SYNC 4.98 7.54E?06 1.09E?04 BRSK1 1.21 1.94E?04 8.46E?04 PODXL2 1.62 2.17E?03 5.19E?03 TXN 1.16 7.70E?06 1.10E?04 CHPF2 1.40 1.94E?04 8.48E?04 NOMO3 1.30 2.18E?03 5.21E?03 FOXC1 2.77 7.79E?06 1.11E?04 TTC17 1.37 1.95E?04 8.49E?04 PDE4DIP 1.35 2.19E?03 5.21E?03 NFKB1 1.71 7.82E?06 1.11E?04 SH3BGRL3 1.34 1.95E?04 8.49E?04 PPM1A 1.16 2.20E?03 5.23E?03 FAM3C 1.29 7.95E?06 1.13E?04 NXPH4 2.53 1.95E?04 8.50E?04 SLMAP 1.22 2.25E?03 5.33E?03 GJB1 1.52 7.95E?06 1.13E?04 ATG12 1.36 1.96E?04 8.52E?04 RC3H2 1.17 2.25E?03 5.33E?03 TMEM154 3.26 7.93E?06 1.13E?04 HIPK3 1.43 1.96E?04 8.52E?04 ATP6V1F 1.15 2.25E?03 5.34E?03 APC 2.11 8.04E?06 1.13E?04 CRYL1 2.49 1.97E?04 8.55E?04 ERLEC1 1.17 2.27E?03 5.37E?03 SEZ6L2 1.60 8.02E?06 1.13E?04 SLC39A13 1.56 1.97E?04 8.56E?04 P3H4 1.13 2.27E?03 5.37E?03 PLP2 1.38 8.13E?06 1.14E?04 TVP23B 1.20 1.98E?04 8.56E?04 PFKP 1.11 2.28E?03 5.38E?03 LINC01570 66.53 8.15E?06 1.14E?04 UGGT2 1.29 1.98E?04 8.56E?04 LOC100129434 1.12 2.28E?03 5.38E?03 LOC107984449 2.21 8.17E?06 1.14E?04 IERS 1.43 1.99E?04 8.60E?04 B4GALT7 1.24 2.28E?03 5.40E?03 PGK1 1.30 8.21E?06 1.14E?04 AGA 1.37 2.00E?04 8.61E?04 HPRT1 1.32 2.29E?03 5.41E?03 ARPCIA 1.27 8.29E?06 1.15E?04 CMTM3 1.42 1.99E?04 8.61E?04 HSDL1 1.14 2.30E?03 5.42E?03 GNG2 2.57 8.30E?06 1.15E?04 TNFRSF12A 1.36 1.99E?04 8.61E?04 MAP3K11 1.18 2.30E?03 5.42E?03 MAP4 1.17 8.31E?06 1.15E?04 9-Mar 1.54 2.01E?04 8.65E?04 SPATA20 1.38 2.30E?03 5.43E?03 EDEM1 1.56 8.33E?06 1.15E?04 WDR47 1.44 2.02E?04 8.67E?04 COPE 1.11 2.31E?03 5.44E?03 NFIB 1.93 8.44E?06 1.16E?04 LOC101928143 3.10 2.03E?04 8.74E?04 SPRYD3 1.46 2.32E?03 5.46E?03 SLC14A1 4.53 8.60E?06 1.17E?04 NOL3 1.38 2.06E?04 8.82E?04 PLCB3 1.51 2.32E?03 5.47E?03 CAPN2 1.30 8.71E?06 1.18E?04 ATP6AP2 1.24 2.08E?04 8.89E?04 HMGCL 1.33 2.34E?03 5.49E?03 SERPINE1 7.62 8.68E?06 1.18E?04 CHST7 1.58 2.11E?04 8.97E?04 TNIP2 1.20 2.34E?03 5.49E?03 C15orf48 11.76 8.77E?06 1.18E?04 GUCD1 1.35 2.13E?04 9.00E?04 SOCS2 1.78 2.37E?03 5.56E?03 ODC1 2.44 8.92E?06 1.20E?04 ARHGEF1 1.19 2.13E?04 9.01E?04 LINC00506 1.12 2.39E?03 5.60E?03 AHNAK2 4.25 8.96E?06 1.20E?04 TMEM9B 1.21 2.14E?04 9.04E?04 TBCEL 1.15 2.40E?03 5.60E?03 SEMA3A 2.40 9.00E?06 1.20E?04 ARHGAP22 3.29 2.15E?04 9.04E?04 CD109 1.10 2.40E?03 5.61E?03 KDM5B 1.21 9.03E?06 1.20E?04 MTRNR2L2 1.32 2.15E?04 9.05E?04 TESK1 1.27 2.40E?03 5.61E?03 TMX3 1.41 9.23E?06 1.22E?04 DNAJB2 1.40 2.19E?04 9.19E?04 ACOT8 1.11 2.41E?03 5.64E?03 ALPK1 2.94 9.51E?06 1.25E?04 DESI2 1.16 2.20E?04 9.21E?04 TRIM3 1.35 2.41E?03 5.64E?03 PIK3CD 1.89 9.67E?06 1.27E?04 WDTC1 1.26 2.21E?04 9.26E?04 G6PC3 1.11 2.44E?03 5.68E?03 CTSL 1.94 9.73E?06 1.27E?04 PPP1CB 1.26 2.25E?04 9.35E?04 PIP4K2B 1.13 2.44E?03 5.68E?03 CORO2B 1.62 9.79E?06 1.27E?04 SAR1B 1.29 2.25E?04 9.36E?04 YIF1A 1.17 2.44E?03 5.69E?03 MAP1LC3B 1.53 9.79E?06 1.27E?04 CPE 1.12 2.25E?04 9.37E?04 NAT6 1.56 2.45E?03 5.71E?03 MLLT4 2.10 9.90E?06 1.28E?04 SPTBN1 1.16 2.29E?04 9.47E?04 TNKS 1.15 2.46E?03 5.74E?03 TMEM132A 1.99 9.98E?06 1.29E?04 MAML2 1.51 2.29E?04 9.48E?04 PRUNE 1.10 2.47E?03 5.75E?03 IRF2BP2 1.70 1.01E?05 1.30E?04 LRAT 2.39 2.30E?04 9.49E?04 ARSA 1.83 2.53E?03 5.85E?03 ITGB8 2.01 1.01E?05 1.30E?04 CTTN 1.22 2.30E?04 9.50E?04 MDFIC 1.52 2.53E?03 5.87E?03 B3GNT5 4.34 1.02E?05 1.30E?04 SNHG6 1.15 2.33E?04 9.61E?04 SPRED2 1.18 2.54E?03 5.88E?03 FLNA 1.34 1.02E?05 1.30E?04 KHNYN 1.46 2.34E?04 9.62E?04 LOC100507460 1.16 2.55E?03 5.89E?03 PANX1 1.96 1.02E?05 1.30E?04 MOB3C 1.50 2.34E?04 9.63E?04 EVIS 1.41 2.56E?03 5.90E?03 ARHGAP21 1.59 1.03E?05 1.30E?04 TRPT1 1.51 2.35E?04 9.67E?04 TMEM62 1.31 2.58E?03 5.94E?03 RGS2 4.86 1.03E?05 1.30E?04 KLHDC2 1.21 2.36E?04 9.71E?04 MTRNR2L8 1.25 2.58E?03 5.94E?03 SDC2 2.08 1.03E?05 1.30E?04 ESRG 1.82 2.38E?04 9.77E?04 ATP6V1H 1.12 2.58E?03 5.95E?03 UBE2Q2 1.51 1.03E?05 1.30E?04 CLU 1.47 2.38E?04 9.78E?04 HOMER1 1.10 2.60E?03 5.98E?03 EFNB2 1.53 1.05E?05 1.31E?04 PGM3 1.92 2.42E?04 9.90E?04 C12orf49 1.12 2.62E?03 6.02E?03 WDR45 1.35 1.05E?05 1.31E?04 GAS5 1.33 2.46E?04 1.00E?03 TMEM255B 2.40 2.63E?03 6.04E?03 C2CD2L 1.37 1.05E?05 1.31E?04 ZER1 1.21 2.46E?04 1.00E?03 FAM58A 1.09 2.64E?03 6.06E?03 TOR1AIP1 1.18 1.05E?05 1.31E?04 RPLPO 1.11 2.50E?04 1.02E?03 CAPRIN2 1.86 2.64E?03 6.06E?03 CPEB4 1.69 1.07E?05 1.33E?04 LOC729348 1.19 2.51E?04 1.02E?03 CTSF 1.20 2.64E?03 6.06E?03 SRSF8 1.51 1.09E?05 1.35E?04 TPP1 1.21 2.51E?04 1.02E?03 BCR 1.15 2.65E?03 6.07E?03 PPARD 3.38 1.09E?05 1.35E?04 KLHL2 1.32 2.51E?04 1.02E?03 ZADH2 1.27 2.67E?03 6.10E?03 FMNL3 1.51 1.11E?05 1.36E?04 UBALD2 1.59 2.52E?04 1.02E?03 TMEM219 1.35 2.67E?03 6.11E?03 KCNK1 8.77 1.11E?05 1.36E?04 TNFRSF1A 1.20 2.53E?04 1.02E?03 UBR1 1.22 2.68E?03 6.13E?03 PLXNA3 2.20 1.11E?05 1.36E?04 FAT1 1.18 2.55E?04 1.03E?03 PTK2 1.14 2.70E?03 6.16E?03 TUFT1 1.34 1.11E?05 1.36E?04 TMC7 3.12 2.58E?04 1.04E?03 FAM127B 1.12 2.71E?03 6.19E?03 B3GAT1 4.19 1.12E?05 1.37E?04 UPRT 1.45 2.58E?04 1.04E?03 RPS19 1.09 2.72E?03 6.20E?03 NCS1 1.76 1.13E?05 1.37E?04 LAP3 1.49 2.59E?04 1.04E?03 ATP6V1D 1.22 2.75E?03 6.26E?03 STAT6 1.36 1.13E?05 1.38E?04 KLC2 1.27 2.60E?04 1.04E?03 ABCC10 1.31 2.76E?03 6.28E?03 LARP6 1.52 1.14E?05 1.38E?04 MANEAL 1.45 2.61E?04 1.05E?03 ERAP1 1.18 2.77E?03 6.29E?03 RPS12 1.22 1.15E?05 1.40E?04 LOC105369340 2.98 2.61E?04 1.05E?03 FAH 1.19 2.78E?03 6.31E?03 SERPINB8 1.62 1.15E?05 1.40E?04 MLLT3 1.87 2.62E?04 1.05E?03 KBTBD2 1.18 2.78E?03 6.31E?03 RELB 2.39 1.16E?05 1.40E?04 INPP5A 1.55 2.65E?04 1.06E?03 ID3 1.16 2.79E?03 6.33E?03 TRIM8 1.59 1.16E?05 1.40E?04 VAMP3 1.30 2.65E?04 1.06E?03 UTRN 1.23 2.80E?03 6.34E?03 MINPP1 1.33 1.18E?05 1.42E?04 MICALL1 1.14 2.67E?04 1.06E?03 CAPN10 1.30 2.82E?03 6.39E?03 PTDSS1 1.24 1.19E?05 1.42E?04 RIN2 2.01 2.68E?04 1.07E?03 TMEM59 1.19 2.83E?03 6.39E?03 RIPK2 1.89 1.19E?05 1.42E?04 FAM102A 1.35 2.69E?04 1.07E?03 TUBB4A 1.32 2.83E?03 6.39E?03 TNFRSF10B 1.43 1.20E?05 1.43E?04 NRBP1 1.20 2.69E?04 1.07E?03 URGCP 1.08 2.83E?03 6.39E?03 ZKSCAN1 1.29 1.21E?05 1.43E?04 PIGM 1.30 2.69E?04 1.07E?03 METTL23 1.16 2.83E?03 6.39E?03 DENNDIA 1.46 1.25E?05 1.47E?04 HIST3H2A 1.93 2.69E?04 1.07E?03 ACOX2 1.29 2.84E?03 6.42E?03 MACF1 1.28 1.27E?05 1.48E?04 STIM2 1.40 2.69E?04 1.07E?03 RAB40B 1.84 2.85E?03 6.43E?03 RPSAP52 6.43 1.27E?05 1.48E?04 CLCF1 1.54 2.70E?04 1.07E?03 TPD52L2 1.18 2.86E?03 6.46E?03 LTBP4 1.88 1.28E?05 1.48E?04 LOC105372580 1.87 2.70E?04 1.07E?03 DOK4 1.40 2.87E?03 6.49E?03 SPRR2D 4.23 1.29E?05 1.49E?04 2-Mar 1.25 2.70E?04 1.07E?03 LOC105370333 1.06 2.94E?03 6.59E?03 NET1 1.93 1.30E?05 1.49E?04 CLDN12 1.33 2.71E?04 1.07E?03 RAB29 1.12 2.94E?03 6.61E?03 PLSCR3 1.62 1.30E?05 1.49E?04 MSANTD3 1.60 2.72E?04 1.07E?03 GALNS 1.34 2.96E?03 6.65E?03 SCYL2 1.24 1.31E?05 1.49E?04 ETV3 1.40 2.72E?04 1.07E?03 DEAF1 1.25 2.97E?03 6.65E?03 CES2 1.27 1.31E?05 1.50E?04 RAP1GAP2 1.58 2.73E?04 1.07E?03 YWHAG 1.09 2.98E?03 6.67E?03 KDM1B 1.60 1.32E?05 1.50E?04 FUT8 1.47 2.74E?04 1.08E?03 SELK 1.32 2.98E?03 6.67E?03 HDAC9 2.39 1.33E?05 1.51E?04 MCOLN1 1.29 2.74E?04 1.08E?03 JADE1 1.19 2.99E?03 6.67E?03 RP2 2.05 1.34E?05 1.52E?04 TLE1 1.37 2.74E?04 1.08E?03 ARPC2 1.11 3.00E?03 6.69E?03 CALB1 14.55 1.38E?05 1.55E?04 EXOC7 1.24 2.74E?04 1.08E?03 RAP1B 1.17 3.00E?03 6.69E?03 BIVM 1.51 1.41E?05 1.57E?04 RNA45S5 1.39 2.74E?04 1.08E?03 VANGL1 1.11 3.01E?03 6.72E?03 CARMIL2 3.32 1.42E?05 1.57E?04 CCDC93 1.21 2.75E?04 1.08E?03 FAM213A 1.35 3.02E?03 6.74E?03 RABAC1 1.90 1.44E?05 1.57E?04 NKILA 2.27 2.76E?04 1.08E?03 ARNT 1.25 3.03E?03 6.76E?03 CERS2 1.32 1.45E?05 1.58E?04 TXNIP 1.69 2.77E?04 1.09E?03 HRAS 1.07 3.07E?03 6.84E?03 MYO9B 1.21 1.46E?05 1.58E?04 GLTP 1.34 2.78E?04 1.09E?03 NT5DC3 1.36 3.13E?03 6.96E?03 STX1A 1.92 1.46E?05 1.58E?04 DLX1 1.36 2.79E?04 1.09E?03 TM7SF3 1.11 3.16E?03 7.00E?03 PRKCA 1.75 1.47E?05 1.59E?04 FADD 1.25 2.80E?04 1.10E?03 TP53I13 1.49 3.17E?03 7.01E?03 APAF1 1.71 1.49E?05 1.60E?04 SBF1 1.24 2.85E?04 1.11E?03 IRF1 1.32 3.17E?03 7.03E?03 ZCCHC9 1.73 1.50E?05 1.61E?04 SMAGP 1.32 2.87E?04 1.12E?03 NAGLU 1.23 3.18E?03 7.03E?03 MYH16 4.80 1.51E?05 1.61E?04 UBA6 1.92 2.88E?04 1.12E?03 MOV10 1.19 3.18E?03 7.05E?03 DIEXF 1.89 1.52E?05 1.62E?04 GAGE12H 4.22 2.89E?04 1.12E?03 MFSD2A 1.21 3.20E?03 7.08E?03 NRIP3 3.24 1.53E?05 1.63E?04 PITRM1 1.20 2.90E?04 1.12E?03 CASC4 1.07 3.20E?03 7.08E?03 TAF9B 1.81 1.53E?05 1.63E?04 LOC105376382 2.64 2.90E?04 1.13E?03 LOC100507002 2.46 3.21E?03 7.10E?03 SNX9 1.83 1.54E?05 1.63E?04 DEFB103A 14.24 2.90E?04 1.13E?03 RGS16 1.31 3.22E?03 7.11E?03 FIBP 1.14 1.54E?05 1.64E?04 GRIK2 1.33 2.90E?04 1.13E?03 SNAP23 1.15 3.24E?03 7.14E?03 CLSTN1 1.58 1.55E?05 1.64E?04 HIPK1 1.24 2.91E?04 1.13E?03 HTATIP2 1.18 3.24E?03 7.14E?03 INPPL1 1.15 1.55E?05 1.64E?04 CACYBP 1.18 2.91E?04 1.13E?03 MIA3 1.15 3.26E?03 7.17E?03 CD68 2.20 1.57E?05 1.65E?04 CMTM4 1.60 2.93E?04 1.13E?03 ULK3 1.24 3.26E?03 7.17E?03 NIT1 1.83 1.58E?05 1.66E?04 KDSR 1.27 2.93E?04 1.13E?03 STARD3 1.13 3.26E?03 7.18E?03 SERINC3 1.54 1.58E?05 1.66E?04 NFE2L3 1.32 2.94E?04 1.14E?03 CD276 1.11 3.26E?03 7.18E?03 CERK 1.34 1.60E?05 1.67E?04 GBA 1.26 2.97E?04 1.14E?03 KLHL42 1.27 3.27E?03 7.18E?03 DGKQ 1.64 1.60E?05 1.67E?04 TMED9 1.12 2.98E?04 1.15E?03 WASL 1.20 3.27E?03 7.18E?03 ELOVL1 1.39 1.60E?05 1.67E?04 OSGIN2 1.30 3.00E?04 1.15E?03 CTNNA1 1.09 3.30E?03 7.24E?03 EXT2 1.39 1.60E?05 1.67E?04 SUMF1 1.32 2.99E?04 1.15E?03 PHRF1 1.11 3.30E?03 7.25E?03 FAM214B 1.93 1.59E?05 1.67E?04 TCP11L1 1.27 3.00E?04 1.15E?03 FBXO31 1.09 3.31E?03 7.27E?03 ZSWIM4 1.69 1.60E?05 1.67E?04 GUK1 1.28 3.02E?04 1.16E?03 C9orf16 1.21 3.33E?03 7.29E?03 UAP1 1.69 1.61E?05 1.67E?04 PDZD11 1.29 3.07E?04 1.17E?03 CSGALNACT2 1.33 3.34E?03 7.31E?03 ARL8A 1.90 1.62E?05 1.67E?04 GPAA1 1.14 3.09E?04 1.18E?03 RHOG 1.25 3.36E?03 7.35E?03 RRBP1 1.20 1.63E?05 1.68E?04 SLC30A9 1.20 3.11E?04 1.18E?03 TRIM4 1.31 3.36E?03 7.35E?03 ID2 2.58 1.63E?05 1.68E?04 SMYD2 1.57 3.11E?04 1.18E?03 POLG 1.24 3.37E?03 7.36E?03 ACAA1 1.76 1.64E?05 1.68E?04 PTPN23 1.11 3.13E?04 1.19E?03 CDK5RAP2 1.12 3.40E?03 7.41E?03 PARP8 1.78 1.64E?05 1.68E?04 LINC00704 2.81 3.15E?04 1.19E?03 JAK1 1.06 3.40E?03 7.41E?03 F2RL2 2.18 1.65E?05 1.68E?04 YPEL3 1.50 3.16E?04 1.20E?03 MSRA 1.29 3.40E?03 7.42E?03 FOXD1 1.56 1.66E?05 1.68E?04 HECTD3 1.22 3.18E?04 1.20E?03 ARHGDIA 1.07 3.42E?03 7.43E?03 FGFRL1 1.37 1.68E?05 1.70E?04 CDC42SE2 1.34 3.20E?04 1.21E?03 PPIB 1.05 3.43E?03 7.45E?03 ZDHHC24 1.50 1.70E?05 1.71E?04 KIF21A 1.48 3.21E?04 1.21E?03 RERE 1.08 3.43E?03 7.45E?03 CCNA1 3.55 1.71E?05 1.72E?04 PPP1R21 1.74 3.21E?04 1.21E?03 TMEM50A 1.24 3.46E?03 7.50E?03 COL9A2 1.94 1.72E?05 1.72E?04 NAPG 1.18 3.26E?04 1.23E?03 TOLLIP 1.22 3.46E?03 7.50E?03 FOXF1 3.18 1.72E?05 1.72E?04 SLC48A1 1.31 3.30E?04 1.24E?03 DBNL 1.14 3.47E?03 7.53E?03 NOTCH2 1.24 1.72E?05 1.72E?04 ZSWIM6 1.27 3.30E?04 1.24E?03 PLPP6 1.33 3.48E?03 7.54E?03 PABPC1 1.07 1.72E?05 1.72E?04 PJA1 1.80 3.31E?04 1.24E?03 MIA 1.16 3.49E?03 7.57E?03 CXCL3 10.57 1.74E?05 1.73E?04 USP12 1.34 3.34E?04 1.25E?03 IKBIP 1.16 3.49E?03 7.57E?03 HIST2H2BE 2.90 1.74E?05 1.73E?04 ARSD 1.59 3.37E?04 1.26E?03 PART1 1.58 3.50E?03 7.58E?03 ALKBH8 1.51 1.75E?05 1.74E?04 AQP3 2.19 3.38E?04 1.26E?03 CD63 1.06 3.53E?03 7.63E?03 GAS2L1 1.98 1.75E?05 1.74E?04 GRAMD1A 1.35 3.38E?04 1.26E?03 ZBTB7A 1.22 3.54E?03 7.63E?03 SWAP70 1.46 1.75E?05 1.74E?04 MLLT11 1.29 3.41E?04 1.27E?03 TGIF1 1.26 3.54E?03 7.64E?03 ELL2 2.99 1.78E?05 1.75E?04 ITGAV 1.29 3.44E?04 1.28E?03 KIDINS220 1.14 3.57E?03 7.68E?03 SOX4 2.17 1.80E?05 1.76E?04 PTBP3 1.24 3.45E?04 1.28E?03 TIMM10B 1.15 3.58E?03 7.70E?03 ECM1 1.82 1.81E?05 1.77E?04 PACS1 1.24 3.45E?04 1.28E?03 BCORL1 1.43 3.61E?03 7.75E?03 GDI1 1.67 1.81E?05 1.77E?04 UPP1 1.51 3.47E?04 1.29E?03 HERC4 1.22 3.61E?03 7.75E?03 AGAP2-AS1 1.68 1.81E?05 1.77E?04 EIF2S3 1.11 3.51E?04 1.30E?03 AKIRIN2 1.17 3.61E?03 7.75E?03 SLC22A18 1.38 1.82E?05 1.77E?04 KIAA0754 1.25 3.52E?04 1.30E?03 GLB1 1.11 3.63E?03 7.78E?03 ATP2B4 1.45 1.83E?05 1.78E?04 DHRS7 1.98 3.56E?04 1.31E?03 IGF1R 1.09 3.63E?03 7.79E?03 RASA1 2.47 1.83E?05 1.78E?04 NFIL3 1.36 3.60E?04 1.33E?03 LOC283788 1.25 3.67E?03 7.86E?03 NUMB 1.44 1.84E?05 1.78E?04 PLGRKT 1.45 3.60E?04 1.33E?03 MFSD10 1.13 3.67E?03 7.86E?03 CLASP1 1.53 1.88E?05 1.80E?04 TPMT 1.42 3.62E?04 1.33E?03 PLD2 1.22 3.70E?03 7.91E?03 TMEM121 1.70 1.88E?05 1.80E?04 SLC35E1 1.16 3.64E?04 1.34E?03 ZSWIM8 1.12 3.71E?03 7.92E?03 ADGRG6 3.19 1.89E?05 1.81E?04 SIPA1L1 1.84 3.65E?04 1.34E?03 PDCD10 1.17 3.74E?03 7.98E?03 ANTXR2 2.69 1.92E?05 1.83E?04 EIF4EBP2 1.13 3.67E?04 1.35E?03 FAM177A1 1.44 3.74E?03 7.98E?03 MLC1 10.91 1.92E?05 1.83E?04 GPR107 1.23 3.72E?04 1.36E?03 STK4 1.16 3.77E?03 8.02E?03 NFKBIA 2.87 1.97E?05 1.87E?04 ENO2 1.42 3.72E?04 1.36E?03 STX7 1.32 3.79E?03 8.06E?03 BTC 9.15 1.99E?05 1.87E?04 CMTM6 1.14 3.72E?04 1.36E?03 FBXO17 1.21 3.84E?03 8.15E?03 ITPR3 1.54 1.99E?05 1.87E?04 SAMD9 1.80 3.72E?04 1.36E?03 EVI5L 1.25 3.85E?03 8.17E?03 CST3 1.69 2.00E?05 1.87E?04 GNG10 1.23 3.73E?04 1.36E?03 SERTAD1 1.46 3.87E?03 8.20E?03 CAPS 1.55 2.01E?05 1.88E?04 CAST 1.20 3.73E?04 1.36E?03 ERBIN 1.16 3.87E?03 8.21E?03 CD99 1.29 2.02E?05 1.89E?04 P4HA2 1.58 3.74E?04 1.36E?03 CHCHD2 1.09 3.89E?03 8.23E?03 EEF1A2 1.49 2.05E?05 1.91E?04 SEMA7A 1.17 3.77E?04 1.37E?03 ERP44 1.20 3.91E?03 8.28E?03 LAMC2 7.02 2.06E?05 1.91E?04 ATL3 1.40 3.81E?04 1.38E?03 PPIC 1.29 3.92E?03 8.29E?03 CFL1 1.15 2.08E?05 1.92E?04 IRF9 3.03 3.83E?04 1.39E?03 NUDCD3 1.11 3.93E?03 8.32E?03 IGSF9B 3.19 2.09E?05 1.93E?04 OPHN1 1.32 3.83E?04 1.39E?03 ATP6V0E1 1.19 3.94E?03 8.33E?03 EFNB1 2.33 2.10E?05 1.94E?04 ABTB1 1.86 3.87E?04 1.40E?03 AMACR 1.26 3.97E?03 8.38E?03 EVC 2.54 2.11E?05 1.94E?04 CYB5R3 1.15 3.87E?04 1.40E?03 ICA1 1.45 3.99E?03 8.41E?03 DVL1 1.68 2.12E?05 1.94E?04 LRP1 1.36 3.88E?04 1.40E?03 CDKN1B 1.14 3.99E?03 8.42E?03 EPB41L3 13.86 2.13E?05 1.95E?04 SEC14L2 1.46 3.88E?04 1.40E?03 ESRRA 1.16 4.00E?03 8.43E?03 GJB3 2.74 2.12E?05 1.95E?04 HOMER2 2.08 3.90E?04 1.40E?03 TMEM14A 1.44 4.01E?03 8.43E?03 AKR1C1 2.20 2.14E?05 1.95E?04 AP3S1 1.33 3.90E?04 1.40E?03 IGBP1 1.19 4.01E?03 8.43E?03 RPL3 1.14 2.16E?05 1.97E?04 BAG1 1.13 3.91E?04 1.41E?03 PCNX3 1.19 4.02E?03 8.45E?03 CAPG 1.34 2.18E?05 1.98E?04 SLC35G2 1.48 3.95E?04 1.42E?03 NRAS 1.04 4.03E?03 8.47E?03 STK17B 2.10 2.19E?05 1.99E?04 CYTB 1.29 3.98E?04 1.43E?03 INPP5K 1.17 4.04E?03 8.49E?03 FRMD4B 2.02 2.20E?05 2.00E?04 CYBRD1 1.33 3.99E?04 1.43E?03 KAT14 1.21 4.04E?03 8.49E?03 ARRDC1 1.68 2.22E?05 2.01E?04 DNAJC3 1.18 4.04E?04 1.45E?03 KDELR1 1.16 4.06E?03 8.52E?03 ACSL1 1.98 2.24E?05 2.02E?04 TMED4 1.21 4.06E?04 1.45E?03 MAPK8IP1 1.25 4.10E?03 8.59E?03 FZD8 1.65 2.24E?05 2.02E?04 TNK2 1.17 4.07E?04 1.45E?03 C1orf122 1.23 4.10E?03 8.59E?03 CHPF 1.61 2.25E?05 2.02E?04 DPY19L1 1.17 4.09E?04 1.46E?03 GHDC 1.22 4.10E?03 8.59E?03 IRGQ 1.66 2.26E?05 2.03E?04 FLJ20021 2.15 4.09E?04 1.46E?03 MORC3 1.22 4.11E?03 8.60E?03 TMEM117 2.91 2.27E?05 2.04E?04 SSR4 1.36 4.09E?04 1.46E?03 NIN 1.17 4.11E?03 8.60E?03 PRB1 12.87 2.29E?05 2.05E?04 MFGE8 1.56 4.10E?04 1.46E?03 TRAM1 1.08 4.14E?03 8.66E?03 TNFAIP3 2.11 2.30E?05 2.05E?04 SDSL 1.65 4.13E?04 1.47E?03 LRRC75A-AS1 1.12 4.15E?03 8.67E?03 DUSP10 1.66 2.31E?05 2.05E?04 ARF1 1.09 4.16E?04 1.48E?03 GNB4 1.28 4.15E?03 8.67E?03 CUX1 1.42 2.32E?05 2.06E?04 FOXC2 2.17 4.16E?04 1.48E?03 CREB3 1.24 4.16E?03 8.69E?03 OSBPL8 1.33 2.33E?05 2.06E?04 ECE1 1.12 4.19E?04 1.48E?03 EIF3F 1.08 4.16E?03 8.69E?03 KLF13 1.97 2.34E?05 2.07E?04 YPEL5 1.51 4.20E?04 1.49E?03 TBC1D8 1.16 4.16E?03 8.69E?03 LOC79160 3.78 2.34E?05 2.07E?04 TANGO2 1.51 4.23E?04 1.50E?03 LOC107984717 1.13 4.19E?03 8.72E?03 RPLP1 1.17 2.34E?05 2.07E?04 RASA2 1.72 4.28E?04 1.51E?03 TDRKH 1.24 4.21E?03 8.77E?03 EYA3 1.37 2.38E?05 2.09E?04 UNC13B 1.63 4.29E?04 1.51E?03 ZNF252P 1.19 4.22E?03 8.78E?03 VLDLR 2.35 2.37E?05 2.09E?04 PLIN3 1.20 4.30E?04 1.51E?03 ASAP2 1.09 4.24E?03 8.81E?03 IER2 1.38 2.38E?05 2.09E?04 LARP1 1.11 4.38E?04 1.54E?03 GYG1 1.12 4.25E?03 8.83E?03 RUNX1 1.84 2.40E?05 2.10E?04 RPL13A 1.09 4.42E?04 1.55E?03 TMCO4 1.26 4.25E?03 8.84E?03 EBLN3 1.28 2.41E?05 2.10E?04 LRP8 1.23 4.42E?04 1.55E?03 RNF146 1.23 4.26E?03 8.84E?03 TGFBR1 1.63 2.41E?05 2.10E?04 SPATA13 1.30 4.43E?04 1.55E?03 TPRG1L 1.38 4.27E?03 8.86E?03 BCAP31 1.32 2.42E?05 2.10E?04 TMC01 1.16 4.46E?04 1.56E?03 PRMT2 1.17 4.28E?03 8.88E?03 AJAP1 2.80 2.43E?05 2.11E?04 DOCK5 1.43 4.48E?04 1.57E?03 JRKL 1.27 4.29E?03 8.89E?03 STK17A 1.97 2.43E?05 2.11E?04 TAF13 1.28 4.49E?04 1.57E?03 AKT1 1.17 4.31E?03 8.92E?03 AHCYL2 1.89 2.45E?05 2.13E?04 PML 1.34 4.50E?04 1.57E?03 RNF4 1.13 4.32E?03 8.93E?03 IL1RL1 3.62 2.50E?05 2.15E?04 LRPAP1 1.14 4.51E?04 1.57E?03 IKBKB 1.18 4.35E?03 8.98E?03 JARID2 1.90 2.53E?05 2.17E?04 DNTTIP1 1.30 4.51E?04 1.57E?03 DCAF12 1.11 4.37E?03 9.02E?03 PCBP4 1.31 2.53E?05 2.17E?04 TRIM56 1.24 4.56E?04 1.59E?03 MTRNR2L1 1.21 4.38E?03 9.04E?03 SFT2D2 1.86 2.55E?05 2.18E?04 EEF1G 1.05 4.59E?04 1.59E?03 CDC42 1.10 4.39E?03 9.05E?03 F11R 1.95 2.58E?05 2.21E?04 SUCO 1.25 4.61E?04 1.60E?03 HIPK2 1.12 4.39E?03 9.05E?03 DSC2 5.72 2.64E?05 2.24E?04 TICAM1 1.58 4.63E?04 1.61E?03 ATP6V0C 1.15 4.40E?03 9.07E?03 USP36 1.27 2.64E?05 2.24E?04 C11orf24 1.12 4.65E?04 1.61E?03 AMPD2 1.13 4.41E?03 9.08E?03 SLC6A15 1.43 2.65E?05 2.24E?04 PIGT 1.14 4.66E?04 1.62E?03 INF2 1.18 4.42E?03 9.10E?03 PPP3CA 1.99 2.67E?05 2.26E?04 TUG1 1.20 4.69E?04 1.62E?03 CTTNBP2NL 1.33 4.43E?03 9.12E?03 RNPEPL1 2.58 2.68E?05 2.26E?04 LOC105371453 1.25 4.72E?04 1.63E?03 LCMT2 1.16 4.45E?03 9.14E?03 C12orf75 1.86 2.71E?05 2.28E?04 CLDN4 1.52 4.72E?04 1.63E?03 EXOC4 1.09 4.47E?03 9.18E?03 OSTM1 1.37 2.73E?05 2.29E?04 PSEN1 1.44 4.72E?04 1.63E?03 PRDX2 1.11 4.48E?03 9.19E?03 ABCA2 1.45 2.76E?05 2.30E?04 TGFB1I1 1.72 4.73E?04 1.63E?03 LOC101927374 1.30 4.50E?03 9.23E?03 ACTN4 1.19 2.85E?05 2.37E?04 ACTA2 1.59 4.77E?04 1.64E?03 CTBP1-AS2 1.11 4.51E?03 9.23E?03 HOMER3 1.66 2.88E?05 2.39E?04 EFCAB14 1.30 4.76E?04 1.64E?03 HIST2H4A 1.51 4.54E?03 9.28E?03 TGFB1 1.62 2.92E?05 2.41E?04 PCYOX1 1.07 4.78E?04 1.64E?03 HIST2H4B 1.51 4.54E?03 9.28E?03 MOAP1 1.30 2.94E?05 2.42E?04 PHLDB1 1.29 4.86E?04 1.67E?03 YIPF2 1.10 4.55E?03 9.30E?03 SLC24A3 1.58 2.94E?05 2.42E?04 TRHDE-AS1 1.53 4.87E?04 1.67E?03 EPM2AIP1 1.12 4.56E?03 9.32E?03 SP3 1.50 2.95E?05 2.42E?04 MEIS3 2.11 4.90E?04 1.68E?03 MED15 1.15 4.57E?03 9.32E?03 AP1S2 1.55 2.98E?05 2.43E?04 PTPN9 1.20 4.92E?04 1.68E?03 RPL28 1.07 4.57E?03 9.32E?03 TCN2 3.18 3.00E?05 2.45E?04 EMP1 1.25 4.92E?04 1.68E?03 SEMA3B 1.12 4.57E?03 9.32E?03 SLC9A3R2 1.65 3.01E?05 2.45E?04 PCOLCE2 2.27 4.95E?04 1.69E?03 RFWD2 1.22 4.59E?03 9.36E?03 SLC25A30 1.66 3.06E?05 2.48E?04 CRLF1 2.92 4.96E?04 1.69E?03 ZNF697 1.20 4.59E?03 9.36E?03 SHC4 1.92 3.08E?05 2.50E?04 SPHK1 1.55 4.96E?04 1.69E?03 FLYWCH1 1.15 4.60E?03 9.36E?03 SMPD1 2.09 3.11E?05 2.51E?04 NEK7 1.17 4.99E?04 1.70E?03 SEC23B 1.09 4.60E?03 9.37E?03 CEND1 1.95 3.11E?05 2.51E?04 PINK1 1.74 4.99E?04 1.70E?03 ACVR1 1.13 4.60E?03 9.37E?03 CDH6 12.48 3.12E?05 2.52E?04 LYPLA2 1.16 5.01E?04 1.70E?03 CMIP 1.20 4.61E?03 9.38E?03 EMP3 1.34 3.13E?05 2.52E?04 ATP6AP1 1.17 5.03E?04 1.71E?03 HELZ2 2.58 4.63E?03 9.42E?03 SPSB4 3.58 3.15E?05 2.53E?04 RPL39 1.09 5.03E?04 1.71E?03 PCSK7 1.15 4.65E?03 9.44E?03 APBB2 1.78 3.15E?05 2.53E?04 UGDH-AS1 1.20 5.04E?04 1.71E?03 MAST3 1.19 4.68E?03 9.49E?03 PSMD2 1.35 3.17E?05 2.54E?04 FLII 1.12 5.06E?04 1.71E?03 FANCE 1.32 4.70E?03 9.52E?03 CD151 1.31 3.19E?05 2.54E?04 FOXK1 1.31 5.08E?04 1.72E?03 MCFD2 1.10 4.72E?03 9.56E?03 PRDM2 1.65 3.20E?05 2.55E?04 CANT1 1.28 5.10E?04 1.72E?03 KDM5C 1.13 4.73E?03 9.58E?03 ROBO4 2.04 3.21E?05 2.55E?04 TCIRG1 1.45 5.12E?04 1.73E?03 RMND5B 1.27 4.74E?03 9.58E?03 STXBP1 1.44 3.24E?05 2.56E?04 CDS2 1.31 5.13E?04 1.73E?03 C4orf48 1.15 4.75E?03 9.59E?03 TMCO3 1.38 3.28E?05 2.58E?04 CTSA 1.23 5.16E?04 1.73E?03 MC1R 1.21 4.76E?03 9.61E?03 C3orf52 2.64 3.30E?05 2.60E?04 FBRS 1.10 5.16E?04 1.73E?03 AP5Z1 1.15 4.78E?03 9.65E?03 APLP2 1.56 3.38E?05 2.64E?04 CPPED1 1.30 5.18E?04 1.74E?03 COMMD6 1.21 4.79E?03 9.67E?03 TMED7 1.14 3.39E?05 2.64E?04 YRDC 1.14 5.23E?04 1.75E?03 HEXA 1.17 4.82E?03 9.72E?03 IL37 7.41 3.45E?05 2.67E?04 TMUB2 1.27 5.29E?04 1.77E?03 LOC652276 1.29 4.82E?03 9.72E?03 MIR4697HG 2.74 3.48E?05 2.68E?04 APMAP 1.22 5.36E?04 1.79E?03 PARP10 1.38 4.83E?03 9.73E?03 SEC24D 1.67 3.51E?05 2.69E?04 TP53BP2 1.17 5.39E?04 1.79E?03 ENOX2 1.24 4.84E?03 9.74E?03 CSNK1E 1.29 3.52E?05 2.70E?04 H3F3B 1.14 5.41E?04 1.80E?03 AGPAT3 1.17 4.85E?03 9.77E?03 TDRD7 2.15 3.53E?05 2.70E?04 RAB38 1.30 5.42E?04 1.80E?03 ELFN1-AS1 1.22 4.86E?03 9.77E?03 FRMD8 1.38 3.56E?05 2.71E?04 WASF3 1.30 5.43E?04 1.80E?03 FAM96B 1.07 4.86E?03 9.78E?03 ASB1 1.54 3.57E?05 2.71E?04 AGFG1 1.24 5.45E?04 1.81E?03 TRIM32 1.12 4.88E?03 9.82E?03 FAM83G 1.46 3.58E?05 2.72E?04 MPP6 1.20 5.45E?04 1.81E?03 STK25 1.04 4.89E?03 9.83E?03 LINC00707 1.96 3.61E?05 2.72E?04 NUP50-AS1 2.34 5.51E?04 1.82E?03 INO80C 1.41 4.91E?03 9.87E?03 SNX25 1.70 3.62E?05 2.73E?04 NCEH1 1.19 5.52E?04 1.83E?03 DRAM1 1.16 4.92E?03 9.87E?03 APPL2 1.52 3.64E?05 2.74E?04 STX16 1.09 5.53E?04 1.83E?03 GOLGA1 1.19 4.92E?03 9.88E?03 KCNMA1 5.17 3.65E?05 2.74E?04 SKIL 1.46 5.55E?04 1.83E?03 FKBP2 1.30 4.93E?03 9.89E?03 XYLT1 5.93 3.73E?05 2.79E?04 PURB 1.14 5.59E?04 1.84E?03 CCPG1 1.15 4.96E?03 9.94E?03 NR2F2 1.51 3.75E?05 2.80E?04 ITPKC 1.22 5.60E?04 1.84E?03 RAP1GDS1 1.15 4.97E?03 9.95E?03 CD274 Genes Isoform Fold Pval Padj ALKBH8 1.15 5.75E?06 5.57E?03 ANGPTL2 1.51 2.71E?05 8.81E?03 CD274 1773.14 7.55E?07 2.20E?03 CSGALNACT1 1.30 1.54E?05 8.24E?03 FDCSP 2.70 3.36E?05 9.83E?03 LRRC45 1.10 2.65E?06 5.29E?03 PMEPA1 1.55 6.05E?07 2.20E?03 PXYLP1 1.25 2.56E?05 8.81E?03 TMX4 1.26 1.89E?05 8.24E?03 B3GNT2 Genes Isoform Fold Pval Padj ADAM19 2.01 1.10E?06 2.15E?03 ATOX1 1.45 2.38E?06 2.15E?03 B3GNT2 215.39 5.62E?07 2.15E?03 DNAJC3 1.38 1.84E?06 2.15E?03 DUSP10 1.65 1.53E?06 2.15E?03 GPNMB 1.98 2.18E?06 2.15E?03 IL24 2.89 3.44E?06 2.15E?03 SQSTM1 2.25 8.26E?07 2.15E?03 ST3GAL4 1.26 3.06E?06 2.15E?03 TGFBI 1.50 2.50E?06 2.15E?03 TTC17 1.58 1.95E?06 2.15E?03 TXNRD1 1.41 3.29E?06 2.15E?03 CANX 1.28 6.07E?06 2.95E?03 P4HB 1.20 5.44E?06 2.95E?03 DUSP4 1.31 1.27E?05 3.54E?03 KANK1 1.33 1.04E?05 3.54E?03 NRP2 1.49 1.08E?05 3.54E?03 PMEPA1 1.28 9.37E?06 3.54E?03 CALR 1.23 1.44E?05 3.76E?03 FTH1 1.43 1.52E?05 3.76E?03 LRRC59 1.14 1.59E?05 3.76E?03 SCD 1.22 2.19E?05 4.45E?03 RHOQ 1.27 2.43E?05 4.72E?03 SLC37A2 1.45 2.58E?05 4.79E?03 ATP6V0B 1.25 3.11E?05 4.98E?03 ATP6V1E1 1.22 3.01E?05 4.98E?03 LIF 1.51 2.86E?05 4.98E?03 NGFR 1.37 3.27E?05 4.98E?03 TKT 1.13 3.30E?05 4.98E?03 ARHGEF4 1.90 4.00E?05 5.37E?03 FGFR1 1.31 3.77E?05 5.37E?03 PKM 1.06 3.75E?05 5.37E?03 FKBP1A 1.12 4.26E?05 5.65E?03 INSIG1 1.73 4.36E?05 5.68E?03 GSR 1.16 4.74E?05 6.00E?03 CXCL8 1.71 5.07E?05 6.15E?03 KYNU 1.52 5.01E?05 6.15E?03 CD63 1.19 5.56E?05 6.39E?03 GJB1 1.69 5.86E?05 6.41E?03 MAP1B 1.24 5.77E?05 6.41E?03 WNT9A 2.11 5.87E?05 6.41E?03 FERMT1 1.33 5.95E?05 6.42E?03 CITED1 3.93 6.17E?05 6.49E?03 RPN1 1.13 6.16E?05 6.49E?03 PLIN2 1.21 6.66E?05 6.69E?03 ATP6V0A4 2.46 7.56E?05 7.04E?03 MCF2L 1.39 8.47E?05 7.04E?03 PHLDA1 1.22 8.24E?05 7.04E?03 SEC61A1 1.17 8.44E?05 7.04E?03 SURF4 1.18 7.83E?05 7.04E?03 TFRC 1.28 7.86E?05 7.04E?03 UAP1L1 2.03 7.72E?05 7.04E?03 MGAT4B 1.42 9.24E?05 7.41E?03 NEFL 1.75 9.74E?05 7.47E?03 CAPN1 1.10 9.97E?05 7.51E?03 ALDOA 1.10 1.01E?04 7.52E?03 C3 1.59 1.05E?04 7.69E?03 ASAH1 1.41 1.07E?04 7.76E?03 SLC7A11 1.66 1.08E?04 7.81E?03 EPT1 1.12 1.19E?04 8.25E?03 OAF 1.14 1.18E?04 8.25E?03 TBC1D14 1.24 1.19E?04 8.25E?03 SND1 1.10 1.20E?04 8.27E?03 MLEC 1.17 1.25E?04 8.38E?03 CHST11 1.48 1.27E?04 8.41E?03 PDIA4 1.22 1.29E?04 8.46E?03 FTL 1.19 1.32E?04 8.51E?03 SAT2 1.21 1.34E?04 8.54E?03 EDEM1 1.38 1.36E?04 8.56E?03 FDCSP 2.17 1.37E?04 8.56E?03 MPI 1.12 1.37E?04 8.56E?03 ITPR3 1.35 1.41E?04 8.76E?03 APOBEC3G 1.80 1.44E?04 8.78E?03 ENO2 1.52 1.63E?04 8.93E?03 FBXO27 1.49 1.63E?04 8.93E?03 HSPA5 1.16 1.60E?04 8.93E?03 LMNA 1.08 1.54E?04 8.93E?03 MANF 1.23 1.56E?04 8.93E?03 MGST1 1.35 1.51E?04 8.93E?03 NOV 2.55 1.54E?04 8.93E?03 DPY19L1 1.17 1.67E?04 8.94E?03 MMP14 1.19 1.69E?04 8.96E?03 NEU1 1.22 1.72E?04 9.04E?03 CREB3L2 1.35 1.77E?04 9.16E?03 SLC7A5 1.17 1.78E?04 9.16E?03 PDIA6 1.20 1.88E?04 9.19E?03 TPP1 1.15 1.93E?04 9.35E?03 RGS16 1.57 2.08E?04 9.84E?03 USP12 1.13 2.07E?04 9.84E?03 G6PD 1.15 2.13E?04 9.96E?03 HS1BP3 1.57 2.14E?04 9.96E?03 MCL1 Genes Isoform Fold Pval Padj MCL1 8.65 5.89E?10 2.58E?06 TIMP1 1.72 2.96E?10 2.58E?06 HLA-B 1.54 1.73E?07 3.02E?04 HLA-C 1.40 2.19E?07 3.02E?04 RAMP1 1.60 2.34E?07 3.02E?04 CD74 1.25 4.14E?07 4.03E?04 GRN 1.27 4.99E?07 4.37E?04 LTBP4 1.15 2.27E?06 1.25E?03 SOD3 2.52 2.17E?06 1.25E?03 PMEPA1 1.33 3.68E?06 1.58E?03 IRS2 1.14 5.42E?06 1.91E?03 ITGB3 1.19 6.09E?06 1.91E?03 SDC2 1.55 5.77E?06 1.91E?03 S100A1 1.77 6.55E?06 1.98E?03 HAPLN1 1.69 9.96E?06 2.50E?03 S100A13 1.22 9.85E?06 2.50E?03 SCAND1 1.25 1.02E?05 2.50E?03 INHBA 1.60 1.07E?05 2.53E?03 DHCR24 1.17 1.17E?05 2.54E?03 GALNT2 1.19 1.15E?05 2.54E?03 EEF1A2 1.41 1.24E?05 2.58E?03 LGALS3BP 1.17 1.30E?05 2.65E?03 SPARC 1.15 1.44E?05 2.72E?03 CSPG4 1.29 1.68E?05 2.80E?03 HLA-A 1.30 1.61E?05 2.80E?03 ISG20 1.20 1.71E?05 2.80E?03 PDE3A 2.14 1.58E?05 2.80E?03 EPHA3 1.24 2.01E?05 3.04E?03 GPR153 1.49 2.68E?05 3.40E?03 PCSK1 1.81 2.51E?05 3.40E?03 SFRP1 1.22 2.59E?05 3.40E?03 TCN1 1.65 2.84E?05 3.46E?03 PYGB 1.20 2.99E?05 3.59E?03 TRPV4 1.34 3.43E?05 3.90E?03 VAT1L 1.42 3.53E?05 3.96E?03 ARNT2 1.41 3.62E?05 3.96E?03 MIA 1.27 3.60E?05 3.96E?03 EEF1G 1.07 3.74E?05 4.04E?03 ATG101 1.08 4.04E?05 4.11E?03 CUX1 1.12 3.94E?05 4.11E?03 RPL10A 1.06 4.03E?05 4.11E?03 TESC 1.63 3.90E?05 4.11E?03 VGF 1.73 3.98E?05 4.11E?03 SLC24A3 1.73 4.32E?05 4.25E?03 CEMIP 1.41 4.50E?05 4.27E?03 IGFBP3 1.58 4.54E?05 4.27E?03 AMACR 1.31 5.12E?05 4.41E?03 CST3 1.18 5.75E?05 4.41E?03 FAM210B 1.28 5.54E?05 4.41E?03 NR4A1 1.16 5.70E?05 4.41E?03 PAPSS2 1.56 5.51E?05 4.41E?03 PRAF2 1.07 5.61E?05 4.41E?03 TGFA 1.17 5.25E?05 4.41E?03 GNAS 1.28 5.90E?05 4.45E?03 CSGALNACT1 1.43 6.22E?05 4.62E?03 HLA-DRB1 1.27 6.21E?05 4.62E?03 PLD3 1.22 6.44E?05 4.64E?03 RPL10 1.03 6.35E?05 4.64E?03 SERPINA3 1.78 6.47E?05 4.64E?03 NES 1.12 6.76E?05 4.71E?03 PLOD3 1.18 6.84E?05 4.71E?03 SNHG6 1.04 6.74E?05 4.71E?03 TFPI2 1.34 6.94E?05 4.71E?03 CHPF 1.30 7.72E?05 5.11E?03 EYA1 1.45 7.88E?05 5.11E?03 SOX10 1.16 7.82E?05 5.11E?03 CXCL8 1.77 8.34E?05 5.29E?03 HTRA1 1.70 8.48E?05 5.35E?03 LAMA4 1.41 9.17E?05 5.50E?03 RIPK4 1.37 9.11E?05 5.50E?03 TSPAN13 1.26 9.39E?05 5.55E?03 ACSL3 1.16 9.77E?05 5.63E?03 ABCA2 1.28 1.02E?04 5.67E?03 PTPRU 1.47 1.02E?04 5.67E?03 UGGT2 1.08 1.02E?04 5.67E?03 COL9A3 1.16 1.04E?04 5.67E?03 ADGRL1 1.29 1.06E?04 5.70E?03 ATOX1 1.14 1.06E?04 5.70E?03 HLA-DQB1 1.33 1.06E?04 5.70E?03 COL6A2 1.28 1.09E?04 5.74E?03 PXYLP1 1.27 1.09E?04 5.74E?03 KIAA0040 1.24 1.11E?04 5.76E?03 SPRY4 1.30 1.12E?04 5.76E?03 ABHD17C 1.34 1.15E?04 5.87E?03 FABP6 1.52 1.21E?04 6.02E?03 NR4A2 1.29 1.23E?04 6.05E?03 LRPAP1 1.15 1.30E?04 6.24E?03 AREG 1.83 1.34E?04 6.35E?03 B3GNT7 1.43 1.35E?04 6.35E?03 ACY1 1.21 1.36E?04 6.36E?03 QSOX1 1.16 1.38E?04 6.41E?03 SEZ6L2 1.26 1.46E?04 6.70E?03 SLC25A23 1.27 1.47E?04 6.70E?03 HLA-DRA 1.19 1.51E?04 6.80E?03 RPLPO 1.06 1.52E?04 6.81E?03 RPS3 1.10 1.55E?04 6.83E?03 CTNNA1 1.08 1.62E?04 6.87E?03 PRKCSH 1.11 1.60E?04 6.87E?03 RPL3 1.09 1.61E?04 6.87E?03 BSG 1.10 1.79E?04 6.91E?03 EEF2 1.11 1.79E?04 6.91E?03 FCRLA 1.45 1.74E?04 6.91E?03 FKBP10 1.19 1.70E?04 6.91E?03 ID1 1.15 1.70E?04 6.91E?03 PLPP4 1.42 1.76E?04 6.91E?03 PSKH1 1.17 1.71E?04 6.91E?03 RPS5 1.09 1.79E?04 6.91E?03 SEPN1 1.14 1.64E?04 6.91E?03 SLC1A4 1.67 1.70E?04 6.91E?03 VAMP5 1.20 1.77E?04 6.91E?03 APRT 1.08 1.90E?04 6.99E?03 SLC26A2 1.09 1.87E?04 6.99E?03 TMEM2 1.21 1.83E?04 6.99E?03 DBNDD1 1.38 1.98E?04 7.18E?03 PSAP 1.25 1.99E?04 7.22E?03 HLA-DRB4 1.22 2.07E?04 7.24E?03 LTBP3 1.21 2.04E?04 7.24E?03 RPS14 1.11 2.15E?04 7.37E?03 ST6GAL1 1.42 2.24E?04 7.53E?03 GSK3B 1.25 2.26E?04 7.56E?03 SCARB1 1.11 2.26E?04 7.56E?03 MARCKSL1 1.24 2.35E?04 7.76E?03 ACTN1 1.11 2.38E?04 7.80E?03 MELTF 1.30 2.38E?04 7.80E?03 FAM234A 1.28 2.46E?04 7.81E?03 PITPNCA 1.35 2.43E?04 7.81E?03 SYTL5 1.25 2.43E?04 7.81E?03 TLR4 1.11 2.45E?04 7.81E?03 WIPI1 1.30 2.53E?04 7.88E?03 CYBA 1.20 2.55E?04 7.91E?03 RPLP1 1.08 2.59E?04 7.97E?03 HMCN1 1.44 2.66E?04 8.08E?03 P3H4 1.17 2.66E?04 8.08E?03 SCARA5 1.50 2.70E?04 8.11E?03 FDCPS 2.79 2.95E?04 8.57E?03 HLA-DPA1 1.16 2.97E?04 8.57E?03 SPTBN2 1.13 2.94E?04 8.57E?03 COL18A1 1.34 3.13E?04 8.86E?03 ICAM 1.37 3.13E?04 8.86E?03 MEGF8 1.20 3.17E?04 8.91E?03 SLC25A6 1.10 3.19E?04 8.91E?03 ABHD2 1.13 3.24E?04 8.99E?03 PNPLA2 1.18 3.31E?04 9.12E?03 LY6E 1.10 3.35E?04 9.19E?03 ANKH 1.45 3.48E?04 9.40E?03 IGSF8 1.32 3.48E?04 9.40E?03 PRDX2 1.14 3.48E?04 9.40E?03 CTHRC1 1.49 3.53E?04 9.44E?03 PTGFRN 1.14 3.54E?04 9.44E?03 TFAP2B 1.59 3.66E?04 9.68E?03 GAA 1.40 3.74E?04 9.79E?03 LOC102724122 1.46 3.84E?04 9.97E?03

    TABLE-US-00009 TABLE 6 ChIP-seq characterization of JUNB target genes. Only genes with JUNB ChIP-seq peaks that were significantly differentially expressed as measured by RNA-seq are listed. Isoform Fold Pval Padj GALNT9 12426667.67 1.78E?06 4.85E?05 KPRP 404795 2.06E?06 5.32E?05 PRR9 249944 7.42E?06 1.08E?04 PLD5 1363.40 5.18E?06 8.67E?05 PDPN 807.85 3.36E?08 1.05E?05 COL22A1 510.96 2.62E?08 9.89E?06 LOC101927120 441.36 9.24E?05 5.14E?04 PRRT4 350.61 2.66E?06 5.99E?05 LCE1D 272.05 2.88E?06 6.19E?05 SERPINB2 218.85 1.78E?07 1.83E?05 HMCN2 217.73 3.88E?06 7.29E?05 SCEL 191.82 2.71E?07 2.17E?05 CCL3 189.83 4.30E?07 2.46E?05 CXCL14 153.02 3.13E?07 2.21E?05 MMP10 146.03 3.22E?07 2.25E?05 HAS2 132.26 1.47E?08 8.56E?06 PI3 108.57 1.36E?07 1.69E?05 LRFN5 97.76 1.58E?09 3.61E?06 ACAN 79.24 1.70E?08 8.62E?06 CDH6 78.69 3.12E?05 2.52E?04 OPRL1 50.72 1.13E?06 3.98E?05 CD24 49.60 2.02E?09 3.69E?06 BCL2A1 44.67 2.56E?07 2.14E?05 FERMT1 39.66 2.46E?08 9.89E?06 JUNB 33.35 1.89E?08 8.62E?06 CTSS 32.74 3.65E?07 2.32E?05 BRINP2 31.46 4.41E?07 2.46E?05 BTBD11 31.21 1.29E?07 1.69E?05 CALB1 30.50 1.38E?05 1.55E?04 ESM1 26.97 6.42E?08 1.25E?05 PTGS2 26.54 4.90E?06 8.38E?05 TAC1 23.46 4.49E?06 7.98E?05 VCAN 21.32 5.96E?08 1.25E?05 CD93 21.10 1.62E?06 4.75E?05 C15orf48 19.95 8.77E?06 1.18E?04 MAST4 19.76 3.67E?08 1.08E?05 SLAMF9 19.53 6.00E?07 2.78E?05 MMP1 18.96 3.04E?07 2.21E?05 EPAS1 18.84 1.07E?06 3.88E?05 RAET1L 16.57 1.91E?04 8.38E?04 FLRT2 15.64 9.30E?08 1.41E?05 DNER 14.07 5.72E?05 3.70E?04 LYPD3 13.96 6.18E?06 9.53E?05 GALNT12 13.81 2.85E?06 6.19E?05 BIRC3 13.78 8.77E?07 3.39E?05 ALK 13.46 6.04E?08 1.25E?05 CXCL3 12.81 1.74E?05 1.73E?04 MMP9 12.62 1.06E?04 5.65E?04 GK 12.31 6.51E?06 9.85E?05 SERPINE1 12.25 8.68E?06 1.18E?04 IKZF2 11.42 4.50E?06 7.98E?05 DUSP1 11.09 6.96E?07 3.00E?05 WSCD1 10.99 6.76E?07 2.95E?05 PDZRN3 10.47 2.20E?07 2.06E?05 KRT6B 10.44 3.71E?09 4.23E?06 NCAM1 10.30 4.02E?07 2.40E?05 DSC2 10.29 2.64E?05 2.24E?04 KIAA0040 10.25 5.99E?08 1.25E?05 FAT3 9.68 1.46E?06 4.60E?05 RPSAP52 9.34 1.27E?05 1.48E?04 MDGA1 9.29 1.14E?04 5.87E?04 HS3ST3B1 9.21 9.66E?05 5.30E?04 WNT9A 9.08 1.40E?06 4.43E?05 TMCC2 8.48 2.33E?07 2.12E?05 FAM19A2 8.41 1.09E?06 3.92E?05 CXCL8 8.37 6.64E?07 2.93E?05 LOC105372663 8.33 8.83E?05 4.98E?04 KRTAP2-3 8.06 1.78E?06 4.85E?05 USP43 7.95 7.66E?07 3.12E?05 TGFBI 7.94 3.47E?09 4.23E?06 LAMB3 7.86 3.19E?08 1.05E?05 ITGA2 7.77 2.71E?07 2.17E?05 CLMP 7.69 3.15E?07 2.21E?05 MYH16 7.64 1.51E?05 1.61E?04 INHBA 7.57 6.79E?08 1.25E?05 LEMD1 7.52 1.37E?07 1.69E?05 ARNTL2 7.49 3.14E?08 1.05E?05 PARM1 7.46 3.46E?06 6.77E?05 IGFBP3 7.21 6.57E?08 1.25E?05 XYLT1 7.16 3.73E?05 2.79E?04 GAP43 7.05 6.04E?08 1.25E?05 A4GALT 6.74 6.97E?07 3.00E?05 SYNC 6.73 7.54E?06 1.09E?04 SETBP1 6.61 3.68E?07 2.32E?05 KCNC4 5.83 1.06E?04 5.64E?04 CHMP4C 5.62 2.01E?07 1.95E?05 AHNAK2 5.55 8.96E?06 1.20E?04 ARSB 5.50 2.52E?06 5.85E?05 COL6A3 5.41 1.53E?07 1.73E?05 ZNF536 5.32 2.46E?06 5.82E?05 KCNMA1 5.31 3.65E?05 2.74E?04 NRCAM 5.19 2.99E?07 2.21E?05 LRIG1 5.05 1.69E?06 4.78E?05 TLN2 5.05 1.63E?06 4.75E?05 SLC14A1 4.99 8.60E?06 1.17E?04 SH2D2A 4.99 7.61E?05 4.48E?04 RGS2 4.98 1.03E?05 1.30E?04 SQRDL 4.88 4.16E?05 2.99E?04 GEM 4.85 1.19E?06 4.10E?05 HMOX1 4.79 1.49E?06 4.62E?05 LIF 4.70 7.21E?07 3.07E?05 B3GAT1 4.67 1.12E?05 1.37E?04 PKIA 4.63 5.07E?07 2.56E?05 KLF7 4.60 9.90E?07 3.66E?05 C3orf67 4.58 3.39E?06 6.69E?05 TIMP1 4.53 6.45E?07 2.87E?05 SPSB4 4.49 3.15E?05 2.53E?04 IL1RL1 4.46 2.50E?05 2.15E?04 DSP 4.45 5.79E?07 2.71E?05 SPRR2D 4.34 1.29E?05 1.49E?04 MYO1D 4.28 2.93E?07 2.21E?05 IL24 4.26 1.59E?07 1.73E?05 ARHGAP22 4.25 2.15E?04 9.04E?04 NFASC 4.11 9.89E?07 3.66E?05 TMEM154 4.05 7.93E?06 1.13E?04 RNF19B 4.04 1.49E?06 4.62E?05 NRIP3 4.02 1.53E?05 1.63E?04 LINC00941 4.02 2.28E?06 5.53E?05 GPR158 3.89 4.20E?05 3.00E?04 BPGM 3.84 1.53E?06 4.67E?05 GRB10 3.83 1.66E?06 4.77E?05 TMC7 3.72 2.58E?04 1.04E?03 DIP2B 3.72 1.60E?06 4.74E?05 PLAT 3.68 6.65E?06 9.96E?05 CDYL2 3.68 1.24E?07 1.67E?05 RAPH1 3.64 5.15E?06 8.65E?05 IGSF9B 3.63 2.09E?05 1.93E?04 PPARD 3.61 1.09E?05 1.35E?04 PLEKHG5 3.60 2.66E?07 2.17E?05 LPXN 3.57 5.61E?07 2.68E?05 ARIDSA 3.52 3.14E?06 6.45E?05 CCDC80 3.51 2.69E?06 6.02E?05 LYPD1 3.47 4.97E?07 2.53E?05 CD55 3.47 1.66E?07 1.75E?05 MBOAT2 3.47 8.95E?07 3.43E?05 LOC101928143 3.44 2.03E?04 8.74E?04 RGMB 3.41 1.79E?06 4.85E?05 UCN2 3.40 3.77E?06 7.17E?05 TMEM117 3.40 2.27E?05 2.04E?04 ADGRG6 3.37 1.89E?05 1.81E?04 HIST2H2BE 3.36 1.74E?05 1.73E?04 ALPK1 3.34 9.51E?06 1.25E?04 LINC00704 3.33 3.15E?04 1.19E?03 PITPNC1 3.32 1.28E?06 4.28E?05 KCNG1 3.31 8.83E?08 1.37E?05 ANGPTL2 3.27 1.11E?06 3.95E?05 NREP 3.27 4.18E?08 1.16E?05 SDC1 3.25 3.67E?07 2.32E?05 C1orf198 3.25 2.07E?06 5.32E?05 TBX2 3.24 4.39E?07 2.46E?05 IRF9 3.21 3.83E?04 1.39E?03 CXCL1 3.20 3.01E?06 6.32E?05 ELL2 3.19 1.78E?05 1.75E?04 SPANXB1 3.18 1.29E?06 4.29E?05 TMCC3 3.17 2.24E?06 5.50E?05 S100A2 3.14 5.24E?07 2.60E?05 TM4SF1 3.13 1.56E?06 4.67E?05 ETHE1 3.12 9.66E?07 3.63E?05 RGS20 3.10 1.81E?04 8.06E?04 MYD88 3.09 1.74E?06 4.83E?05 ANTXR2 3.06 1.92E?05 1.83E?04 LOC105369340 3.06 2.61E?04 1.05E?03 NRP1 3.06 1.90E?07 1.88E?05 FBXO27 3.02 2.52E?07 2.13E?05 IL4R 3.01 7.46E?06 1.08E?04 AJAP1 2.99 2.43E?05 2.11E?04 PDGFC 2.97 7.95E?05 4.62E?04 HBEGF 2.97 4.28E?05 3.04E?04 BIRC2 2.95 7.23E?07 3.07E?05 ID2 2.92 1.63E?05 1.68E?04 ADAMTS1 2.91 5.56E?06 8.93E?05 SATB1 2.91 6.37E?06 9.68E?05 FOXC1 2.90 7.79E?06 1.11E?04 LOC105376382 2.89 2.90E?04 1.13E?03 SLC2A13 2.87 1.23E?04 6.22E?04 GJB3 2.86 2.12E?05 1.95E?04 NT5E 2.84 4.65E?07 2.47E?05 LOC100507002 2.84 3.21E?03 7.10E?03 SPOCK1 2.83 1.36E?06 4.42E?05 WNT5A 2.76 3.75E?07 2.35E?05 HELZ2 2.75 4.63E?03 9.42E?03 PTPRM 2.72 1.42E?04 6.82E?04 VLDLR 2.72 2.37E?05 2.09E?04 HDAC9 2.71 1.33E?05 1.51E?04 STRA6 2.71 7.38E?08 1.25E?05 TMEM255B 2.71 2.63E?03 6.04E?03 CIT 2.68 1.38E?06 4.42E?05 HIST2H2AA3 2.66 4.46E?06 7.96E?05 RNPEPL1 2.66 2.68E?05 2.26E?04 GNG2 2.64 8.30E?06 1.15E?04 CRYL1 2.64 1.97E?04 8.55E?04 AKR1C2 2.62 8.56E?05 4.87E?04 PHLDB3 2.61 3.01E?07 2.21E?05 EFNB1 2.57 2.10E?05 1.94E?04 FHL2 2.57 4.63E?07 2.47E?05 APOD 2.56 1.66E?04 7.63E?04 SAT1 2.54 4.76E?05 3.26E?04 ARHGEF4 2.54 1.24E?04 6.26E?04 ADGRE2 2.53 4.94E?06 8.43E?05 RASA1 2.52 1.83E?05 1.78E?04 S100A16 2.52 3.80E?08 1.08E?05 RNF182 2.51 5.39E?05 3.55E?04 EDNRB 2.51 6.54E?05 4.06E?04 STEAP3 2.51 1.34E?07 1.69E?05 SEMA3A 2.50 9.00E?06 1.20E?04 HIST1H2BK 2.50 1.43E?04 6.84E?04 ETS1 2.47 4.67E?06 8.19E?05 PLAUR 2.46 1.67E?06 4.78E?05 ENDOD1 2.46 4.66E?05 3.23E?04 NKILA 2.45 2.76E?04 1.08E?03 RELB 2.45 1.16E?05 1.40E?04 FAM107B 2.44 8.70E?05 4.93E?04 CD59 2.40 5.19E?08 1.25E?05 F2RL2 2.40 1.65E?05 1.68E?04 PCOLCE2 2.39 4.95E?04 1.69E?03 PFKFB4 2.39 1.68E?06 4.78E?05 MANBA 2.39 5.70E?06 9.11E?05 HIVEP2 2.38 7.42E?07 3.09E?05 CDK17 2.38 4.23E?06 7.73E?05 NFKB2 2.38 6.28E?07 2.84E?05 PLS1 2.37 4.08E?05 2.95E?04 FLJ20021 2.37 4.09E?04 1.46E?03 GDNF 2.36 1.58E?04 7.38E?04 ID1 2.36 2.96E?06 6.25E?05 TNFAIP3 2.34 2.30E?05 2.05E?04 DLX2 2.34 6.13E?05 3.88E?04 TDRD7 2.34 3.53E?05 2.70E?04 PLXNA3 2.34 1.11E?05 1.36E?04 SMAD7 2.34 1.20E?03 3.27E?03 PTHLH 2.32 1.45E?04 6.91E?04 ARG2 2.32 1.75E?04 7.89E?04 FOXC2 2.31 4.16E?04 1.48E?03 AQP3 2.31 3.38E?04 1.26E?03 SOX4 2.30 1.80E?05 1.76E?04 TMBIM1 2.29 1.28E?06 4.28E?05 ADAM19 2.29 4.84E?07 2.51E?05 PRKCDBP 2.29 8.05E?05 4.66E?04 NFKBIZ 2.28 7.46E?06 1.08E?04 ADK 2.27 5.09E?06 8.59E?05 SREK1IP1 2.26 1.61E?06 4.75E?05 ITGAS 2.26 1.39E?06 4.43E?05 FAS 2.25 4.96E?06 8.44E?05 HSPG2 2.25 6.23E?06 9.56E?05 IFNGR1 2.24 1.31E?06 4.29E?05 KDM6B 2.24 2.44E?07 2.12E?05 FRMD3 2.23 5.84E?05 3.76E?04 CREM 2.23 1.82E?04 8.11E?04 PMEPA1 2.23 2.61E?07 2.15E?05 CD68 2.23 1.57E?05 1.65E?04 SERINCS 2.22 7.19E?05 4.31E?04 TRNP1 2.22 1.85E?06 4.95E?05 SYNJ2 2.21 4.50E?06 7.98E?05 RAP2B 2.20 6.89E?05 4.21E?04 HOMER2 2.19 3.90E?04 1.40E?03 S100A1 2.19 3.64E?07 2.32E?05 AMOTL1 2.18 2.42E?07 2.12E?05 APC 2.18 8.04E?06 1.13E?04 LOC100996740 2.18 4.69E?06 8.19E?05 MGST3 2.17 5.53E?05 3.61E?04 TLDC1 2.17 4.91E?05 3.32E?04 PORCN 2.16 8.57E?05 4.88E?04 SMPD1 2.16 3.11E?05 2.51E?04 RIN2 2.15 2.68E?04 1.07E?03 MAP1B 2.15 2.20E?06 5.45E?05 FRMD4B 2.15 2.20E?05 2.00E?04 ERGIC1 2.14 3.91E?07 2.36E?05 STIM1 2.13 1.62E?06 4.75E?05 SORBS2 2.13 3.31E?06 6.64E?05 SDC2 2.13 1.03E?05 1.30E?04 CTHRC1 2.13 1.17E?04 5.98E?04 CEND1 2.12 3.11E?05 2.51E?04 SMTN 2.12 1.97E?06 5.14E?05 KLF13 2.10 2.34E?05 2.07E?04 ABLIM1 2.09 1.15E?04 5.91E?04 F11R 2.08 2.58E?05 2.21E?04 LINC00707 2.08 3.61E?05 2.72E?04 DBNDD1 2.05 5.30E?06 8.71E?05 ITGB8 2.04 1.01E?05 1.30E?04 COL9A2 2.04 1.72E?05 1.72E?04 DHRS7 2.03 3.56E?04 1.31E?03 RAB11FIP5 2.03 6.52E?06 9.85E?05 ACSL1 2.03 2.24E?05 2.02E?04 NR4A1 2.02 3.78E?07 2.35E?05 AHCYL2 2.02 2.45E?05 2.13E?04 TMEM132A 2.02 9.98E?06 1.29E?04 SHC4 2.02 3.08E?05 2.50E?04 PANX1 2.02 1.02E?05 1.30E?04 HIST1H2AC 2.02 9.47E?04 2.72E?03 MLLT3 2.01 2.62E?04 1.05E?03 CD82 2.01 9.13E?05 5.10E?04 NFIB 2.01 8.44E?06 1.16E?04 STK17A 2.00 2.43E?05 2.11E?04 NRP2 1.99 1.36E?06 4.42E?05 ABHD2 1.99 4.44E?07 2.46E?05 SIPA1L1 1.98 3.65E?04 1.34E?03 PGM3 1.98 2.42E?04 9.90E?04 CAPRIN2 1.98 2.64E?03 6.06E?03 NTM 1.97 8.95E?04 2.60E?03 ARSA 1.97 2.53E?03 5.85E?03 FAM214B 1.96 1.59E?05 1.67E?04 UBA6 1.96 2.88E?04 1.12E?03 HIST3H2A 1.96 2.69E?04 1.07E?03 IL13RA1 1.96 7.37E?06 1.08E?04 TBC1D9 1.96 1.49E?04 7.08E?04 GPRC5A 1.96 1.70E?06 4.78E?05 KIF13A 1.95 6.39E?05 3.99E?04 MXRA7 1.95 5.52E?06 8.88E?05 NET1 1.95 1.30E?05 1.49E?04 CTSL 1.95 9.73E?06 1.27E?04 JARID2 1.95 2.53E?05 2.17E?04 RIPK2 1.95 1.19E?05 1.42E?04 PIK3CD 1.94 9.67E?06 1.27E?04 CCDC71L 1.93 1.76E?06 4.85E?05 PRNP 1.93 4.92E?06 8.40E?05 NPDC1 1.93 1.15E?04 5.89E?04 DIEXF 1.93 1.52E?05 1.62E?04 PLPP4 1.92 1.40E?04 6.79E?04 TRPV4 1.92 4.81E?06 8.31E?05 ABTB1 1.92 3.87E?04 1.40E?03 LTBP4 1.91 1.28E?05 1.48E?04 SOCS2 1.91 2.37E?03 5.56E?03 TOMM34 1.91 1.49E?06 4.62E?05 RABAC1 1.91 1.44E?05 1.57E?04 MET 1.91 5.12E?07 2.56E?05 LINC00623 1.90 4.88E?05 3.31E?04 ATOX1 1.90 4.62E?07 2.47E?05 RHOC 1.90 1.19E?07 1.62E?05 GAS6 1.90 2.39E?06 5.70E?05 MYO10 1.89 1.19E?04 6.06E?04 TWF1 1.89 3.39E?06 6.69E?05 RIPK4 1.89 4.23E?05 3.01E?04 SH3PXD2B 1.89 6.58E?06 9.89E?05 NUP50 1.89 2.07E?06 5.32E?05 CORO1C 1.89 5.48E?06 8.84E?05 GPR161 1.89 1.46E?04 6.95E?04 CDK5R1 1.88 2.63E?06 5.95E?05 PERP 1.88 1.40E?06 4.43E?05 MYH9 1.88 2.98E?07 2.21E?05 GZF1 1.88 1.56E?03 4.01E?03 MROH1 1.88 6.77E?05 4.17E?04 APBB2 1.87 3.15E?05 2.53E?04 SNX9 1.87 1.54E?05 1.63E?04 UBA6-AS1 1.87 1.05E?04 5.60E?04 FURIN 1.87 6.48E?08 1.25E?05 KLF6 1.87 1.41E?04 6.81E?04 RUNX1 1.87 2.40E?05 2.10E?04 DHRS1 1.86 1.21E?04 6.12E?04 ECM1 1.85 1.81E?05 1.77E?04 S100A11 1.85 2.36E?06 5.67E?05 PARP8 1.85 1.64E?05 1.68E?04 GADD45B 1.85 1.02E?04 5.54E?04 DLGAP4 1.84 5.76E?06 9.19E?05 TAF9B 1.84 1.53E?05 1.63E?04 VAT1L 1.84 1.27E?04 6.32E?04 RHOB 1.84 3.23E?06 6.57E?05 SASH1 1.84 5.67E?06 9.09E?05 PPP1R21 1.82 3.21E?04 1.21E?03 MELTF 1.82 3.08E?06 6.38E?05 TAGLN2 1.82 5.22E?08 1.25E?05 RASA2 1.82 4.28E?04 1.51E?03 MAP1S 1.80 2.49E?06 5.83E?05 PRKCA 1.80 1.47E?05 1.59E?04 C9orf72 1.80 1.21E?03 3.28E?03 PPIF 1.80 8.05E?09 7.11E?06 TJP1 1.80 5.83E?06 9.25E?05 TRIO 1.79 4.69E?06 8.19E?05 APAF1 1.79 1.49E?05 1.60E?04 SHROOM4 1.78 7.04E?05 4.26E?04 ACAA1 1.78 1.64E?05 1.68E?04 ZFYVE16 1.77 7.76E?05 4.55E?04 TRIM58 1.77 3.77E?05 2.81E?04 PINK1 1.77 4.99E?04 1.70E?03 TBC1D19 1.76 2.05E?03 4.95E?03 TRPS1 1.76 9.89E?05 5.38E?04 RNF144A 1.76 4.82E?06 8.31E?05 CNKSR3 1.76 1.58E?04 7.37E?04 TM4SF19 1.76 9.60E?05 5.29E?04 SLC39A6 1.76 3.20E?06 6.54E?05 HES1 1.75 1.11E?04 5.80E?04 CPEB4 1.75 1.07E?05 1.33E?04 ABRACL 1.75 7.53E?06 1.09E?04 AKAP12 1.74 7.74E?07 3.13E?05 BCAS3 1.74 1.18E?03 3.23E?03 DNAJB9 1.74 1.40E?04 6.79E?04 NDRG1 1.74 4.54E?06 8.01E?05 ZSWIM4 1.74 1.60E?05 1.67E?04 SNX25 1.74 3.62E?05 2.73E?04 STARD13 1.74 1.00E?04 5.45E?04 PTPRU 1.74 4.12E?05 2.97E?04 IRGQ 1.73 2.26E?05 2.03E?04 NFKB1 1.72 7.82E?06 1.11E?04 AGAP2-AS1 1.71 1.81E?05 1.77E?04 ACOT7 1.71 1.59E?07 1.73E?05 TXNIP 1.71 2.77E?04 1.09E?03 NOV 1.71 9.51E?04 2.73E?03 ARRDC1 1.71 2.22E?05 2.01E?04 TMEM8A 1.71 9.13E?05 5.10E?04 PRDM2 1.71 3.20E?05 2.55E?04 SDSL 1.70 4.13E?04 1.47E?03 UAP1 1.70 1.61E?05 1.67E?04 KCNN4 1.70 7.27E?05 4.34E?04 JOSD1 1.69 2.37E?06 5.68E?05 DVL1 1.69 2.12E?05 1.94E?04 ANKRA2 1.69 1.34E?04 6.56E?04 MYADM 1.69 1.20E?06 4.11E?05 TGFBR1 1.69 2.41E?05 2.10E?04 DUSP10 1.69 2.31E?05 2.05E?04 UNC13B 1.68 4.29E?04 1.51E?03 FMN2 1.68 9.43E?04 2.71E?03 RRAS 1.68 9.07E?05 5.08E?04 C14orf159 1.68 1.04E?03 2.93E?03 MAFK 1.68 1.31E?04 6.47E?04 FZD8 1.68 2.24E?05 2.02E?04 GDI1 1.68 1.81E?05 1.77E?04 SLC18B1 1.68 5.64E?04 1.85E?03 FYN 1.67 4.48E?07 2.46E?05 LOC102724122 1.67 1.10E?04 5.78E?04 CHST7 1.67 2.11E?04 8.97E?04 CENPM 1.67 1.15E?04 5.89E?04 HOMER3 1.67 2.88E?05 2.39E?04 SLC22A4 1.67 2.02E?03 4.90E?03 ADD2 1.67 1.70E?04 7.75E?04 IL1RAPL1 1.66 8.27E?04 2.44E?03 AIG1 1.66 1.79E?03 4.45E?03 MSN 1.66 2.71E?08 9.89E?06 SLC9A3R2 1.66 3.01E?05 2.45E?04 CORO2B 1.66 9.79E?06 1.27E?04 ARSD 1.65 3.37E?04 1.26E?03 SLC1A1 1.65 7.56E?04 2.29E?03 HYAL3 1.65 1.35E?03 3.57E?03 TRIB1 1.65 5.09E?06 8.59E?05 SLC24A3 1.64 2.94E?05 2.42E?04 ENTPD7 1.64 1.25E?04 6.27E?04 SERPINB8 1.64 1.15E?05 1.40E?04 FOXN2 1.64 8.63E?05 4.90E?04 ABR 1.64 4.46E?07 2.46E?05 GLRX 1.64 6.59E?05 4.07E?04 PLSCR3 1.64 1.30E?05 1.49E?04 OXSR1 1.63 3.71E?06 7.10E?05 ACTA2 1.63 4.77E?04 1.64E?03 RAP1GAP2 1.63 2.73E?04 1.07E?03 NAGK 1.63 5.00E?05 3.36E?04 ARHGAP21 1.63 1.03E?05 1.30E?04 TGFB1 1.62 2.92E?05 2.41E?04 MFHAS1 1.62 6.83E?05 4.18E?04 RAI14 1.62 6.89E?05 4.21E?04 PITPNM2 1.62 1.02E?03 2.87E?03 SPRY2 1.62 6.35E?06 9.68E?05 CHPF 1.61 2.25E?05 2.02E?04 MSANTD3 1.61 2.72E?04 1.07E?03 SEZ6L2 1.61 8.02E?06 1.13E?04 GRN 1.61 2.19E?06 5.45E?05 ARPC1B 1.61 2.41E?06 5.74E?05 RNF215 1.61 9.82E?05 5.37E?04 TICAM1 1.61 4.63E?04 1.61E?03 PSAP 1.61 2.48E?06 5.82E?05 NAT6 1.61 2.45E?03 5.71E?03 EFL1 1.60 6.18E?05 3.90E?04 CEP170B 1.60 1.10E?04 5.78E?04 BTBD10 1.60 5.11E?06 8.61E?05 CCNDBP1 1.60 1.11E?04 5.81E?04 ASAH1 1.60 4.37E?05 3.08E?04 IFI27L2 1.60 1.54E?03 3.97E?03 TRIM35 1.60 1.22E?03 3.29E?03 TMSB10 1.60 1.73E?06 4.82E?05 P4HA2 1.59 3.74E?04 1.36E?03 UBALD2 1.59 2.52E?04 1.02E?03 CYSTM1 1.59 2.12E?03 5.10E?03 CLSTN1 1.59 1.55E?05 1.64E?04 TRAM2 1.59 6.71E?06 1.00E?04 SLC39A8 1.59 2.12E?03 5.10E?03 CAPN1 1.59 3.13E?06 6.44E?05 MTMR1 1.59 1.81E?04 8.06E?04 CLCF1 1.59 2.70E?04 1.07E?03 SMYD2 1.59 3.11E?04 1.18E?03 FOXD1 1.58 1.66E?05 1.68E?04 GALNT7 1.58 8.79E?05 4.97E?04 TMEM54 1.58 1.62E?04 7.51E?04 MYL6 1.58 4.94E?07 2.53E?05 INPP5A 1.58 2.65E?04 1.06E?03 DNASE1L1 1.58 1.60E?03 4.10E?03 SLC39A13 1.58 1.97E?04 8.56E?04 PHKA1 1.58 1.44E?04 6.90E?04 9-Mar 1.58 2.01E?04 8.65E?04 KCTD11 1.58 1.62E?03 4.12E?03 EDEM1 1.58 8.33E?06 1.15E?04 BCAS4 1.58 1.42E?04 6.84E?04 IFT80 1.58 1.54E?04 7.24E?04 MFGE8 1.57 4.10E?04 1.46E?03 SPHK1 1.57 4.96E?04 1.69E?03 LRP10 1.57 5.24E?06 8.68E?05 PSEN2 1.57 1.45E?04 6.94E?04 TMEM102 1.57 7.15E?04 2.20E?03 APLP2 1.56 3.38E?05 2.64E?04 ZCCHC14 1.56 1.52E?04 7.17E?04 IL11 1.56 1.51E?04 7.14E?04 ABAT 1.56 1.01E?03 2.87E?03 AIDA 1.56 1.72E?04 7.79E?04 EFNB2 1.56 1.05E?05 1.31E?04 AP1S2 1.56 2.98E?05 2.43E?04 CAPS 1.56 2.01E?05 1.88E?04 RELT 1.55 9.70E?04 2.77E?03 CLDN4 1.55 4.72E?04 1.63E?03 ZFP36 1.55 1.12E?03 3.10E?03 CLASP1 1.55 1.88E?05 1.80E?04 MDFIC 1.55 2.53E?03 5.87E?03 BIVM 1.55 1.41E?05 1.57E?04 UBL3 1.55 1.07E?04 5.65E?04 MAML2 1.55 2.29E?04 9.48E?04 GJB1 1.55 7.95E?06 1.13E?04 SLC33A1 1.55 6.80E?04 2.13E?03 NPC1 1.54 2.90E?06 6.19E?05 APPL2 1.54 3.64E?05 2.74E?04 SERINC3 1.54 1.58E?05 1.66E?04 GNAI1 1.54 1.30E?03 3.47E?03 KIF21A 1.54 3.21E?04 1.21E?03 WLS 1.54 2.77E?06 6.11E?05 PARP3 1.54 8.18E?05 4.71E?04 TEX30 1.54 1.63E?03 4.15E?03 RALGPS2 1.54 7.05E?04 2.19E?03 S100A13 1.54 7.96E?07 3.17E?05 MAP1LC3B 1.53 9.79E?06 1.27E?04 RAB11FIP1 1.53 7.48E?05 4.44E?04 PLD3 1.53 7.50E?05 4.44E?04 YPEL5 1.53 4.20E?04 1.49E?03 SLC35C1 1.53 8.12E?05 4.68E?04 NR2F2 1.53 3.75E?05 2.80E?04 USP11 1.53 2.84E?06 6.19E?05 CLU 1.53 2.38E?04 9.78E?04 TCF7L2 1.53 9.53E?05 5.27E?04 UBE2Q2 1.53 1.03E?05 1.30E?04 ANKRD10 1.53 5.63E?04 1.85E?03 FYCO1 1.53 1.72E?04 7.79E?04 ZEB1 1.53 6.35E?06 9.68E?05 SP3 1.53 2.95E?05 2.42E?04 SRSF8 1.53 1.09E?05 1.35E?04 HIST2H4A 1.53 4.54E?03 9.28E?03 HIST2H4B 1.53 4.54E?03 9.28E?03 YPEL3 1.53 3.16E?04 1.20E?03 ANKS6 1.52 1.52E?04 7.18E?04 SERGEF 1.52 1.54E?04 7.26E?04 RPRD1A 1.52 9.77E?04 2.79E?03 PTRH1 1.52 1.53E?03 3.95E?03 UPP1 1.52 3.47E?04 1.29E?03 TRPT1 1.52 2.35E?04 9.67E?04 TTPAL 1.52 1.96E?07 1.92E?05 HEBP2 1.52 2.01E?03 4.88E?03 SVIL 1.51 7.05E?05 4.26E?04 FEZ1 1.51 1.97E?06 5.14E?05 SLCO4A1-AS1 1.51 1.19E?03 3.24E?03 FUT8 1.51 2.74E?04 1.08E?03 OSTF1 1.50 6.04E?04 1.95E?03 LAP3 1.50 2.59E?04 1.04E?03 PDE4A 1.50 5.05E?05 3.38E?04 SLC35G2 1.50 3.95E?04 1.42E?03 UPRT 1.50 2.58E?04 1.04E?03 ISCA1 1.50 1.30E?04 6.42E?04 FAM177A1 1.50 3.74E?03 7.98E?03 SWAP70 1.49 1.75E?05 1.74E?04 DSTYK 1.49 6.20E?06 9.53E?05 SP100 1.49 1.37E?03 3.62E?03 DENND1A 1.49 1.25E?05 1.47E?04 SKAP2 1.49 1.67E?04 7.65E?04 SKIL 1.49 5.55E?04 1.83E?03 POLD4 1.49 1.27E?04 6.32E?04 SPRYD3 1.49 2.32E?03 5.46E?03 CACNB3 1.48 6.57E?05 4.07E?04 FAM83G 1.48 3.58E?05 2.72E?04 KHNYN 1.48 2.34E?04 9.62E?04 ABCA2 1.48 2.76E?05 2.30E?04 MED13 1.48 5.40E?05 3.55E?04 BCORL1 1.48 3.61E?03 7.75E?03 ITPKB 1.48 1.71E?03 4.31E?03 PARVB 1.48 7.30E?06 1.07E?04 FAM168A 1.47 4.36E?05 3.07E?04 KIFAP3 1.47 1.86E?04 8.24E?04 HIPK3 1.47 1.96E?04 8.52E?04 FLOT1 1.47 5.97E?05 3.81E?04 MAP3K4 1.47 1.26E?04 6.30E?04 SERTAD1 1.47 3.87E?03 8.20E?03 MANEAL 1.47 2.61E?04 1.05E?03 TCIRG1 1.47 5.12E?04 1.73E?03 PLGRKT 1.47 3.60E?04 1.33E?03 QSOX1 1.47 5.09E?05 3.40E?04 FGFR1 1.46 1.15E?04 5.89E?04 PSEN1 1.46 4.72E?04 1.63E?03 NOMO2 1.46 3.75E?05 2.80E?04 SPAG9 1.46 1.01E?04 5.48E?04 TMEM14A 1.46 4.01E?03 8.43E?03 NUMB 1.46 1.84E?05 1.78E?04 ATP2B4 1.46 1.83E?05 1.78E?04 EVIS 1.46 2.56E?03 5.90E?03 DECR1 1.46 1.74E?03 4.36E?03 ADIPOR1 1.45 1.55E?06 4.67E?05 MICAL1 1.45 7.27E?04 2.23E?03 PGPEP1 1.45 9.86E?04 2.81E?03 STXBP1 1.45 3.24E?05 2.56E?04 DOCK5 1.45 4.48E?04 1.57E?03 STEAP1B 1.44 1.01E?04 5.48E?04 SLC6A15 1.44 2.65E?05 2.24E?04 GM2A 1.44 1.28E?04 6.37E?04 CITED4 1.44 1.89E?03 4.65E?03 PPTC7 1.44 8.22E?05 4.72E?04 UHRF2 1.44 1.33E?03 3.54E?03 LRFN4 1.44 5.78E?04 1.89E?03 TMEM134 1.44 1.25E?03 3.37E?03 SLC1A4 1.44 1.36E?04 6.66E?04 IFI30 1.43 7.03E?05 4.26E?04 CALCOCO1 1.43 1.07E?04 5.65E?04 IER5 1.43 1.99E?04 8.60E?04 MAPKBP1 1.43 4.43E?05 3.10E?04 MAFF 1.43 2.09E?03 5.02E?03 CUX1 1.43 2.32E?05 2.06E?04 PPP4R1 1.43 1.18E?03 3.22E?03 WBP1L 1.43 1.41E?04 6.82E?04 ATL3 1.43 3.81E?04 1.38E?03 INO80C 1.43 4.91E?03 9.87E?03 PELI1 1.43 1.77E?03 4.42E?03 LMF2 1.43 1.05E?03 2.95E?03 PPP2R1B 1.43 5.77E?04 1.88E?03 ENO2 1.43 3.72E?04 1.36E?03 TPM4 1.43 1.30E?06 4.29E?05 DOK4 1.42 2.87E?03 6.49E?03 KRT15 1.42 1.41E?03 3.69E?03 STIM2 1.42 2.69E?04 1.07E?03 MLXIP 1.42 1.09E?04 5.74E?04 DBN1 1.42 6.84E?05 4.19E?04 ADO 1.42 1.37E?03 3.62E?03 CUEDC1 1.42 2.87E?06 6.19E?05 DNAJB2 1.42 2.19E?04 9.19E?04 ETV3 1.41 2.72E?04 1.07E?03 CYBA 1.41 3.35E?06 6.68E?05 OSBPL3 1.41 4.12E?05 2.97E?04 MESDC1 1.41 1.78E?03 4.42E?03 FKBP10 1.41 4.18E?06 7.69E?05 SGK1 1.41 1.59E?04 7.39E?04 CYLD 1.41 6.99E?04 2.17E?03 FRYL 1.41 1.34E?04 6.57E?04 GAK 1.41 1.16E?04 5.91E?04 FBN1 1.41 9.60E?05 5.29E?04 TLCD1 1.41 2.12E?03 5.09E?03 SLC22A18 1.40 1.82E?05 1.77E?04 MAN2B1 1.40 1.13E?04 5.83E?04 NT5DC3 1.40 3.13E?03 6.96E?03 NFIL3 1.40 3.60E?04 1.33E?03 SLC35F2 1.40 1.38E?03 3.63E?03 ARRDC2 1.40 8.45E?05 4.83E?04 MXD4 1.40 2.08E?03 5.01E?03 LAMC1 1.40 3.10E?07 2.21E?05 ERCC5 1.40 6.45E?04 2.05E?03 KIF16B 1.40 5.97E?04 1.93E?03 TRIM3 1.40 2.41E?03 5.64E?03 TPRG1L 1.40 4.27E?03 8.86E?03 TLE3 1.40 8.28E?05 4.75E?04 SNX29 1.40 6.83E?05 4.18E?04 CALD1 1.40 1.12E?04 5.82E?04 RELA 1.40 9.06E?05 5.08E?04 ELOVL1 1.39 1.60E?05 1.67E?04 SALL1 1.39 4.22E?05 3.01E?04 SYVN1 1.39 1.01E?04 5.48E?04 SNAPC2 1.39 2.06E?03 4.97E?03 NOL3 1.39 2.06E?04 8.82E?04 OSTM1 1.39 2.73E?05 2.29E?04 TMCO3 1.39 3.28E?05 2.58E?04 RRM2B 1.39 5.61E?05 3.65E?04 TLE1 1.39 2.74E?04 1.08E?03 PDE4DIP 1.39 2.19E?03 5.21E?03 PIKFYVE 1.39 1.38E?04 6.72E?04 FLOT2 1.39 1.15E?04 5.89E?04 EYA3 1.39 2.38E?05 2.09E?04 SPATA20 1.39 2.30E?03 5.43E?03 PLP2 1.39 8.13E?06 1.14E?04 AGA 1.38 2.00E?04 8.61E?04 MARVELD1 1.38 7.65E?05 4.50E?04 TTC17 1.38 1.95E?04 8.49E?04 ATG12 1.38 1.96E?04 8.52E?04 TMEM87A 1.38 1.10E?04 5.76E?04 FRMD8 1.38 3.56E?05 2.71E?04 DLX1 1.38 2.79E?04 1.09E?03 ZBED1 1.38 7.25E?04 2.22E?03 ADCY7 1.38 5.65E?04 1.85E?03 RCAN3 1.38 1.62E?03 4.13E?03 LRP1 1.37 3.88E?04 1.40E?03 OBFC1 1.37 5.91E?04 1.92E?03 TBX3 1.37 8.97E?05 5.05E?04 C7orf43 1.37 1.03E?04 5.54E?04 UBE2R2 1.37 5.99E?06 9.38E?05 FGFRL1 1.37 1.68E?05 1.70E?04 FN1 1.37 7.50E?07 3.10E?05 STAT6 1.37 1.13E?05 1.38E?04 PRKCD 1.37 1.35E?04 6.61E?04 PMP22 1.37 4.12E?06 7.62E?05 SSR4 1.37 4.09E?04 1.46E?03 ANKRD13A 1.36 6.04E?05 3.84E?04 SLC11A2 1.36 1.71E?04 7.77E?04 IRS2 1.36 9.63E?05 5.29E?04 FAM102A 1.36 2.69E?04 1.07E?03 DOCK7 1.36 1.74E?03 4.37E?03 CSGALNACT2 1.36 3.34E?03 7.31E?03 CDC42SE2 1.36 3.20E?04 1.21E?03 SLC9B2 1.36 1.05E?03 2.95E?03 GRAMD1A 1.36 3.38E?04 1.26E?03 FAM134A 1.36 1.56E?04 7.33E?04 TUFT1 1.36 1.11E?05 1.36E?04 USP12 1.36 3.34E?04 1.25E?03 FAM213A 1.36 3.02E?03 6.74E?03 GNAI2 1.36 1.65E?04 7.60E?04 NDUFB8 1.36 5.87E?05 3.76E?04 CERK 1.36 1.60E?05 1.67E?04 PSMD2 1.36 3.17E?05 2.54E?04 GRIK2 1.35 2.90E?04 1.13E?03 KYNU 1.35 5.37E?05 3.54E?04 AGPAT2 1.35 1.67E?04 7.67E?04 GUCD1 1.35 2.13E?04 9.00E?04 KLHL2 1.35 2.51E?04 1.02E?03 ACTG1 1.35 1.78E?06 4.85E?05 CTTNBP2NL 1.35 4.43E?03 9.12E?03 WDR45 1.35 1.05E?05 1.31E?04 PLPP6 1.35 3.48E?03 7.54E?03 PLEKHM1 1.35 1.71E?04 7.78E?04 GLTP 1.35 2.78E?04 1.09E?03 ANXA4 1.35 6.98E?04 2.17E?03 LOC100507377 1.35 1.06E?03 2.97E?03 HMGCL 1.35 2.34E?03 5.49E?03 IRF1 1.35 3.17E?03 7.03E?03 STX7 1.35 3.79E?03 8.06E?03 VPS13C 1.35 1.49E?04 7.09E?04 PLK3 1.35 8.01E?04 2.39E?03 ABCC10 1.35 2.76E?03 6.28E?03 CDS2 1.34 5.13E?04 1.73E?03 EMP3 1.34 3.13E?05 2.52E?04 OSBPL8 1.34 2.33E?05 2.06E?04 ARAP1 1.34 1.02E?04 5.51E?04 IKBKE 1.34 7.17E?04 2.21E?03 ZFAND1 1.34 7.25E?04 2.22E?03 CAPG 1.34 2.18E?05 1.98E?04 ARHGAP1 1.34 5.93E?04 1.92E?03 WASF3 1.34 5.43E?04 1.80E?03 SIK3 1.34 1.48E?03 3.85E?03 HGSNAT 1.34 1.59E?04 7.40E?04 ITGB1 1.34 5.24E?06 8.68E?05 SH3BGRL3 1.34 1.95E?04 8.49E?04 PLPP5 1.34 1.00E?03 2.85E?03 MINPP1 1.34 1.18E?05 1.42E?04 RAB6A 1.34 1.25E?04 6.27E?04 CPPED1 1.34 5.18E?04 1.74E?03 ZCCHC6 1.33 8.62E?04 2.52E?03 NR3C1 1.33 7.35E?04 2.24E?03 RAB18 1.33 1.57E?03 4.05E?03 SLC48A1 1.33 3.30E?04 1.24E?03 SERINC1 1.33 1.89E?04 8.33E?04 COG3 1.33 2.09E?03 5.03E?03 AP3S1 1.33 3.90E?04 1.40E?03 RGS16 1.33 3.22E?03 7.11E?03 FOXK1 1.33 5.08E?04 1.72E?03 CD96 1.33 7.11E?05 4.29E?04 VIMP 1.33 2.16E?03 5.17E?03 CSRP1 1.33 1.27E?04 6.34E?04 FEM1C 1.33 9.62E?05 5.29E?04 CAPN10 1.33 2.82E?03 6.39E?03 SMAGP 1.33 2.87E?04 1.12E?03 TRIM4 1.33 3.36E?03 7.35E?03 GASS 1.33 2.46E?04 1.00E?03 ELK4 1.33 1.40E?03 3.66E?03 OSGIN2 1.33 3.00E?04 1.15E?03 TSPAN3 1.33 1.06E?03 2.97E?03 LOC652276 1.32 4.82E?03 9.72E?03 CDIPT 1.32 5.39E?05 3.55E?04 KDELC1 1.32 1.45E?03 3.78E?03 RASSF3 1.32 4.20E?05 3.00E?04 EPN2 1.32 1.00E?03 2.85E?03 EFCAB14 1.32 4.76E?04 1.64E?03 FXYD5 1.32 4.78E?05 3.27E?04 NR1D2 1.32 1.66E?04 7.64E?04 UGGT2 1.32 1.98E?04 8.56E?04 SELK 1.32 2.98E?03 6.67E?03 BCAP31 1.32 2.42E?05 2.10E?04 PARP4 1.32 3.25E?06 6.59E?05 CERS2 1.32 1.45E?05 1.58E?04 PIGM 1.32 2.69E?04 1.07E?03 PPP2R5B 1.32 1.07E?03 3.00E?03 MYL12A 1.32 1.65E?04 7.62E?04 RNASEK 1.32 1.24E?03 3.35E?03 10-Sep 1.32 9.61E?05 5.29E?04 TMEM120A 1.31 1.74E?04 7.85E?04 MOAP1 1.31 2.94E?05 2.42E?04 PCBP4 1.31 2.53E?05 2.17E?04 CYTH2 1.31 9.86E?05 5.37E?04 SPATA13 1.31 4.43E?04 1.55E?03 SAR1B 1.31 2.25E?04 9.36E?04 MFSD1 1.31 1.69E?04 7.71E?04 SNX30 1.31 1.55E?03 4.00E?03 LOC100506548 1.31 1.63E?03 4.15E?03 POPDC3 1.31 8.67E?04 2.53E?03 MCOLN1 1.31 2.74E?04 1.08E?03 GNB4 1.31 4.15E?03 8.67E?03 PICALM 1.31 8.78E?05 4.96E?04 ALDH1A3 1.31 1.23E?06 4.17E?05 VAMP3 1.30 2.65E?04 1.06E?03 CAPN2 1.30 8.71E?06 1.18E?04 UFC1 1.30 7.37E?04 2.25E?03 ITGAV 1.30 3.44E?04 1.28E?03 ZKSCAN1 1.30 1.21E?05 1.43E?04 GIPC1 1.30 2.79E?06 6.13E?05 HTR7 1.30 2.17E?03 5.18E?03 DNTTIP1 1.30 4.51E?04 1.57E?03 ZADH2 1.30 2.67E?03 6.10E?03 GMIP 1.30 1.75E?03 4.38E?03 PGK1 1.30 8.21E?06 1.14E?04 TRAPPC1 1.30 4.91E?05 3.32E?04 PHLDB1 1.30 4.86E?04 1.67E?03 PPIC 1.30 3.92E?03 8.29E?03 SOX10 1.30 7.15E?05 4.30E?04 DUSP7 1.30 1.04E?04 5.60E?04 PLEKHA3 1.30 1.88E?03 4.63E?03 JRKL 1.30 4.29E?03 8.89E?03 MLLT11 1.30 3.41E?04 1.27E?03 CD99 1.30 2.02E?05 1.89E?04 TMEM64 1.30 9.57E?04 2.74E?03 H6PD 1.29 9.29E?05 5.16E?04 CSNK1E 1.29 3.52E?05 2.70E?04 TMEM63B 1.29 1.12E?03 3.09E?03 TMEM127 1.29 8.51E?04 2.50E?03 MACF1 1.29 1.27E?05 1.48E?04 PLPPR2 1.29 7.07E?04 2.19E?03 SNX8 1.29 5.71E?05 3.70E?04 EBLN3 1.29 2.41E?05 2.10E?04 FAM3C 1.29 7.95E?06 1.13E?04 RAPGEF1 1.29 5.94E?04 1.92E?03 VEGFB 1.29 6.17E?05 3.89E?04 REST 1.29 1.25E?04 6.28E?04 SLCO4A1 1.29 1.66E?03 4.22E?03 DAB2IP 1.29 5.72E?04 1.87E?03 B2M 1.29 1.12E?04 5.82E?04 LIMS1 1.29 7.50E?05 4.44E?04 ACBD5 1.29 1.91E?03 4.69E?03 DNAJC10 1.29 6.10E?04 1.97E?03 TMCO4 1.29 4.25E?03 8.84E?03 GOLT1B 1.29 8.60E?04 2.52E?03 TCP11L1 1.29 3.00E?04 1.15E?03 GUK1 1.28 3.02E?04 1.16E?03 IMPDH1 1.28 8.48E?05 4.84E?04 TATDN2 1.28 8.17E?05 4.71E?04 FKBP1A 1.28 4.47E?06 7.96E?05 NOL9 1.28 8.35E?04 2.46E?03 DNAJC4 1.28 8.07E?04 2.40E?03 TESK1 1.28 2.40E?03 5.61E?03 CANT1 1.28 5.10E?04 1.72E?03 PRCP 1.28 1.35E?03 3.58E?03 KLHL42 1.28 3.27E?03 7.18E?03 TMUB2 1.28 5.29E?04 1.77E?03 KDSR 1.28 2.93E?04 1.13E?03 RMND5B 1.28 4.74E?03 9.58E?03 MMP16 1.28 1.82E?04 8.08E?04 GRIPAP1 1.28 7.25E?04 2.22E?03 TAF13 1.28 4.49E?04 1.57E?03 SAGE1 1.28 9.48E?04 2.72E?03 UBE2Z 1.28 1.63E?04 7.54E?04 CERCAM 1.28 7.78E?04 2.34E?03 SMARCA2 1.28 1.34E?03 3.57E?03 FAM114A1 1.27 7.46E?04 2.27E?03 CES2 1.27 1.31E?05 1.50E?04 KLHL36 1.27 6.37E?04 2.03E?03 KLC2 1.27 2.60E?04 1.04E?03 NPR2 1.27 1.75E?04 7.88E?04 VPS9D1 1.27 8.98E?05 5.05E?04 TUBB3 1.27 1.42E?04 6.82E?04 CHIC2 1.27 8.14E?04 2.41E?03 EEF2KMT 1.27 1.03E?03 2.89E?03 2-Mar 1.27 2.70E?04 1.07E?03 PLBD2 1.27 1.89E?03 4.64E?03 MNT 1.27 6.46E?04 2.05E?03 TGIF1 1.27 3.54E?03 7.64E?03 ARPC1A 1.27 8.29E?06 1.15E?04 GPN1 1.27 1.19E?03 3.24E?03 CHMP5 1.27 6.19E?04 1.99E?03 WDTC1 1.27 2.21E?04 9.26E?04 XIAP 1.27 4.80E?05 3.27E?04 SQSTM1 1.27 5.69E?05 3.69E?04 ASNS 1.27 1.98E?03 4.82E?03 ARNT 1.27 3.03E?03 6.76E?03 KIAA0754 1.27 3.52E?04 1.30E?03 YIPF5 1.27 9.98E?04 2.84E?03 MAPKAPK2 1.27 8.84E?04 2.57E?03 PRDX5 1.27 7.20E?04 2.21E?03 GBA 1.27 2.97E?04 1.14E?03 PPP1CB 1.26 2.25E?04 9.35E?04 ZBTB4 1.26 8.29E?04 2.45E?03 GPAT3 1.26 1.72E?04 7.79E?04 STXBP3 1.26 1.50E?03 3.90E?03 TSHZ1 1.26 1.08E?03 3.00E?03 AMACR 1.26 3.97E?03 8.38E?03 SMG7 1.26 1.68E?04 7.71E?04 TCAF1 1.26 4.73E?05 3.26E?04 TIPARP 1.26 8.23E?04 2.44E?03 HIPK1 1.26 2.91E?04 1.13E?03 CSTB 1.26 1.43E?03 3.75E?03 TACC1 1.26 1.58E?04 7.37E?04 MGAT4B 1.26 1.87E?04 8.26E?04 DEAF1 1.26 2.97E?03 6.65E?03 YAP1 1.26 8.68E?04 2.53E?03 PLOD1 1.26 1.06E?04 5.64E?04 SUCO 1.26 4.61E?04 1.60E?03 TM9SF3 1.26 7.83E?04 2.35E?03 POLG 1.26 3.37E?03 7.36E?03 TRIM56 1.25 4.56E?04 1.59E?03 PMAIP1 1.25 2.16E?03 5.16E?03 AGFG1 1.25 5.45E?04 1.81E?03 EMP1 1.25 4.92E?04 1.68E?03 RPS4X 1.25 1.65E?07 1.75E?05 ZC3HAV1 1.25 6.90E?04 2.15E?03 SCYL2 1.25 1.31E?05 1.49E?04 TDRKH 1.25 4.21E?03 8.77E?03 B4GALT7 1.25 2.28E?03 5.40E?03 FAM214A 1.25 1.39E?03 3.66E?03 PTBP3 1.25 3.45E?04 1.28E?03 RHOG 1.25 3.36E?03 7.35E?03 PBX3 1.25 1.60E?04 7.44E?04 LAMB2 1.25 8.97E?04 2.60E?03 PACS1 1.25 3.45E?04 1.28E?03 ARHGEF12 1.25 4.03E?05 2.92E?04 ULK3 1.25 3.26E?03 7.17E?03 POGK 1.25 1.01E?03 2.87E?03 MTRNR2L8 1.25 2.58E?03 5.94E?03 HPS6 1.25 2.06E?03 4.98E?03 SLK 1.25 6.45E?04 2.05E?03 NUDT22 1.25 1.77E?03 4.42E?03 RNF146 1.25 4.26E?03 8.84E?03 LRRC8A 1.25 5.87E?05 3.76E?04 CHMP3 1.25 9.78E?04 2.79E?03 ATP6V1G1 1.25 6.07E?05 3.86E?04 UTRN 1.25 2.80E?03 6.34E?03 EXOC7 1.24 2.74E?04 1.08E?03 LOC102723724 1.24 7.02E?04 2.18E?03 TMEM50A 1.24 3.46E?03 7.50E?03 PLOD3 1.24 5.40E?06 8.78E?05 LINC00467 1.24 1.53E?04 7.23E?04 HERC4 1.24 3.61E?03 7.75E?03 SBF1 1.24 2.85E?04 1.11E?03 SMIM19 1.24 1.32E?03 3.52E?03 C16orf45 1.24 6.75E?04 2.12E?03 ARPC5 1.24 5.94E?05 3.80E?04 HS3ST3A1 1.24 1.35E?03 3.58E?03 MGST1 1.24 6.59E?04 2.08E?03 MORC3 1.24 4.11E?03 8.60E?03 CREB3 1.24 4.16E?03 8.69E?03 ITPKC 1.24 5.60E?04 1.84E?03 SHARPIN 1.24 1.01E?03 2.86E?03 ATP6AP2 1.24 2.08E?04 8.89E?04 CTSB 1.24 1.22E?04 6.16E?04 NOTCH2 1.24 1.72E?05 1.72E?04 CCDC93 1.24 2.75E?04 1.08E?03 NIPA1 1.24 6.67E?05 4.11E?04 PTDSS1 1.24 1.19E?05 1.42E?04 BICD1 1.24 1.68E?03 4.24E?03 CMAS 1.24 1.45E?03 3.78E?03 ALDH9A1 1.24 1.27E?04 6.34E?04 DPP3 1.24 7.80E?05 4.57E?04 ATG101 1.24 2.30E?06 5.55E?05 G3BP1 1.23 2.96E?06 6.25E?05 NECAP2 1.23 1.12E?03 3.09E?03 GPR107 1.23 3.72E?04 1.36E?03 CCND1 1.23 3.05E?06 6.38E?05 GRINA 1.23 1.44E?04 6.89E?04 ATXN10 1.23 5.36E?05 3.53E?04 UBR1 1.23 2.68E?03 6.13E?03 ZBTB7A 1.23 3.54E?03 7.63E?03 GNG10 1.23 3.73E?04 1.36E?03 MC1R 1.23 4.76E?03 9.61E?03 NDFIP1 1.23 1.30E?04 6.42E?04 SLMAP 1.23 2.25E?03 5.33E?03 DUSP23 1.23 1.66E?03 4.20E?03 C1orf122 1.23 4.10E?03 8.59E?03 RASAL2 1.23 1.32E?04 6.50E?04 TOLLIP 1.23 3.46E?03 7.50E?03 HECTD3 1.23 3.18E?04 1.20E?03 MPP6 1.23 5.45E?04 1.81E?03 UBE2L6 1.23 1.84E?03 4.53E?03 SESN2 1.23 1.84E?03 4.54E?03 ATP6V1D 1.22 2.75E?03 6.26E?03 BRSK1 1.22 1.94E?04 8.46E?04 APMAP 1.22 5.36E?04 1.79E?03 WDR13 1.22 1.71E?03 4.30E?03 TMEM9B 1.22 2.14E?04 9.04E?04 FBXO17 1.22 3.84E?03 8.15E?03 FSCN1 1.22 7.14E?05 4.30E?04 B3GAT3 1.22 1.15E?03 3.15E?03 CTTN 1.22 2.30E?04 9.50E?04 INSIG1 1.22 1.39E?03 3.66E?03 CORO1B 1.22 1.36E?04 6.66E?04 MYO9B 1.22 1.46E?05 1.58E?04 CBFB 1.22 7.33E?04 2.24E?03 KLHDC2 1.22 2.36E?04 9.71E?04 RPS12 1.22 1.15E?05 1.40E?04 ZER1 1.21 2.46E?04 1.00E?03 SDE2 1.21 1.01E?03 2.87E?03 NCEH1 1.21 5.52E?04 1.83E?03 RECQL 1.21 1.50E?04 7.10E?04 COMMD6 1.21 4.79E?03 9.67E?03 LIX1L 1.21 7.07E?04 2.19E?03 FBXO28 1.21 9.03E?04 2.62E?03 KDM5B 1.21 9.03E?06 1.20E?04 TMED4 1.21 4.06E?04 1.45E?03 CMIP 1.21 4.61E?03 9.38E?03 ZNF444 1.21 1.37E?03 3.62E?03 CTSF 1.21 2.64E?03 6.06E?03 TNIP2 1.21 2.34E?03 5.49E?03 JADE1 1.21 2.99E?03 6.67E?03 CD47 1.21 1.81E?03 4.49E?03 PLEC 1.21 8.56E?04 2.51E?03 EEF2 1.21 5.30E?05 3.50E?04 WASL 1.21 3.27E?03 7.18E?03 MAST3 1.21 4.68E?03 9.49E?03 ERP44 1.21 3.91E?03 8.28E?03 PITRM1 1.21 2.90E?04 1.12E?03 MICA 1.21 4.10E?05 2.96E?04 PLIN3 1.21 4.30E?04 1.51E?03 FRMD4A 1.20 7.57E?04 2.29E?03 TNFRSF1A 1.20 2.53E?04 1.02E?03 PTPN9 1.20 4.92E?04 1.68E?03 TUG1 1.20 4.69E?04 1.62E?03 LTBP3 1.20 1.41E?04 6.81E?04 TVP23B 1.20 1.98E?04 8.56E?04 NAPG 1.20 3.26E?04 1.23E?03 GOLGA1 1.20 4.92E?03 9.88E?03 CD164 1.20 1.16E?03 3.18E?03 FBXO11 1.20 1.29E?03 3.45E?03 RGP1 1.20 1.62E?04 7.50E?04 AKAP13 1.20 4.87E?05 3.31E?04 UGDH-AS1 1.20 5.04E?04 1.71E?03 ZPR1 1.20 6.54E?04 2.07E?03 CAST 1.20 3.73E?04 1.36E?03 SPCS3 1.20 2.16E?03 5.16E?03 NR1H2 1.20 1.87E?04 8.26E?04 RRBP1 1.20 1.63E?05 1.68E?04 C6orf1 1.20 8.56E?04 2.51E?03 IGBP1 1.20 4.01E?03 8.43E?03 REEP5 1.20 9.70E?04 2.77E?03 FAH 1.20 2.78E?03 6.31E?03 PDPK1 1.19 1.47E?03 3.82E?03 MOV10 1.19 3.18E?03 7.05E?03 SLC20A1 1.19 1.08E?04 5.68E?04 MSL2 1.19 9.27E?05 5.15E?04 IKBKB 1.19 4.35E?03 8.98E?03 NSMAF 1.19 7.28E?04 2.23E?03 ARHGEF1 1.19 2.13E?04 9.01E?04 TMEM59 1.19 2.83E?03 6.39E?03 SPRED2 1.19 2.54E?03 5.88E?03 GNB1 1.19 7.93E?05 4.61E?04 KBTBD2 1.19 2.78E?03 6.31E?03 FAT1 1.19 2.55E?04 1.03E?03 MEX3C 1.19 1.26E?03 3.40E?03 ERAP1 1.19 2.77E?03 6.29E?03 CACYBP 1.19 2.91E?04 1.13E?03 AP1B1 1.19 9.55E?05 5.27E?04 FAM222B 1.18 9.00E?04 2.61E?03 VIM 1.18 9.83E?05 5.37E?04 EXOC2 1.18 1.90E?03 4.67E?03 PTTG1IP 1.18 1.34E?03 3.57E?03 TERF2IP 1.18 1.17E?04 5.98E?04 C6orf89 1.18 1.18E?03 3.23E?03 CAP1 1.18 1.28E?04 6.36E?04 NIN 1.18 4.11E?03 8.60E?03 INF2 1.18 4.42E?03 9.10E?03 RPS6KA4 1.18 1.67E?03 4.24E?03 RC3H2 1.18 2.25E?03 5.33E?03 SND1 1.18 1.76E?04 7.92E?04 HTATIP2 1.18 3.24E?03 7.14E?03 NEK7 1.18 4.99E?04 1.70E?03 SSR3 1.18 4.73E?05 3.26E?04 DPY19L1 1.18 4.09E?04 1.46E?03 FAM234A 1.18 1.44E?03 3.77E?03 TNK2 1.18 4.07E?04 1.45E?03 SEMA7A 1.18 3.77E?04 1.37E?03 EDEM2 1.18 1.39E?03 3.65E?03 PPM1A 1.17 2.20E?03 5.23E?03 ATP6V1A 1.17 9.16E?05 5.11E?04 ZNF707 1.17 1.05E?03 2.95E?03 EDEM3 1.17 1.38E?03 3.64E?03 KCTD5 1.17 5.83E?04 1.90E?03 PDCD10 1.17 3.74E?03 7.98E?03 TMEM208 1.17 7.01E?04 2.18E?03 YKT6 1.17 6.69E?04 2.11E?03 HEXA 1.17 4.82E?03 9.72E?03 DYRK3 1.17 1.54E?03 3.97E?03 ARPC5L 1.17 5.65E?05 3.67E?04 DRAM1 1.17 4.92E?03 9.87E?03 ERLEC1 1.17 2.27E?03 5.37E?03 TBCEL 1.17 2.40E?03 5.60E?03 UBA1 1.17 2.74E?06 6.08E?05 ARF4 1.17 8.77E?04 2.56E?03 LCMT2 1.17 4.45E?03 9.14E?03 STK4 1.17 3.77E?03 8.02E?03 SLC35E1 1.17 3.64E?04 1.34E?03 YIF1A 1.17 2.44E?03 5.69E?03 RPLP1 1.17 2.34E?05 2.07E?04 COPA 1.17 3.82E?05 2.84E?04 TNKS 1.16 2.46E?03 5.74E?03 ESRRA 1.16 4.00E?03 8.43E?03 METTL23 1.16 2.83E?03 6.39E?03 DESI2 1.16 2.20E?04 9.21E?04 MKRN1 1.16 1.82E?03 4.50E?03 TMC01 1.16 4.46E?04 1.56E?03 MIA3 1.16 3.26E?03 7.17E?03 AP5Z1 1.16 4.78E?03 9.65E?03 LYPLA2 1.16 5.01E?04 1.70E?03 NUCB1 1.16 1.70E?04 7.75E?04 IGF2R 1.16 2.17E?06 5.42E?05 CCPG1 1.16 4.96E?03 9.94E?03 IKBIP 1.16 3.49E?03 7.57E?03 ERBIN 1.16 3.87E?03 8.21E?03 BCR 1.16 2.65E?03 6.07E?03 ZNF598 1.16 1.68E?03 4.25E?03 AHNAK 1.16 1.77E?03 4.41E?03 SPTBN1 1.16 2.29E?04 9.47E?04 TMBIM6 1.16 1.39E?06 4.43E?05 CSNK1A1 1.16 5.78E?04 1.89E?03 FLYWCH1 1.16 4.60E?03 9.36E?03 TIMM10B 1.16 3.58E?03 7.70E?03 CEP170 1.16 7.70E?04 2.32E?03 RAP1GDS1 1.16 4.97E?03 9.95E?03 DALRD3 1.16 6.38E?04 2.03E?03 ARPP19 1.16 1.40E?03 3.67E?03 RNF13 1.16 1.04E?03 2.93E?03 INTS7 1.16 6.79E?04 2.13E?03 SNAP23 1.16 3.24E?03 7.14E?03 CYB5R3 1.16 3.87E?04 1.40E?03 MIA 1.16 3.49E?03 7.57E?03 ATP6V0B 1.15 1.09E?03 3.02E?03 NOP9 1.15 1.24E?04 6.24E?04 SNHG6 1.15 2.33E?04 9.61E?04 TMEM184B 1.15 1.86E?03 4.59E?03 MED15 1.15 4.57E?03 9.32E?03 TRIM11 1.15 8.84E?04 2.57E?03 MAEA 1.15 2.08E?03 5.00E?03 INPPL1 1.15 1.55E?05 1.64E?04 GNB5 1.15 1.89E?04 8.32E?04 NOMO1 1.15 1.71E?03 4.31E?03 ATP6V0C 1.15 4.40E?03 9.07E?03 PURB 1.15 5.59E?04 1.84E?03 GNB2 1.15 3.98E?05 2.91E?04 PCSK7 1.15 4.65E?03 9.44E?03 WASF2 1.15 6.40E?04 2.04E?03 SLC25A4 1.15 1.47E?03 3.82E?03 TMED7 1.15 3.39E?05 2.64E?04 SMARCAL1 1.15 1.78E?04 7.96E?04 DBNL 1.15 3.47E?03 7.53E?03 KIDINS220 1.14 3.57E?03 7.68E?03 TMEM189 1.14 1.03E?03 2.90E?03 SEC61A1 1.14 1.28E?04 6.37E?04 PNPLA2 1.14 9.43E?04 2.71E?03 RPL3 1.14 2.16E?05 1.97E?04 CDKN1B 1.14 3.99E?03 8.42E?03 FIBP 1.14 1.54E?05 1.64E?04 NFE2L1 1.14 9.82E?05 5.37E?04 STUB1 1.14 8.96E?04 2.60E?03 PIGT 1.14 4.66E?04 1.62E?03 YRDC 1.14 5.23E?04 1.75E?03 MICALL1 1.14 2.67E?04 1.06E?03 TPT1 1.14 1.69E?04 7.73E?04 PTK2 1.14 2.70E?03 6.16E?03 ACVR1 1.14 4.60E?03 9.37E?03 NENF 1.14 1.38E?03 3.63E?03 GPAA1 1.14 3.09E?04 1.18E?03 RNF14 1.14 1.70E?04 7.74E?04 COX6B1 1.14 7.09E?04 2.19E?03 AMPD2 1.14 4.41E?03 9.08E?03 MFSD10 1.14 3.67E?03 7.86E?03 MAP4K4 1.14 5.30E?05 3.50E?04 BAG1 1.14 3.91E?04 1.41E?03 EPM2AIP1 1.14 4.56E?03 9.32E?03 EHBP1L1 1.14 7.18E?04 2.21E?03 RNF4 1.14 4.32E?03 8.93E?03 CPE 1.14 2.25E?04 9.37E?04 PYGL 1.14 7.14E?04 2.20E?03 P3H4 1.13 2.27E?03 5.37E?03 BLOC1S6 1.13 1.53E?03 3.96E?03 TMEM259 1.13 7.14E?04 2.20E?03 PIP4K2B 1.13 2.44E?03 5.68E?03 DNAJC5 1.13 5.20E?05 3.46E?04 NORAD 1.13 9.37E?04 2.70E?03 ERRFI1 1.13 6.36E?04 2.03E?03 STARD3 1.13 3.26E?03 7.18E?03 TRIM32 1.13 4.88E?03 9.82E?03 BET1L 1.13 1.27E?03 3.41E?03 MORF4L2 1.13 7.04E?05 4.26E?04 ATP6V1H 1.13 2.58E?03 5.95E?03 FAM199X 1.13 1.18E?03 3.23E?03 GYG1 1.13 4.25E?03 8.83E?03 ACTR3 1.13 1.65E?03 4.18E?03 PRR12 1.13 1.31E?04 6.46E?04 FAM127B 1.13 2.71E?03 6.19E?03 NCSTN 1.13 1.75E?03 4.37E?03 ECE1 1.12 4.19E?04 1.48E?03 C12orf49 1.12 2.62E?03 6.02E?03 MYO1E 1.12 1.39E?03 3.66E?03 C11orf24 1.12 4.65E?04 1.61E?03 CDK5RAP2 1.12 3.40E?03 7.41E?03 RANGAP1 1.12 8.93E?04 2.59E?03 ACO1 1.12 8.31E?04 2.45E?03 TMED9 1.12 2.98E?04 1.15E?03 LRRC75A-AS1 1.12 4.15E?03 8.67E?03 SEMA3B 1.12 4.57E?03 9.32E?03 YIPF3 1.12 1.19E?03 3.24E?03 FLII 1.12 5.06E?04 1.71E?03 CTBP1-AS2 1.12 4.51E?03 9.23E?03 VANGL1 1.12 3.01E?03 6.72E?03 RPL10 1.12 1.17E?04 5.98E?04 TFRC 1.12 2.11E?03 5.07E?03 GLB1 1.12 3.63E?03 7.78E?03 ACOT8 1.11 2.41E?03 5.64E?03 COPE 1.11 2.31E?03 5.44E?03 EIF2S3 1.11 3.51E?04 1.30E?03 DPP9 1.11 1.16E?03 3.18E?03 DCAF12 1.11 4.37E?03 9.02E?03 ISG20 1.11 7.21E?04 2.21E?03 CD276 1.11 3.26E?03 7.18E?03 PTPN23 1.11 3.13E?04 1.19E?03 PHRF1 1.11 3.30E?03 7.25E?03 MAVS 1.11 1.65E?03 4.18E?03 ITM2B 1.11 1.11E?04 5.78E?04 TPM3 1.11 1.21E?03 3.28E?03 LARP1 1.11 4.38E?04 1.54E?03 HOMER1 1.11 2.60E?03 5.98E?03 PFKP 1.11 2.28E?03 5.38E?03 G6PC3 1.11 2.44E?03 5.68E?03 CDK16 1.11 1.98E?03 4.82E?03 TM7SF3 1.11 3.16E?03 7.00E?03 NUDCD3 1.11 3.93E?03 8.32E?03 RPLPO 1.11 2.50E?04 1.02E?03 ARPC2 1.11 3.00E?03 6.69E?03 MCFD2 1.11 4.72E?03 9.56E?03 PRDX2 1.11 4.48E?03 9.19E?03 FBRS 1.11 5.16E?04 1.73E?03 YIPF2 1.10 4.55E?03 9.30E?03 CLPTM1 1.10 1.61E?03 4.10E?03 DYNLRB1 1.10 9.11E?04 2.63E?03 HM13 1.10 9.96E?04 2.84E?03 PRUNE 1.10 2.47E?03 5.75E?03 CD109 1.10 2.40E?03 5.61E?03 FBXO31 1.10 3.31E?03 7.27E?03 CDC42 1.10 4.39E?03 9.05E?03 SCAF11 1.10 7.70E?05 4.52E?04 SEC23B 1.10 4.60E?03 9.37E?03 ARF1 1.09 4.16E?04 1.48E?03 C16orf58 1.09 6.00E?04 1.93E?03 STX16 1.09 5.53E?04 1.83E?03 MARK2 1.09 2.11E?03 5.08E?03 RPL39 1.09 5.03E?04 1.71E?03 ASAP2 1.09 4.24E?03 8.81E?03 IGF1R 1.09 3.63E?03 7.79E?03 PAFAH2 1.09 5.97E?04 1.93E?03 URGCP 1.09 2.83E?03 6.39E?03 KMT2D 1.09 8.63E?04 2.52E?03 YWHAG 1.09 2.98E?03 6.67E?03 RERE 1.09 3.43E?03 7.45E?03 RPL13A 1.09 4.42E?04 1.55E?03 STT3A 1.08 8.60E?04 2.52E?03 ACTB 1.08 1.25E?04 6.29E?04 RPS20 1.08 4.70E?05 3.25E?04 TRAM1 1.08 4.14E?03 8.66E?03 EIF3F 1.08 4.16E?03 8.69E?03 ATRAID 1.08 7.28E?04 2.23E?03 CANX 1.08 4.65E?05 3.22E?04 RPS3 1.08 6.15E?04 1.98E?03 TRPC4AP 1.08 1.73E?03 4.34E?03 HRAS 1.07 3.07E?03 6.84E?03 RPS28 1.07 7.50E?04 2.28E?03 FAM96B 1.07 4.86E?03 9.78E?03 CASC4 1.07 3.20E?03 7.08E?03 PABPC1 1.07 1.72E?05 1.72E?04 ELK3 1.07 1.42E?04 6.82E?04 CDC37 1.07 1.08E?03 3.00E?03 CD63 1.06 3.53E?03 7.63E?03 JAK1 1.06 3.40E?03 7.41E?03 MTAP 1.06 1.78E?03 4.43E?03 UGGT1 1.06 1.79E?03 4.45E?03 CHTF8 1.06 1.80E?03 4.47E?03 TGOLN2 1.05 1.73E?03 4.35E?03 PEA15 1.05 2.16E?03 5.16E?03 PPIB 1.05 3.43E?03 7.45E?03 P4HB 1.05 1.92E?03 4.71E?03 ATG13 1.05 1.60E?03 4.09E?03 SLC6A8 1.05 1.73E?03 4.34E?03 NRAS 1.04 4.03E?03 8.47E?03 STK25 1.04 4.89E?03 9.83E?03 RPL17 0.96 2.46E?03 5.74E?03 RGL2 0.96 3.76E?03 8.01E?03 NDUFB11 0.96 3.07E?03 6.83E?03 EIF4A1 0.96 5.09E?04 1.72E?03 HMGXB3 0.96 9.41E?05 5.21E?04 MCAM 0.95 5.65E?04 1.85E?03 ATP2A2 0.95 1.00E?03 2.85E?03 RPL4 0.95 3.19E?04 1.20E?03 RPL7 0.95 2.38E?03 5.57E?03 RPSA 0.95 4.45E?03 9.14E?03 EIF3A 0.95 3.88E?03 8.22E?03 LDOCIL 0.95 4.18E?03 8.71E?03 PSMD8 0.95 4.26E?03 8.85E?03 LETM1 0.95 4.48E?03 9.19E?03 GAPDH 0.95 1.12E?03 3.09E?03 EIF3G 0.95 2.92E?03 6.56E?03 FAU 0.94 3.64E?03 7.80E?03 PFN1 0.94 4.79E?04 1.65E?03 ATP5H 0.94 2.70E?03 6.16E?03 AHSA1 0.94 2.10E?04 8.95E?04 DDX23 0.94 2.85E?03 6.44E?03 2-Sep 0.94 1.32E?03 3.51E?03 RPS7 0.94 8.49E?04 2.49E?03 SLC25A3 0.94 6.46E?04 2.05E?03 EIF4H 0.94 1.34E?04 6.56E?04 EIF1AX 0.94 4.83E?03 9.74E?03 COPS6 0.93 2.43E?03 5.67E?03 PRKCI 0.93 1.46E?03 3.81E?03 TAF7 0.93 1.29E?03 3.45E?03 B4GALT5 0.93 4.40E?03 9.07E?03 PAIP1 0.93 2.12E?03 5.09E?03 RPL18 0.93 3.64E?03 7.80E?03 ACTRIA 0.93 2.57E?03 5.93E?03 COPS8 0.93 2.91E?04 1.13E?03 HINT1 0.93 4.98E?05 3.35E?04 DCTN1 0.93 1.81E?03 4.49E?03 DIAPH1 0.93 3.67E?03 7.85E?03 ZMYM4 0.93 1.18E?03 3.22E?03 LRRC59 0.93 3.35E?05 2.63E?04 GNPAT 0.93 1.08E?03 3.01E?03 C6orf106 0.93 1.04E?03 2.93E?03 BCAR1 0.93 3.49E?04 1.29E?03 CHERP 0.93 2.74E?03 6.24E?03 EIF5 0.93 4.62E?03 9.40E?03 RPS24 0.93 1.61E?04 7.48E?04 LDHB 0.93 2.64E?03 6.06E?03 C11orf58 0.93 3.56E?03 7.66E?03 ARFGAP1 0.92 1.37E?04 6.68E?04 RETSAT 0.92 2.12E?03 5.09E?03 DTD1 0.92 3.44E?04 1.28E?03 PDIA3 0.92 1.42E?03 3.72E?03 RPL30 0.92 3.36E?04 1.26E?03 TMEM230 0.92 1.00E?03 2.85E?03 CD74 0.92 3.99E?05 2.91E?04 CTDNEP1 0.92 4.42E?03 9.09E?03 HDLBP 0.92 6.99E?05 4.25E?04 PDIA6 0.92 9.91E?04 2.82E?03 GTF3C1 0.92 3.72E?04 1.36E?03 CLOCK 0.92 1.44E?03 3.76E?03 BRD2 0.92 2.78E?03 6.32E?03 RNH1 0.92 4.54E?03 9.29E?03 KAT6A 0.92 4.78E?03 9.65E?03 CSDE1 0.92 1.87E?03 4.60E?03 ACP2 0.92 3.73E?04 1.36E?03 PRPF6 0.92 1.79E?04 8.00E?04 CCDC97 0.92 2.64E?03 6.06E?03 RPN1 0.92 8.01E?04 2.39E?03 C1orf159 0.92 3.22E?03 7.11E?03 RPL6 0.92 6.47E?05 4.03E?04 CIAO1 0.92 1.63E?03 4.15E?03 PSMA7 0.92 2.69E?04 1.07E?03 CUL4A 0.92 2.65E?03 6.07E?03 MAGEA3 0.92 3.14E?03 6.97E?03 BAD 0.92 4.53E?03 9.27E?03 NCK2 0.92 3.41E?03 7.43E?03 NHP2 0.92 2.15E?04 9.04E?04 YTHDF2 0.92 2.26E?03 5.36E?03 ATN1 0.92 6.51E?04 2.06E?03 ESYT1 0.92 4.56E?05 3.17E?04 AKAP1 0.92 9.19E?04 2.65E?03 CCNY 0.92 2.58E?03 5.94E?03 TRAFD1 0.91 9.85E?04 2.81E?03 CIZ1 0.91 1.37E?03 3.61E?03 RPL15 0.91 2.18E?04 9.17E?04 NOLC1 0.91 4.59E?03 9.36E?03 PRELID1 0.91 3.16E?04 1.20E?03 CCT7 0.91 9.63E?05 5.29E?04 ATF4 0.91 4.85E?03 9.76E?03 RPL23A 0.91 1.08E?04 5.69E?04 MRPL10 0.91 1.01E?04 5.49E?04 DAP3 0.91 2.02E?03 4.90E?03 SMG5 0.91 4.86E?03 9.78E?03 GCN1 0.91 5.85E?05 3.76E?04 PDCD11 0.91 4.41E?05 3.10E?04 LAMP1 0.91 7.60E?05 4.48E?04 CPT2 0.91 3.38E?03 7.38E?03 MRPS7 0.91 2.95E?03 6.61E?03 DYRK1B 0.91 3.96E?03 8.36E?03 NCOA4 0.91 2.48E?03 5.76E?03 NIPA2 0.91 4.61E?03 9.38E?03 CHMP7 0.91 8.01E?04 2.39E?03 ZNF638 0.91 1.66E?03 4.20E?03 PITPNM1 0.91 6.21E?04 1.99E?03 CIAPIN1 0.91 1.31E?03 3.50E?03 NELFB 0.91 1.44E?03 3.75E?03 TUFM 0.91 1.08E?03 3.02E?03 WDR83OS 0.91 1.21E?03 3.29E?03 HCFC1 0.91 3.37E?03 7.36E?03 USP14 0.91 1.60E?03 4.10E?03 CASC3 0.91 2.98E?04 1.15E?03 SDHC 0.91 2.06E?03 4.98E?03 RCC2 0.91 4.21E?03 8.77E?03 FEM1B 0.90 7.01E?04 2.18E?03 NCAPH2 0.90 3.89E?03 8.24E?03 CCAR2 0.90 1.96E?03 4.79E?03 LAMTOR1 0.90 1.76E?03 4.39E?03 CYCS 0.90 2.18E?03 5.20E?03 DNM2 0.90 3.99E?03 8.42E?03 AXL 0.90 1.71E?03 4.30E?03 USP22 0.90 1.34E?03 3.56E?03 SH3GL1 0.90 8.86E?04 2.58E?03 SYNCRIP 0.90 1.08E?03 3.01E?03 BSG 0.90 1.89E?03 4.65E?03 RBM4 0.90 5.52E?04 1.83E?03 CEP250 0.90 3.34E?06 6.66E?05 KIAA0141 0.90 4.45E?03 9.14E?03 ALDOA 0.90 9.24E?05 5.14E?04 SBNO1 0.90 4.83E?03 9.73E?03 RABL6 0.90 1.38E?05 1.55E?04 PLEKHO2 0.90 4.74E?03 9.58E?03 HEXB 0.90 4.21E?03 8.76E?03 EID1 0.90 1.69E?03 4.26E?03 NDUFA11 0.90 2.49E?03 5.77E?03 NUP214 0.90 1.88E?03 4.62E?03 UBAP2L 0.90 2.54E?03 5.87E?03 ABCD1 0.90 3.73E?03 7.96E?03 ATAD3A 0.90 4.75E?05 3.26E?04 SNRPN 0.90 1.45E?03 3.78E?03 HUWE1 0.90 5.13E?05 3.42E?04 BZW1 0.90 3.34E?03 7.31E?03 ATP1A1 0.90 1.16E?04 5.91E?04 PTGES2 0.90 1.32E?03 3.53E?03 TMEM261 0.90 2.07E?03 4.99E?03 PC 0.90 1.88E?03 4.63E?03 FUBP3 0.90 2.28E?03 5.40E?03 RPL24 0.90 2.07E?04 8.85E?04 ZMYND8 0.90 2.06E?03 4.98E?03 NACA 0.90 2.54E?04 1.03E?03 CPSF1 0.90 2.92E?03 6.56E?03 TARS2 0.90 4.18E?03 8.72E?03 PARK7 0.90 4.29E?03 8.89E?03 H1F0 0.90 2.88E?03 6.49E?03 PQBP1 0.90 3.25E?03 7.16E?03 SF3B2 0.90 2.20E?03 5.24E?03 KDM3B 0.90 3.69E?04 1.35E?03 STAG2 0.90 1.68E?03 4.24E?03 EIF3I 0.90 5.59E?07 2.68E?05 SNRNP200 0.90 2.66E?04 1.06E?03 CDK2AP1 0.90 4.29E?03 8.90E?03 PPM1G 0.90 5.42E?04 1.80E?03 GHITM 0.90 3.68E?04 1.35E?03 KMT2C 0.90 4.12E?03 8.62E?03 ARIH2 0.90 5.53E?05 3.61E?04 VKORC1 0.90 4.66E?03 9.46E?03 KPNA3 0.89 3.29E?05 2.59E?04 ANO8 0.89 3.43E?03 7.45E?03 TDG 0.89 1.03E?03 2.89E?03 BUB3 0.89 1.79E?03 4.46E?03 MRPS2 0.89 2.75E?03 6.26E?03 PAIP2 0.89 2.46E?03 5.74E?03 SLC39A1 0.89 4.66E?04 1.62E?03 OSBPL9 0.89 2.71E?03 6.17E?03 SH3KBP1 0.89 2.98E?03 6.66E?03 C20orf24 0.89 1.10E?03 3.06E?03 PPP6R3 0.89 1.95E?04 8.49E?04 ACSL3 0.89 2.12E?04 8.98E?04 ADD1 0.89 2.47E?03 5.75E?03 ZMIZ2 0.89 4.50E?03 9.22E?03 HEG1 0.89 4.99E?03 1.00E?02 PWP1 0.89 1.04E?03 2.92E?03 PPP4C 0.89 2.12E?04 8.98E?04 LRRFIP2 0.89 3.05E?03 6.78E?03 OPA1 0.89 3.92E?03 8.30E?03 MEN1 0.89 1.26E?03 3.39E?03 RSAD1 0.89 3.49E?03 7.56E?03 MFN2 0.89 2.88E?04 1.12E?03 TFE3 0.89 3.48E?05 2.68E?04 DNAJA2 0.89 7.06E?04 2.19E?03 HNRNPUL2 0.89 1.74E?03 4.35E?03 EZR 0.89 3.54E?03 7.63E?03 CDK8 0.89 1.25E?03 3.38E?03 LIPA 0.89 3.75E?03 7.99E?03 VARS 0.89 3.96E?03 8.36E?03 ACOX1 0.89 4.41E?03 9.09E?03 RNPS1 0.89 6.85E?04 2.14E?03 CHEK1 0.89 7.77E?04 2.33E?03 VGF 0.89 1.11E?03 3.07E?03 MAGEA6 0.89 3.43E?03 7.45E?03 MRPL3 0.89 1.82E?03 4.50E?03 EIF2S1 0.89 9.90E?04 2.82E?03 TOMM5 0.89 2.67E?03 6.11E?03 LOC101927556 0.89 6.80E?04 2.13E?03 SARIA 0.89 7.51E?04 2.28E?03 CISD3 0.89 8.35E?04 2.46E?03 DARS 0.89 2.72E?04 1.07E?03 SRA1 0.89 2.33E?03 5.47E?03 AZI2 0.89 1.92E?03 4.70E?03 GPS1 0.89 3.53E?03 7.63E?03 TMEM214 0.89 3.27E?03 7.19E?03 CARHSP1 0.89 1.34E?03 3.57E?03 HSP90AB1 0.89 7.43E?06 1.08E?04 CSNK1G2 0.89 1.93E?03 4.73E?03 LRWD1 0.89 4.81E?03 9.70E?03 PHB2 0.89 4.46E?03 9.15E?03 GSS 0.89 1.41E?03 3.69E?03 PPP1R37 0.89 8.65E?04 2.53E?03 SUMO2 0.89 1.21E?03 3.28E?03 STK3 0.89 4.38E?03 9.04E?03 CPSF7 0.89 2.97E?03 6.65E?03 CHP1 0.88 2.40E?05 2.10E?04 SFRP1 0.88 6.41E?04 2.04E?03 PSMD4 0.88 9.87E?04 2.81E?03 TOP1MT 0.88 2.18E?03 5.21E?03 CHCHD3 0.88 7.46E?04 2.27E?03 NADK 0.88 7.45E?04 2.26E?03 SPOP 0.88 2.28E?04 9.46E?04 AAGAB 0.88 3.14E?03 6.97E?03 CLTC 0.88 2.24E?05 2.02E?04 DNAJA1 0.88 1.91E?03 4.68E?03 RPL36AL 0.88 2.77E?03 6.29E?03 CAPRIN1 0.88 4.62E?05 3.21E?04 FUZ 0.88 4.65E?03 9.45E?03 DNAJB6 0.88 2.34E?03 5.51E?03 DR1 0.88 3.44E?04 1.28E?03 ATP5B 0.88 1.91E?05 1.82E?04 CREB3L2 0.88 2.22E?03 5.27E?03 APP 0.88 2.11E?05 1.94E?04 HDAC3 0.88 1.60E?03 4.10E?03 IQCE 0.88 3.85E?04 1.39E?03 SNTB2 0.88 2.88E?03 6.49E?03 EML3 0.88 3.01E?04 1.15E?03 SMARCC2 0.88 9.86E?04 2.81E?03 UXT 0.88 8.64E?04 2.52E?03 RAD23B 0.88 2.22E?03 5.28E?03 MED16 0.88 4.38E?03 9.04E?03 MCM3AP 0.88 3.13E?05 2.52E?04 EIF4G1 0.88 6.37E?04 2.03E?03 PCBP1 0.88 3.20E?05 2.55E?04 RBM28 0.88 3.79E?03 8.07E?03 AGAP3 0.88 3.68E?03 7.87E?03 EGLN1 0.88 2.01E?03 4.88E?03 PSMD11 0.88 2.06E?03 4.98E?03 PIGS 0.88 8.30E?04 2.45E?03 CDC42BPA 0.88 2.84E?03 6.41E?03 UTP6 0.88 1.96E?04 8.51E?04 POLR2B 0.88 2.08E?04 8.89E?04 MCTS1 0.88 4.91E?03 9.86E?03 WDR61 0.88 2.30E?03 5.42E?03 SRP72 0.88 1.93E?03 4.73E?03 ADNP2 0.88 4.63E?03 9.42E?03 NRDC 0.88 7.00E?04 2.17E?03 DPYSL2 0.88 2.38E?03 5.57E?03 NUBP1 0.88 8.38E?04 2.47E?03 HNRNPUL1 0.88 4.64E?05 3.22E?04 SLIRP 0.88 3.16E?03 7.01E?03 USP16 0.87 2.71E?03 6.17E?03 GTF3C2 0.87 4.92E?03 9.88E?03 SON 0.87 1.65E?03 4.18E?03 FAM136A 0.87 4.01E?03 8.43E?03 RAB8A 0.87 4.28E?03 8.87E?03 CCSAP 0.87 2.95E?03 6.61E?03 SRSF9 0.87 7.65E?04 2.31E?03 UBE2G2 0.87 8.03E?04 2.39E?03 HMG20A 0.87 3.32E?03 7.28E?03 SCAMP4 0.87 1.44E?04 6.88E?04 TFCP2 0.87 2.14E?03 5.13E?03 COPB2 0.87 8.94E?04 2.60E?03 MTCH2 0.87 3.27E?03 7.18E?03 CNBP 0.87 1.57E?04 7.36E?04 HIRA 0.87 1.16E?03 3.18E?03 PLPP2 0.87 2.29E?04 9.48E?04 SPAG7 0.87 4.98E?03 9.98E?03 SRM 0.87 4.18E?04 1.48E?03 OAZ2 0.87 1.35E?03 3.59E?03 CLIC1 0.87 7.25E?04 2.22E?03 U2AF2 0.87 8.75E?05 4.95E?04 CYC1 0.87 2.11E?04 8.95E?04 ENSA 0.87 4.51E?03 9.23E?03 IGF2BP2 0.87 3.41E?03 7.43E?03 KARS 0.87 1.36E?04 6.67E?04 MRPL51 0.87 2.88E?03 6.49E?03 PSENEN 0.87 3.03E?03 6.75E?03 TRAK1 0.87 2.90E?03 6.53E?03 ZNF207 0.87 1.96E?05 1.86E?04 PKM 0.87 1.51E?05 1.61E?04 CNPY2 0.87 3.24E?04 1.22E?03 BBS4 0.87 2.02E?03 4.90E?03 USP10 0.87 3.39E?03 7.38E?03 TRIP10 0.87 6.96E?04 2.17E?03 FBXO21 0.87 5.24E?04 1.75E?03 PLAA 0.87 2.90E?03 6.54E?03 VPRBP 0.87 1.47E?03 3.82E?03 DDX20 0.87 4.02E?03 8.45E?03 FAM120A 0.87 2.00E?05 1.87E?04 SAMM50 0.87 1.52E?03 3.93E?03 SENP3 0.87 6.50E?04 2.06E?03 ADCY6 0.87 4.51E?03 9.24E?03 GDE1 0.87 8.67E?04 2.53E?03 PSMD13 0.87 1.98E?04 8.57E?04 CSNK2A1 0.87 5.30E?04 1.77E?03 EIF2AK4 0.87 8.38E?04 2.47E?03 PHF20 0.87 3.99E?05 2.91E?04 ATP2B1 0.87 3.55E?03 7.64E?03 C11orf31 0.87 8.26E?05 4.74E?04 TUT1 0.87 2.39E?03 5.59E?03 NOC2L 0.87 7.37E?05 4.39E?04 C14orf166 0.87 1.55E?03 3.99E?03 HMGA1 0.87 2.59E?05 2.21E?04 CUL1 0.87 5.87E?04 1.91E?03 UPF3A 0.87 2.69E?03 6.15E?03 GSPT1 0.87 2.37E?03 5.56E?03 PSMB1 0.87 4.96E?06 8.44E?05 AHCYL1 0.87 3.83E?04 1.39E?03 ESYT2 0.87 2.86E?05 2.38E?04 VDAC1 0.87 2.99E?04 1.15E?03 GNG12 0.87 5.71E?07 2.69E?05 RPL5 0.87 3.87E?05 2.86E?04 RARS 0.87 1.95E?03 4.76E?03 PPM1B 0.87 3.00E?04 1.15E?03 DDX3X 0.87 6.85E?04 2.14E?03 SUMO1 0.87 2.29E?03 5.40E?03 TNPO3 0.87 1.40E?03 3.68E?03 PIK3R1 0.87 7.13E?04 2.20E?03 C5orf15 0.87 1.56E?03 4.01E?03 ARFGAP2 0.87 3.35E?04 1.25E?03 G6PD 0.87 4.43E?05 3.10E?04 PAM 0.87 1.49E?03 3.87E?03 SERPINB6 0.87 3.24E?03 7.14E?03 RNF40 0.86 2.86E?05 2.38E?04 MRPS34 0.86 4.45E?03 9.14E?03 SLC4A2 0.86 7.92E?04 2.37E?03 ARL2 0.86 2.73E?03 6.22E?03 ELP2 0.86 2.72E?03 6.21E?03 YY1 0.86 9.61E?04 2.75E?03 HNRNPA1 0.86 9.70E?05 5.32E?04 WDR43 0.86 1.00E?03 2.85E?03 DUT 0.86 1.38E?03 3.63E?03 RPS26 0.86 1.86E?04 8.24E?04 ZNF395 0.86 4.16E?03 8.68E?03 MSTO1 0.86 4.31E?03 8.91E?03 PPHLN1 0.86 2.47E?03 5.74E?03 KIAA1429 0.86 1.19E?03 3.24E?03 CREBBP 0.86 2.23E?03 5.29E?03 EIF1B 0.86 2.31E?03 5.45E?03 CHRAC1 0.86 1.16E?03 3.18E?03 PHLDA3 0.86 2.51E?04 1.02E?03 REPIN1 0.86 1.56E?03 4.02E?03 SHFM1 0.86 3.49E?03 7.57E?03 COX20 0.86 4.95E?03 9.92E?03 POLR2K 0.86 2.38E?03 5.57E?03 NFATC3 0.86 4.24E?04 1.50E?03 MGA 0.86 2.98E?03 6.66E?03 ENTPD6 0.86 2.01E?04 8.64E?04 RNASEH2C 0.86 2.80E?03 6.34E?03 C17orf80 0.86 2.12E?03 5.09E?03 TRA2A 0.86 2.79E?03 6.32E?03 UBE2N 0.86 1.28E?04 6.37E?04 TNRC18 0.86 2.48E?03 5.76E?03 EI24 0.86 8.07E?04 2.40E?03 ABCD3 0.86 1.60E?03 4.09E?03 IARS 0.86 1.64E?05 1.68E?04 UBE20 0.86 1.40E?03 3.67E?03 SUPT7L 0.86 1.73E?03 4.34E?03 GOT2 0.86 1.16E?05 1.40E?04 PSMA6 0.86 1.01E?03 2.87E?03 COPS2 0.86 1.81E?03 4.48E?03 PSMC1 0.86 2.20E?03 5.23E?03 DDX50 0.86 2.08E?03 5.00E?03 SLBP 0.86 2.04E?03 4.93E?03 TEAD1 0.86 3.30E?03 7.24E?03 GPBP1 0.86 1.04E?04 5.59E?04 CNP 0.86 1.41E?05 1.57E?04 CLUH 0.86 5.99E?04 1.93E?03 APIS 0.86 2.24E?04 9.34E?04 UBE2M 0.86 7.96E?04 2.38E?03 CCDC47 0.86 2.22E?03 5.28E?03 FXR1 0.86 3.80E?03 8.08E?03 RPUSD2 0.86 2.53E?03 5.86E?03 CAND1 0.86 5.56E?04 1.83E?03 SHMT2 0.86 2.54E?04 1.03E?03 COLGALT1 0.86 6.62E?05 4.08E?04 DHX40 0.86 7.68E?04 2.32E?03 TRMT10C 0.86 8.70E?04 2.54E?03 PHF14 0.86 2.40E?03 5.62E?03 ZNF106 0.86 3.35E?04 1.25E?03 CS 0.86 2.64E?04 1.05E?03 PSMD7 0.86 4.55E?04 1.58E?03 URM1 0.86 3.26E?03 7.17E?03 LSM12 0.86 1.82E?05 1.77E?04 TRUB2 0.86 2.95E?03 6.61E?03 LONP1 0.86 1.87E?04 8.26E?04 MED1 0.86 8.25E?04 2.44E?03 PLCD3 0.86 1.63E?03 4.15E?03 TRIM28 0.86 4.44E?05 3.11E?04 ATP5G1 0.86 4.91E?03 9.86E?03 ATP50 0.86 2.69E?04 1.07E?03 SDHA 0.86 2.87E?04 1.12E?03 NF1 0.86 3.15E?03 6.98E?03 UBE2K 0.86 1.76E?04 7.91E?04 PRKACA 0.86 9.75E?04 2.79E?03 NDUFB9 0.86 3.45E?05 2.67E?04 YME1L1 0.86 6.81E?04 2.13E?03 CPNE1 0.86 4.33E?03 8.94E?03 NELFA 0.86 2.06E?04 8.82E?04 MICU1 0.86 1.04E?03 2.92E?03 GPI 0.85 1.21E?04 6.12E?04 TOP1 0.85 1.44E?05 1.57E?04 ARMC8 0.85 3.62E?03 7.76E?03 GEMIN4 0.85 5.10E?04 1.72E?03 COPG2 0.85 3.52E?03 7.61E?03 ATP5G2 0.85 2.45E?04 1.00E?03 YBX1 0.85 3.78E?06 7.17E?05 DDX54 0.85 2.08E?04 8.88E?04 RRN3 0.85 2.08E?04 8.89E?04 WAC 0.85 6.15E?04 1.98E?03 RYK 0.85 8.09E?05 4.67E?04 CPSF6 0.85 5.05E?05 3.38E?04 PSMD1 0.85 4.40E?03 9.06E?03 TPRKB 0.85 5.35E?04 1.78E?03 PDIA4 0.85 8.41E?05 4.81E?04 CT45A1 0.85 4.93E?03 9.89E?03 TBRG4 0.85 5.74E?05 3.71E?04 TCAIM 0.85 2.64E?03 6.06E?03 BYSL 0.85 3.76E?04 1.37E?03 7-Sep 0.85 1.82E?03 4.50E?03 PSMA5 0.85 1.55E?04 7.29E?04 PCCB 0.85 2.52E?03 5.84E?03 INO80 0.85 1.29E?03 3.46E?03 CSTF2T 0.85 4.72E?03 9.56E?03 TOMM70 0.85 1.09E?03 3.04E?03 PHC1 0.85 1.00E?03 2.84E?03 IPO8 0.85 8.48E?04 2.49E?03 MDH2 0.85 3.91E?05 2.88E?04 ZNF664 0.85 2.88E?04 1.12E?03 DHX29 0.85 1.93E?03 4.73E?03 TCTA 0.85 2.88E?03 6.50E?03 SEC11A 0.85 7.46E?05 4.43E?04 OBSL1 0.85 2.17E?03 5.18E?03 TPGS2 0.85 7.16E?04 2.21E?03 NUP153 0.85 2.25E?03 5.34E?03 SRRM1 0.85 1.36E?03 3.61E?03 ASF1A 0.85 2.55E?03 5.89E?03 DNAJA3 0.85 7.14E?04 2.20E?03 DOCK1 0.85 1.31E?03 3.50E?03 GTF2A2 0.85 1.32E?03 3.53E?03 WBSCR22 0.85 2.32E?03 5.47E?03 HNRNPK 0.85 9.85E?07 3.66E?05 SOX5 0.85 8.86E?04 2.58E?03 MRPS24 0.85 1.17E?03 3.21E?03 HNRNPAO 0.85 1.98E?04 8.58E?04 URB2 0.85 6.91E?04 2.16E?03 IGF2BP1 0.85 3.87E?05 2.86E?04 COMMD4 0.85 2.87E?05 2.38E?04 NOL6 0.85 1.42E?04 6.83E?04 RBBP7 0.85 6.59E?04 2.08E?03 UCHLS 0.85 2.82E?03 6.39E?03 C12orf10 0.85 8.89E?04 2.58E?03 PRKAR2A 0.85 3.08E?04 1.18E?03 ADI1 0.85 2.47E?03 5.74E?03 ENO1 0.85 2.63E?06 5.95E?05 PSMA1 0.85 1.08E?03 3.01E?03 COQ5 0.85 1.83E?03 4.51E?03 CBX5 0.85 1.37E?04 6.69E?04 SF1 0.85 3.39E?03 7.40E?03 GPHN 0.85 1.49E?03 3.86E?03 USP7 0.85 2.26E?04 9.40E?04 PELP1 0.85 2.38E?04 9.77E?04 SEC23IP 0.85 3.45E?04 1.28E?03 VKORC1L1 0.85 5.50E?04 1.82E?03 KHDRBS1 0.85 2.97E?04 1.15E?03 THOP1 0.85 6.84E?04 2.14E?03 SLC30A5 0.85 1.06E?03 2.98E?03 BTF3 0.85 5.47E?04 1.81E?03 CSTF1 0.85 1.73E?03 4.34E?03 GATC 0.85 1.68E?03 4.25E?03 AASDHPPT 0.85 4.74E?03 9.59E?03 AAR2 0.84 1.29E?04 6.38E?04 EIF2B5 0.84 3.34E?03 7.31E?03 SLC50A1 0.84 7.76E?05 4.55E?04 MCCC2 0.84 1.30E?04 6.42E?04 DHX30 0.84 5.62E?06 9.02E?05 MFSD14A 0.84 1.54E?03 3.97E?03 UMPS 0.84 3.30E?04 1.24E?03 RBM10 0.84 2.00E?03 4.86E?03 FAM118B 0.84 3.35E?03 7.32E?03 NOC4L 0.84 7.95E?04 2.38E?03 TRMT5 0.84 2.65E?03 6.08E?03 ADAM9 0.84 1.37E?03 3.62E?03 PAGR1 0.84 2.13E?04 9.00E?04 FAM63B 0.84 2.46E?03 5.74E?03 CCT8 0.84 1.20E?03 3.25E?03 NDUFB10 0.84 2.39E?03 5.58E?03 NDUFAB1 0.84 7.96E?04 2.38E?03 NUTF2 0.84 5.61E?04 1.84E?03 SNRPD2 0.84 4.02E?05 2.92E?04 NOB1 0.84 4.17E?04 1.48E?03 AKT2 0.84 1.42E?03 3.73E?03 MRPL34 0.84 4.87E?04 1.67E?03 USP6NL 0.84 5.95E?04 1.93E?03 ICE1 0.84 1.44E?03 3.75E?03 MAZ 0.84 1.16E?03 3.19E?03 LAMP2 0.84 1.21E?03 3.28E?03 PTBP1 0.84 5.08E?05 3.40E?04 THOC5 0.84 1.15E?03 3.15E?03 KIF3B 0.84 1.41E?04 6.81E?04 POM121C 0.84 1.04E?05 1.30E?04 GULP1 0.84 1.81E?03 4.48E?03 AHCTF1 0.84 9.30E?04 2.68E?03 HNRNPL 0.84 2.51E?05 2.16E?04 SERBP1 0.84 3.46E?05 2.68E?04 SRSF10 0.84 4.15E?03 8.67E?03 POM121 0.84 7.93E?04 2.37E?03 ATPSE 0.84 2.67E?04 1.06E?03 ETF1 0.84 2.39E?05 2.10E?04 ARNT2 0.84 1.68E?03 4.24E?03 DHX15 0.84 1.95E?03 4.76E?03 MRPL15 0.84 2.16E?03 5.16E?03 ZMIZ1 0.84 1.96E?04 8.52E?04 NSUN2 0.84 4.44E?03 9.13E?03 STOML2 0.84 4.09E?04 1.46E?03 CXorf56 0.84 1.45E?03 3.79E?03 MDN1 0.84 1.20E?04 6.08E?04 PTPN2 0.84 1.87E?03 4.60E?03 SF3B1 0.84 1.41E?04 6.80E?04 CHTOP 0.84 7.92E?04 2.37E?03 MSANTD4 0.84 8.03E?04 2.39E?03 DKC1 0.84 6.18E?04 1.98E?03 BAZ1B 0.84 4.84E?05 3.29E?04 RBM25 0.84 1.86E?03 4.58E?03 CCT2 0.84 9.67E?05 5.30E?04 AKT1S1 0.84 2.26E?04 9.37E?04 ELOF1 0.84 1.34E?04 6.58E?04 MED26 0.84 8.43E?04 2.48E?03 XPO7 0.84 1.68E?03 4.25E?03 NFXL1 0.84 1.07E?03 2.99E?03 COPZ1 0.84 4.33E?04 1.52E?03 LOC100288778 0.84 2.23E?03 5.29E?03 HNRNPAB 0.84 5.39E?04 1.79E?03 CUL3 0.84 6.93E?04 2.16E?03 SNRPD3 0.84 2.50E?03 5.79E?03 RAVER1 0.84 3.20E?05 2.55E?04 PDPR 0.84 1.58E?04 7.38E?04 HSPA8 0.84 1.54E?06 4.67E?05 MAP4K5 0.84 1.89E?03 4.65E?03 EPS15L1 0.84 1.10E?03 3.04E?03 CYB561 0.84 1.53E?03 3.96E?03 DSTN 0.84 4.97E?05 3.35E?04 THUMPD1 0.84 3.03E?03 6.76E?03 SLC39A14 0.84 2.31E?05 2.05E?04 CHD4 0.84 4.71E?06 8.20E?05 FANCG 0.84 3.43E?03 7.45E?03 CLK2 0.84 4.05E?03 8.49E?03 TYW1 0.84 4.82E?03 9.72E?03 PTOV1 0.84 3.53E?03 7.63E?03 CDC123 0.84 3.43E?04 1.28E?03 ING1 0.84 8.06E?04 2.40E?03 SRRM2 0.84 7.82E?05 4.57E?04 PRMT3 0.84 1.99E?03 4.85E?03 LOC613037 0.84 3.31E?03 7.26E?03 ACADVL 0.84 6.41E?04 2.04E?03 MSH6 0.84 7.52E?04 2.28E?03 PIK3R4 0.84 4.80E?05 3.27E?04 TOMM6 0.84 5.93E?04 1.92E?03 PDHB 0.84 1.70E?05 1.71E?04 MRPS27 0.84 1.86E?03 4.58E?03 ABHD12 0.84 1.04E?03 2.93E?03 HIF1A 0.84 1.23E?05 1.45E?04 BCKDHA 0.84 3.96E?03 8.36E?03 CASP7 0.84 7.41E?04 2.26E?03 SIKE1 0.84 4.28E?03 8.88E?03 VAV2 0.84 2.14E?04 9.04E?04 CLPB 0.84 2.20E?03 5.24E?03 AIMP1 0.84 3.71E?04 1.36E?03 PON2 0.84 7.08E?04 2.19E?03 NEMF 0.84 4.74E?03 9.59E?03 SRSF5 0.84 1.71E?03 4.30E?03 TUBB4B 0.84 1.87E?05 1.80E?04 CARM1 0.84 9.56E?04 2.74E?03 YY1AP1 0.83 2.64E?03 6.06E?03 DDX27 0.83 4.76E?04 1.64E?03 E2F1 0.83 4.79E?04 1.65E?03 RFX5 0.83 2.31E?04 9.53E?04 RPS6KA3 0.83 6.13E?05 3.88E?04 ATP5G3 0.83 4.84E?04 1.66E?03 CCNJL 0.83 1.01E?03 2.87E?03 UBN1 0.83 7.04E?05 4.26E?04 GTF2F1 0.83 2.24E?04 9.35E?04 PIP5K1A 0.83 1.20E?03 3.26E?03 NEK4 0.83 9.83E?04 2.81E?03 B4GAT1 0.83 3.13E?03 6.94E?03 TFDP2 0.83 2.54E?03 5.87E?03 CCT3 0.83 2.11E?04 8.95E?04 PI4KB 0.83 1.69E?04 7.71E?04 ERLIN1 0.83 8.16E?04 2.42E?03 HMGN1 0.83 4.25E?04 1.50E?03 SLC44A1 0.83 3.61E?03 7.76E?03 GCLC 0.83 3.33E?03 7.30E?03 BABAM1 0.83 1.08E?04 5.68E?04 CBX3 0.83 7.67E?04 2.32E?03 NOP58 0.83 1.67E?04 7.65E?04 BCS1L 0.83 1.30E?04 6.42E?04 SLC1A5 0.83 5.20E?04 1.74E?03 DRG1 0.83 2.34E?03 5.49E?03 ATG4B 0.83 1.26E?03 3.39E?03 TXNRD2 0.83 2.20E?03 5.23E?03 KEAP1 0.83 2.04E?03 4.94E?03 SLX1A 0.83 1.68E?03 4.24E?03 SLX1B 0.83 1.68E?03 4.24E?03 NOL10 0.83 3.62E?03 7.77E?03 DERA 0.83 1.42E?05 1.57E?04 NIP7 0.83 7.17E?04 2.21E?03 GMPR2 0.83 2.45E?03 5.71E?03 SMPD4 0.83 9.55E?04 2.74E?03 MAPK1IP1L 0.83 9.16E?04 2.64E?03 DHX33 0.83 7.81E?04 2.34E?03 RAF1 0.83 5.36E?04 1.79E?03 C16orf13 0.83 2.47E?05 2.14E?04 RBM8A 0.83 5.81E?05 3.74E?04 USP34 0.83 6.57E?05 4.07E?04 PEX26 0.83 2.36E?03 5.54E?03 PTP4A2 0.83 1.08E?03 3.00E?03 ENY2 0.83 2.84E?03 6.42E?03 RAP1A 0.83 4.20E?04 1.49E?03 USP24 0.83 8.11E?04 2.41E?03 GNG5 0.83 3.06E?03 6.81E?03 CEBPZ 0.83 3.15E?04 1.20E?03 PSMC3 0.83 4.90E?05 3.32E?04 SRP9 0.83 3.05E?04 1.17E?03 PAPOLA 0.83 8.08E?04 2.40E?03 SPCS1 0.83 1.33E?04 6.54E?04 IRAK1 0.83 6.02E?05 3.84E?04 H2AFX 0.83 3.82E?03 8.12E?03 EWSR1 0.83 6.52E?05 4.05E?04 NCOA3 0.83 2.08E?05 1.92E?04 KIAA1143 0.83 1.89E?03 4.64E?03 HSP90B1 0.83 1.90E?04 8.33E?04 PSMD5 0.83 2.91E?04 1.13E?03 DDX18 0.83 9.63E?04 2.76E?03 RSL24D1 0.83 1.65E?03 4.18E?03 NFIC 0.83 3.16E?04 1.20E?03 PSMB3 0.83 1.30E?04 6.42E?04 TBK1 0.83 8.52E?04 2.50E?03 TRIAP1 0.83 1.81E?03 4.48E?03 SRGAP2B 0.83 4.35E?03 8.98E?03 TNKS1BP1 0.83 6.78E?05 4.17E?04 PUSL1 0.83 4.48E?04 1.57E?03 SDHB 0.83 9.61E?04 2.75E?03 RPAP3 0.83 1.17E?03 3.21E?03 FDX1 0.83 5.33E?04 1.78E?03 TIMP2 0.83 1.97E?04 8.53E?04 ANKRD40 0.83 4.12E?03 8.62E?03 CDC5L 0.83 3.56E?03 7.67E?03 CALR 0.83 9.78E?06 1.27E?04 PIM2 0.83 1.01E?03 2.87E?03 MRM3 0.83 3.55E?03 7.64E?03 CNOT1 0.83 2.63E?04 1.05E?03 CDK4 0.83 2.13E?05 1.95E?04 ORAI2 0.83 4.29E?04 1.51E?03 POLDIP2 0.83 6.60E?05 4.07E?04 MAPK8IP3 0.83 3.05E?03 6.79E?03 UTP11 0.83 2.49E?04 1.01E?03 FAM49B 0.83 2.91E?03 6.54E?03 CACUL1 0.83 2.64E?03 6.06E?03 POLDIP3 0.83 1.00E?03 2.84E?03 NBPF1 0.83 1.69E?03 4.26E?03 C1orf123 0.82 1.67E?04 7.65E?04 MTG2 0.82 7.21E?05 4.31E?04 SEC13 0.82 3.22E?04 1.21E?03 HDGF 0.82 2.53E?04 1.02E?03 ALKBH1 0.82 1.42E?03 3.71E?03 BDP1 0.82 2.32E?03 5.46E?03 MARCKSL1 0.82 1.81E?05 1.77E?04 RBFOX2 0.82 6.52E?04 2.06E?03 HEIH 0.82 2.29E?04 9.47E?04 ADGRL2 0.82 3.61E?05 2.72E?04 SMARCC1 0.82 1.08E?05 1.34E?04 CNTROB 0.82 9.14E?05 5.10E?04 CLTB 0.82 4.30E?03 8.90E?03 NFYC 0.82 1.50E?03 3.88E?03 C19orf53 0.82 5.42E?04 1.80E?03 PHB 0.82 2.43E?04 9.94E?04 ERH 0.82 1.57E?05 1.66E?04 TIMM8B 0.82 1.38E?03 3.64E?03 EPRS 0.82 2.28E?06 5.53E?05 PNPLA6 0.82 8.36E?05 4.79E?04 NSD1 0.82 4.94E?05 3.33E?04 PRPF40A 0.82 2.29E?05 2.05E?04 AFG3L2 0.82 1.44E?03 3.77E?03 DCLRE1A 0.82 4.00E?03 8.42E?03 SLC31A1 0.82 2.22E?04 9.26E?04 ILVBL 0.82 1.43E?05 1.57E?04 POLR2J 0.82 5.53E?04 1.83E?03 MED13L 0.82 2.69E?04 1.07E?03 NUP155 0.82 2.54E?03 5.87E?03 EMC4 0.82 2.42E?05 2.10E?04 RIF1 0.82 2.29E?03 5.40E?03 CCT4 0.82 1.41E?04 6.82E?04 WDR77 0.82 2.73E?04 1.08E?03 C5orf22 0.82 1.37E?03 3.61E?03 ELF2 0.82 5.38E?04 1.79E?03 FOXRED1 0.82 4.92E?05 3.32E?04 TAF1C 0.82 4.99E?04 1.70E?03 ARPIN 0.82 5.42E?04 1.80E?03 POLRIB 0.82 2.61E?04 1.05E?03 CHMP2B 0.82 3.64E?03 7.80E?03 ORC5 0.82 1.23E?03 3.32E?03 FIP1L1 0.82 1.77E?03 4.42E?03 DNMBP 0.82 3.83E?03 8.14E?03 GMPS 0.82 3.63E?04 1.34E?03 CLIC4 0.82 1.38E?04 6.70E?04 KIF22 0.82 2.64E?03 6.06E?03 FANCI 0.82 1.25E?03 3.38E?03 EIF2B1 0.82 9.45E?07 3.58E?05 MAPRE2 0.82 8.88E?04 2.58E?03 UBR5 0.82 1.25E?03 3.37E?03 SUMO3 0.82 7.96E?04 2.38E?03 PPAT 0.82 7.62E?04 2.30E?03 GPX4 0.82 9.24E?04 2.66E?03 TRNT1 0.82 1.56E?05 1.65E?04 LDHA 0.82 1.27E?05 1.48E?04 HMGCS1 0.82 5.11E?04 1.72E?03 FAF1 0.82 1.61E?03 4.11E?03 AHR 0.82 1.71E?04 7.76E?04 ANXA11 0.82 2.95E?05 2.42E?04 EPB41L1 0.82 3.96E?05 2.90E?04 TRUB1 0.82 4.06E?03 8.52E?03 PTPRS 0.82 2.86E?04 1.12E?03 GRWD1 0.82 1.88E?04 8.30E?04 COPS3 0.82 3.61E?05 2.72E?04 UBTF 0.82 1.55E?03 4.00E?03 SLC4A7 0.82 3.64E?03 7.79E?03 MRPL14 0.82 1.88E?03 4.63E?03 STMN1 0.82 4.44E?04 1.55E?03 BAG3 0.82 4.64E?04 1.61E?03 PGAM1 0.82 5.43E?05 3.56E?04 ZNF317 0.82 1.92E?03 4.72E?03 AIP 0.82 2.22E?03 5.28E?03 FOXP4 0.82 1.01E?03 2.85E?03 IL13RA2 0.82 1.68E?04 7.71E?04 ARMC6 0.82 4.24E?05 3.01E?04 BCLAF1 0.82 2.79E?05 2.33E?04 RBM39 0.82 5.22E?04 1.75E?03 NCBP1 0.82 6.37E?04 2.03E?03 NFAT5 0.82 4.54E?03 9.29E?03 NLE1 0.82 1.14E?04 5.88E?04 CEP350 0.82 7.69E?04 2.32E?03 ZC3H7A 0.82 9.97E?04 2.84E?03 AARS2 0.82 3.53E?03 7.63E?03 ZMAT2 0.82 1.12E?04 5.82E?04 MLEC 0.82 1.12E?04 5.82E?04 ELAVL1 0.82 3.70E?04 1.36E?03 MRPL12 0.82 2.94E?03 6.60E?03 PSMB2 0.82 2.06E?04 8.82E?04 PCBP2 0.82 2.45E?05 2.13E?04 CHUK 0.82 8.41E?05 4.81E?04 TMX4 0.82 3.93E?05 2.89E?04 XPO5 0.82 9.86E?04 2.81E?03 PRAME 0.82 3.32E?04 1.25E?03 C19orf54 0.81 2.73E?03 6.22E?03 ELOVL5 0.81 1.13E?04 5.83E?04 POLR2E 0.81 3.32E?03 7.27E?03 COPRS 0.81 2.09E?03 5.03E?03 FMN1 0.81 1.49E?03 3.87E?03 DDX56 0.81 2.06E?04 8.83E?04 BOP1 0.81 1.87E?05 1.80E?04 PIGO 0.81 4.69E?04 1.62E?03 MTA2 0.81 1.16E?04 5.94E?04 PGM2 0.81 5.40E?04 1.80E?03 RASSF1 0.81 2.19E?04 9.20E?04 AKAP8L 0.81 2.25E?04 9.36E?04 FARSA 0.81 1.05E?04 5.61E?04 MASTL 0.81 1.04E?03 2.93E?03 SUN2 0.81 5.80E?04 1.89E?03 WWC2 0.81 4.39E?03 9.05E?03 BAG4 0.81 3.21E?03 7.08E?03 TMEM161A 0.81 2.96E?03 6.64E?03 MMADHC 0.81 1.18E?05 1.42E?04 NF2 0.81 6.15E?04 1.98E?03 PPP4R2 0.81 3.48E?04 1.29E?03 NDRG3 0.81 6.13E?05 3.88E?04 CNOT6 0.81 3.43E?03 7.45E?03 SPIDR 0.81 3.97E?03 8.38E?03 NMRAL1 0.81 2.57E?03 5.93E?03 FTSJ3 0.81 2.77E?04 1.09E?03 EMG1 0.81 2.36E?04 9.70E?04 RBM19 0.81 4.29E?03 8.90E?03 GGCT 0.81 4.22E?03 8.77E?03 EIFSB 0.81 1.79E?03 4.46E?03 MRPL19 0.81 1.20E?04 6.08E?04 EIF2B3 0.81 9.30E?04 2.68E?03 KAT7 0.81 7.19E?05 4.31E?04 ZNF511 0.81 1.09E?03 3.04E?03 EIF3J 0.81 1.13E?03 3.11E?03 PRPF4 0.81 7.99E?05 4.63E?04 NDUFA10 0.81 4.45E?03 9.14E?03 MFAP2 0.81 1.60E?03 4.10E?03 HAX1 0.81 1.70E?05 1.71E?04 GARS 0.81 8.20E?05 4.72E?04 CTCF 0.81 1.72E?04 7.79E?04 AGPS 0.81 3.75E?06 7.16E?05 GTF3C4 0.81 1.89E?04 8.32E?04 FKTN 0.81 2.27E?03 5.37E?03 MADD 0.81 3.41E?03 7.42E?03 ZW10 0.81 3.04E?03 6.78E?03 MCAT 0.81 1.18E?03 3.23E?03 TBL3 0.81 3.79E?03 8.07E?03 UQCRFS1 0.81 8.93E?04 2.59E?03 ARGLU1 0.81 3.48E?04 1.29E?03 TARDBP 0.81 2.40E?05 2.10E?04 PSMC6 0.81 1.08E?04 5.68E?04 RHOA 0.81 1.76E?05 1.74E?04 IREB2 0.81 1.31E?03 3.50E?03 DDX10 0.81 2.91E?03 6.54E?03 TRIOBP 0.81 3.51E?04 1.30E?03 SEMA4C 0.81 3.76E?04 1.37E?03 NUDT5 0.81 3.38E?05 2.64E?04 TMTC3 0.81 5.13E?04 1.73E?03 NARS 0.81 4.55E?04 1.58E?03 NXF1 0.81 1.21E?03 3.27E?03 PRKDC 0.81 3.96E?06 7.38E?05 GADD45GIP1 0.81 2.00E?03 4.86E?03 ZWILCH 0.81 1.01E?03 2.85E?03 UBA2 0.81 1.87E?05 1.80E?04 AOR 0.81 7.62E?04 2.30E?03 KIF7 0.81 1.51E?03 3.91E?03 IRF2BP1 0.81 1.04E?04 5.58E?04 CCT6A 0.81 1.40E?05 1.56E?04 IPO4 0.81 4.98E?05 3.35E?04 NOP56 0.81 9.90E?05 5.39E?04 IWS1 0.81 3.94E?05 2.89E?04 GART 0.81 2.48E?04 1.01E?03 RAD21 0.81 4.32E?06 7.81E?05 SUV39H1 0.81 2.25E?04 9.36E?04 ETV6 0.81 3.83E?03 8.13E?03 PHTF1 0.81 2.81E?03 6.37E?03 STOM 0.81 1.98E?05 1.87E?04 TCERG1 0.81 1.19E?03 3.25E?03 GFM2 0.81 2.40E?04 9.84E?04 IMPDH2 0.81 6.80E?05 4.17E?04 THYN1 0.81 4.86E?03 9.78E?03 TSTD2 0.81 6.24E?04 2.00E?03 PHTF2 0.81 1.31E?03 3.50E?03 GDI2 0.81 1.99E?05 1.87E?04 ELP6 0.81 7.71E?04 2.32E?03 CNOT2 0.81 3.38E?03 7.38E?03 CTNND1 0.81 1.76E?05 1.74E?04 SLC4A1AP 0.81 2.00E?03 4.87E?03 RNASEH1 0.81 2.40E?04 9.82E?04 MATR3 0.81 1.07E?04 5.66E?04 SCO1 0.81 1.60E?04 7.43E?04 FAM208B 0.81 5.58E?05 3.63E?04 ZFP36L1 0.81 1.39E?04 6.74E?04 MRPS23 0.81 1.16E?03 3.18E?03 PSME3 0.81 2.84E?05 2.36E?04 SNRNP27 0.80 7.20E?04 2.21E?03 KPNA2 0.80 2.62E?05 2.23E?04 MRPS31 0.80 8.21E?04 2.43E?03 BRIX1 0.80 1.66E?03 4.21E?03 TRIM37 0.80 1.75E?03 4.38E?03 TXNDC5 0.80 4.61E?05 3.21E?04 SNHG7 0.80 6.19E?04 1.99E?03 POC5 0.80 1.12E?03 3.10E?03 MRPS18A 0.80 6.32E?04 2.02E?03 ARHGAP17 0.80 2.64E?04 1.05E?03 UBE4B 0.80 2.44E?03 5.70E?03 CTNNB1 0.80 8.37E?06 1.15E?04 C15orf57 0.80 9.22E?04 2.66E?03 NUP43 0.80 4.93E?03 9.89E?03 TOMM40 0.80 3.14E?05 2.52E?04 DDX1 0.80 4.40E?06 7.90E?05 ILKAP 0.80 1.64E?03 4.17E?03 DIABLO 0.80 2.33E?03 5.49E?03 NDUFC2 0.80 3.38E?04 1.26E?03 NOP2 0.80 3.89E?04 1.40E?03 CDK11A 0.80 5.11E?04 1.72E?03 LEO1 0.80 1.34E?03 3.57E?03 TIMM10 0.80 7.19E?04 2.21E?03 EDRF1 0.80 3.75E?03 7.99E?03 UGCG 0.80 3.64E?03 7.79E?03 UTP4 0.80 6.92E?04 2.16E?03 SF3A1 0.80 4.16E?05 2.99E?04 DPH2 0.80 6.77E?04 2.13E?03 ZBTB11 0.80 1.79E?03 4.46E?03 PPIL3 0.80 4.78E?04 1.65E?03 TAF9 0.80 4.68E?04 1.62E?03 INTS4 0.80 1.05E?03 2.95E?03 AGBL5 0.80 1.77E?03 4.41E?03 RECQL4 0.80 3.29E?03 7.23E?03 CLNS1A 0.80 6.26E?05 3.94E?04 IER3 0.80 1.30E?06 4.29E?05 SUPT16H 0.80 8.63E?06 1.17E?04 TMCO6 0.80 2.09E?03 5.02E?03 CLPP 0.80 8.42E?04 2.48E?03 TOP2B 0.80 3.14E?04 1.19E?03 BRMS1 0.80 2.65E?04 1.06E?03 WNK1 0.80 2.67E?05 2.26E?04 ZCCHC3 0.80 3.82E?03 8.12E?03 EIF3B 0.80 1.21E?06 4.11E?05 UTP15 0.80 6.93E?04 2.16E?03 WDR75 0.80 2.73E?05 2.29E?04 RFC1 0.80 2.70E?03 6.16E?03 SMARCAS 0.80 4.98E?04 1.70E?03 CPSF3 0.80 3.75E?04 1.37E?03 BCAS2 0.80 4.05E?04 1.45E?03 DNAJC9 0.80 2.70E?03 6.16E?03 SNRPB 0.80 1.81E?05 1.77E?04 MRPL42 0.80 4.55E?03 9.30E?03 TRIP13 0.80 1.11E?03 3.08E?03 RPL26L1 0.80 5.04E?04 1.71E?03 RBPJ 0.80 3.88E?03 8.23E?03 DUSP6 0.80 1.05E?04 5.62E?04 FAM98B 0.80 2.42E?07 2.12E?05 ZC3HC1 0.80 9.86E?04 2.81E?03 CNOT7 0.80 2.69E?05 2.27E?04 PES1 0.80 5.80E?04 1.89E?03 NABP2 0.80 1.31E?03 3.51E?03 PCNT 0.80 1.96E?03 4.77E?03 LOC102723897 0.80 3.42E?05 2.66E?04 DCUN1D5 0.80 7.58E?04 2.29E?03 EXOSC2 0.80 1.60E?03 4.09E?03 SIPA1L2 0.80 3.18E?03 7.03E?03 RCC1L 0.80 1.99E?04 8.61E?04 METAP2 0.80 1.75E?04 7.89E?04 PMPCB 0.80 1.26E?04 6.31E?04 MGAT5 0.80 6.51E?04 2.06E?03 C17orf53 0.80 4.76E?03 9.61E?03 RHOT1 0.80 3.41E?03 7.42E?03 PNO1 0.80 4.35E?03 8.98E?03 PSMD3 0.80 3.51E?04 1.30E?03 COMMD2 0.80 1.46E?04 6.96E?04 APIP 0.80 2.90E?03 6.54E?03 PHKG2 0.80 1.17E?03 3.20E?03 SIK2 0.80 8.53E?04 2.50E?03 TOMM22 0.80 3.59E?05 2.72E?04 SFSWAP 0.80 4.77E?04 1.64E?03 ARL6IP1 0.80 5.77E?04 1.88E?03 DCPS 0.80 2.08E?04 8.88E?04 RPA2 0.80 1.21E?04 6.12E?04 PRPF3 0.80 4.32E?04 1.52E?03 MAP2K3 0.80 1.12E?03 3.10E?03 LSM3 0.79 1.68E?03 4.25E?03 MKLN1 0.79 2.55E?03 5.89E?03 PELO 0.79 1.17E?03 3.21E?03 MAML3 0.79 1.48E?03 3.85E?03 TMEM123 0.79 4.95E?04 1.69E?03 GLO1 0.79 1.39E?04 6.74E?04 COL4A3BP 0.79 4.63E?03 9.42E?03 PRMT7 0.79 7.20E?04 2.21E?03 DDX47 0.79 3.51E?04 1.30E?03 CD44 0.79 4.50E?05 3.14E?04 SMARCAD1 0.79 6.01E?04 1.94E?03 YWHAE 0.79 5.41E?06 8.78E?05 PTCD1 0.79 2.74E?03 6.24E?03 ALKBH7 0.79 1.09E?03 3.04E?03 CLN6 0.79 1.41E?04 6.81E?04 LCTL 0.79 1.59E?03 4.08E?03 RBM7 0.79 1.70E?04 7.74E?04 IMMT 0.79 1.08E?04 5.71E?04 SAP18 0.79 8.93E?04 2.59E?03 ANKH 0.79 1.41E?03 3.70E?03 HSPH1 0.79 8.83E?06 1.19E?04 MSANTD2 0.79 1.21E?04 6.12E?04 RNASEH2A 0.79 2.14E?04 9.03E?04 NPM1 0.79 8.22E?06 1.14E?04 TCP1 0.79 2.76E?05 2.30E?04 IPO9 0.79 1.67E?05 1.69E?04 MCMBP 0.79 7.46E?05 4.43E?04 PHIP 0.79 6.95E?04 2.17E?03 GLYR1 0.79 2.00E?03 4.87E?03 SEMA4D 0.79 4.13E?04 1.47E?03 TCTN3 0.79 2.15E?03 5.14E?03 PSMA2 0.79 2.73E?05 2.29E?04 ELP5 0.79 4.98E?04 1.70E?03 GBAS 0.79 1.34E?03 3.57E?03 MED25 0.79 3.22E?03 7.10E?03 LARP1B 0.79 2.91E?03 6.55E?03 CAPN15 0.79 1.65E?03 4.18E?03 ASXL1 0.79 7.99E?04 2.38E?03 SNU13 0.79 8.13E?04 2.41E?03 ACAD9 0.79 1.51E?03 3.90E?03 HIRIP3 0.79 2.66E?03 6.09E?03 HNRNPF 0.79 1.73E?04 7.81E?04 TARBP2 0.79 1.93E?04 8.46E?04 HAUS4 0.79 2.24E?03 5.31E?03 CASKIN2 0.79 6.95E?04 2.17E?03 PCMT1 0.79 3.05E?03 6.79E?03 ILF2 0.79 2.31E?05 2.05E?04 C20orf27 0.79 4.36E?05 3.07E?04 ZCCHC11 0.79 4.74E?03 9.59E?03 TIAL1 0.79 4.34E?04 1.52E?03 MRPS26 0.79 6.89E?04 2.15E?03 TMEM183A 0.79 6.85E?05 4.19E?04 MRPL16 0.79 1.89E?04 8.32E?04 RXRA 0.79 2.81E?03 6.36E?03 SNRPA 0.79 2.08E?04 8.89E?04 HNRNPH1 0.79 3.97E?05 2.90E?04 CDK6 0.79 1.30E?05 1.49E?04 ZDHHC7 0.79 1.84E?04 8.15E?04 PPP6C 0.79 2.38E?03 5.57E?03 DCTPP1 0.79 3.77E?03 8.02E?03 DHX35 0.79 2.06E?03 4.97E?03 MPP5 0.79 4.57E?04 1.59E?03 DDX39A 0.79 1.50E?04 7.10E?04 KIAA1524 0.79 3.15E?04 1.19E?03 FAN1 0.79 8.17E?04 2.42E?03 TCHP 0.79 3.51E?03 7.60E?03 CDK12 0.79 1.85E?04 8.20E?04 DST 0.79 1.27E?03 3.42E?03 PRPF19 0.79 3.82E?04 1.39E?03 SET 0.79 1.04E?05 1.30E?04 RRP1 0.79 6.56E?05 4.07E?04 GUF1 0.79 2.09E?04 8.92E?04 FKBP4 0.79 4.73E?06 8.22E?05 MED20 0.79 2.42E?03 5.65E?03 DNAJC11 0.79 7.42E?04 2.26E?03 NOC3L 0.79 1.13E?03 3.11E?03 MRPL38 0.79 5.19E?04 1.74E?03 C1QBP 0.79 2.63E?06 5.95E?05 PUM3 0.79 4.53E?04 1.58E?03 PPME1 0.79 6.34E?04 2.03E?03 LSG1 0.79 1.10E?03 3.05E?03 ARHGEF2 0.79 2.12E?04 8.98E?04 RNF166 0.79 8.34E?04 2.46E?03 FAM53C 0.79 7.55E?04 2.29E?03 CDCA5 0.79 1.71E?04 7.77E?04 ZNF778 0.79 4.42E?03 9.10E?03 ACOX3 0.79 6.80E?05 4.17E?04 DEK 0.79 4.24E?05 3.01E?04 ZFYVE9 0.79 2.94E?03 6.61E?03 POLR1E 0.79 6.08E?06 9.46E?05 VWA9 0.79 1.77E?04 7.93E?04 CENPH 0.79 1.96E?03 4.78E?03 TUBGCP3 0.79 9.82E?05 5.37E?04 BRD8 0.79 3.53E?03 7.63E?03 MRPS18C 0.78 3.76E?03 8.02E?03 ERI3 0.78 3.52E?03 7.61E?03 MAT2A 0.78 1.00E?05 1.29E?04 COA7 0.78 4.25E?04 1.50E?03 ASUN 0.78 4.81E?04 1.65E?03 UTP14A 0.78 7.16E?04 2.21E?03 POLE3 0.78 4.03E?05 2.92E?04 TXNL4B 0.78 1.87E?04 8.26E?04 TUBG2 0.78 3.56E?03 7.66E?03 KNSTRN 0.78 1.72E?04 7.79E?04 POFUT1 0.78 3.54E?05 2.70E?04 DHX34 0.78 6.40E?04 2.04E?03 RPL7L1 0.78 4.24E?04 1.50E?03 SART3 0.78 1.74E?03 4.35E?03 ITPRIP 0.78 4.52E?04 1.57E?03 SLC2A4RG 0.78 1.01E?03 2.85E?03 ZRANB1 0.78 1.68E?03 4.25E?03 CCDC124 0.78 8.09E?04 2.40E?03 MRPL47 0.78 1.63E?03 4.15E?03 NUP98 0.78 1.56E?03 4.01E?03 PSMC4 0.78 3.14E?05 2.52E?04 SGTA 0.78 1.29E?04 6.40E?04 SH3PXD2A 0.78 2.97E?05 2.43E?04 NELFCD 0.78 3.45E?05 2.67E?04 SRSF4 0.78 1.01E?05 1.30E?04 LMO4 0.78 2.49E?04 1.01E?03 CTNNBL1 0.78 6.51E?05 4.05E?04 LRP5 0.78 3.72E?03 7.95E?03 ESF1 0.78 7.69E?04 2.32E?03 NRF1 0.78 4.15E?03 8.67E?03 YARS 0.78 6.03E?05 3.84E?04 CCT5 0.78 8.61E?06 1.17E?04 PSMG1 0.78 1.65E?03 4.18E?03 LRPPRC 0.78 2.01E?04 8.65E?04 ADAM10 0.78 4.24E?05 3.01E?04 HDAC1 0.78 4.09E?05 2.96E?04 WDR5 0.78 3.57E?04 1.32E?03 NOL8 0.78 4.62E?04 1.60E?03 PDAP1 0.78 2.27E?06 5.53E?05 CWC25 0.78 2.03E?03 4.93E?03 SRSF1 0.78 6.23E?07 2.84E?05 NCKIPSD 0.78 3.48E?05 2.68E?04 MSMO1 0.78 1.20E?03 3.27E?03 UBAC1 0.78 1.57E?04 7.35E?04 HNRNPUL2-BSCL2 0.78 2.77E?03 6.30E?03 CDC25A 0.78 1.46E?03 3.82E?03 LUC7L2 0.78 1.57E?03 4.05E?03 MTA3 0.78 5.60E?04 1.84E?03 TFDP1 0.78 5.29E?04 1.77E?03 PPIE 0.78 3.29E?04 1.24E?03 PRKCZ 0.78 6.77E?04 2.13E?03 PDSS1 0.78 3.83E?04 1.39E?03 MBD3 0.78 1.06E?03 2.96E?03 CHMP4A 0.78 2.99E?04 1.15E?03 NME1 0.78 2.90E?05 2.40E?04 C2CD5 0.78 3.05E?03 6.79E?03 PPP1CC 0.78 7.91E?05 4.61E?04 KTN1 0.78 5.13E?07 2.56E?05 RCOR3 0.78 1.80E?03 4.47E?03 SNHG19 0.78 1.98E?03 4.82E?03 WDR74 0.78 3.68E?05 2.76E?04 NDUFA9 0.78 2.30E?03 5.42E?03 CLPX 0.78 6.59E?04 2.08E?03 C12orf4 0.78 1.42E?04 6.82E?04 STRAP 0.78 3.74E?05 2.79E?04 SLF1 0.78 3.57E?03 7.69E?03 PSMA4 0.78 1.27E?04 6.32E?04 ZNF446 0.78 1.41E?03 3.70E?03 DDX21 0.78 3.51E?05 2.69E?04 PDHX 0.78 1.74E?04 7.86E?04 NCAPG2 0.78 3.45E?03 7.49E?03 MSL3 0.78 7.89E?04 2.36E?03 RAD18 0.78 4.28E?03 8.87E?03 TAF15 0.78 1.72E?05 1.72E?04 SMC6 0.78 2.18E?04 9.17E?04 WRAP53 0.77 8.26E?04 2.44E?03 SAAL1 0.77 8.16E?04 2.42E?03 MRPL30 0.77 1.69E?04 7.71E?04 TWISTNB 0.77 8.85E?04 2.58E?03 WDR73 0.77 8.14E?04 2.41E?03 TMA7 0.77 7.66E?06 1.10E?04 U2SURP 0.77 4.83E?05 3.29E?04 AK2 0.77 5.21E?04 1.75E?03 UVRAG 0.77 2.47E?04 1.00E?03 LZTS2 0.77 2.34E?04 9.62E?04 METTL16 0.77 1.68E?03 4.25E?03 IKBKAP 0.77 7.68E?04 2.32E?03 PRPF4B 0.77 1.18E?04 6.03E?04 COQ4 0.77 1.68E?03 4.25E?03 GORASP1 0.77 1.76E?04 7.92E?04 GSTP1 0.77 4.43E?05 3.10E?04 GFM1 0.77 3.92E?04 1.41E?03 TCTN1 0.77 4.30E?03 8.91E?03 UGP2 0.77 1.94E?03 4.75E?03 TMSB4X 0.77 1.93E?03 4.73E?03 GATB 0.77 2.69E?03 6.14E?03 PPP5C 0.77 6.94E?05 4.23E?04 PRDX6 0.77 8.46E?06 1.16E?04 MRPL2 0.77 7.57E?04 2.29E?03 PPID 0.77 2.52E?03 5.85E?03 COPS4 0.77 1.38E?03 3.63E?03 TTC19 0.77 8.64E?04 2.52E?03 POLR1C 0.77 1.19E?03 3.25E?03 QTRT1 0.77 3.35E?04 1.25E?03 GGPS1 0.77 3.85E?04 1.39E?03 PTTG1 0.77 2.22E?03 5.28E?03 SNRPB2 0.77 1.82E?04 8.10E?04 CDC26 0.77 3.99E?03 8.41E?03 PATZ1 0.77 1.70E?03 4.27E?03 EFTUD2 0.77 3.41E?05 2.66E?04 SMNDC1 0.77 4.31E?03 8.92E?03 CSTF3 0.77 2.96E?04 1.14E?03 LPCAT1 0.77 1.15E?03 3.17E?03 GTF3C6 0.77 2.52E?03 5.85E?03 CDK10 0.77 3.75E?03 8.00E?03 THAP9-AS1 0.77 3.59E?03 7.73E?03 SRSF6 0.77 2.79E?04 1.09E?03 CD70 0.77 9.31E?04 2.68E?03 DSN1 0.77 2.53E?03 5.85E?03 PHF5A 0.77 1.43E?04 6.85E?04 CLASP2 0.77 4.52E?05 3.15E?04 GTF3C3 0.77 1.18E?03 3.22E?03 ADH5 0.77 7.37E?04 2.25E?03 ASNSD1 0.77 3.51E?03 7.59E?03 TMEM63A 0.77 2.13E?04 9.00E?04 TACO1 0.77 3.01E?03 6.72E?03 LATS2 0.77 2.55E?03 5.89E?03 FGFR1OP2 0.77 3.98E?03 8.40E?03 PACSIN2 0.77 2.23E?03 5.29E?03 TSN 0.77 1.34E?03 3.57E?03 AK6 0.77 7.29E?04 2.23E?03 PSIP1 0.77 1.36E?04 6.66E?04 ENKD1 0.77 6.88E?04 2.15E?03 IDH3B 0.77 4.78E?05 3.27E?04 ETV5 0.77 1.08E?03 3.01E?03 SH2B3 0.77 1.54E?04 7.26E?04 KDM4A 0.77 2.04E?04 8.74E?04 ARL3 0.77 6.20E?04 1.99E?03 UBE2S 0.77 7.52E?05 4.45E?04 SRSF11 0.77 5.40E?05 3.55E?04 PODXL 0.77 1.38E?03 3.63E?03 MRPL21 0.77 7.71E?04 2.32E?03 DPYSL3 0.77 1.64E?03 4.17E?03 ATF7IP 0.77 4.23E?03 8.80E?03 ZNF217 0.77 3.88E?05 2.86E?04 PNMAL1 0.77 3.29E?03 7.22E?03 GRAMD1B 0.77 9.84E?05 5.37E?04 MTF2 0.77 1.94E?04 8.48E?04 ACIN1 0.77 2.56E?04 1.03E?03 BUD31 0.76 1.59E?05 1.67E?04 EPB41L2 0.76 7.53E?04 2.28E?03 COA6 0.76 8.09E?04 2.40E?03 RBMX 0.76 3.65E?06 7.05E?05 KRR1 0.76 1.03E?03 2.90E?03 KIAA0753 0.76 4.19E?03 8.73E?03 SNX2 0.76 8.49E?04 2.49E?03 ZNF330 0.76 6.87E?04 2.15E?03 IFRD2 0.76 1.03E?04 5.54E?04 UPF3B 0.76 1.28E?03 3.43E?03 NOP14 0.76 3.60E?05 2.72E?04 METTL12 0.76 4.52E?03 9.25E?03 PTMS 0.76 9.52E?05 5.27E?04 PNRC2 0.76 1.85E?04 8.20E?04 SSBP1 0.76 2.74E?05 2.29E?04 PEX5 0.76 2.59E?04 1.04E?03 HSPA5 0.76 1.62E?06 4.75E?05 SREBF2 0.76 1.69E?06 4.78E?05 RBM23 0.76 7.20E?05 4.31E?04 SNHG17 0.76 9.29E?04 2.68E?03 COX11 0.76 3.98E?03 8.40E?03 IDE 0.76 3.01E?04 1.15E?03 SRGAP2C 0.76 2.35E?03 5.52E?03 PDCD4 0.76 3.11E?04 1.18E?03 SNRPE 0.76 1.21E?04 6.12E?04 TAF11 0.76 1.13E?03 3.13E?03 DHX9 0.76 7.11E?06 1.05E?04 DNMT1 0.76 9.23E?06 1.22E?04 GPATCH4 0.76 1.77E?04 7.93E?04 CAD 0.76 4.03E?05 2.92E?04 WDR36 0.76 7.18E?04 2.21E?03 CYB5D1 0.76 4.64E?03 9.42E?03 RBM26 0.76 3.88E?04 1.40E?03 JMJD8 0.76 2.16E?04 9.10E?04 EXOSC1 0.76 4.11E?03 8.60E?03 H1FX 0.76 9.86E?06 1.28E?04 GEMIN5 0.76 4.92E?04 1.68E?03 UTP18 0.76 7.20E?04 2.21E?03 NAA25 0.76 1.93E?03 4.73E?03 TMEM97 0.76 1.61E?03 4.10E?03 INTS6 0.76 5.00E?04 1.70E?03 DDX11 0.76 1.60E?03 4.09E?03 RAE1 0.76 2.63E?05 2.24E?04 UIMC1 0.76 3.36E?03 7.34E?03 ZNF593 0.76 4.23E?03 8.80E?03 PTCD2 0.76 1.55E?03 3.99E?03 PGD 0.76 2.23E?06 5.50E?05 LMNA 0.76 4.81E?06 8.31E?05 NAE1 0.76 1.55E?03 3.99E?03 BCL2L2-PABPN1 0.76 1.28E?03 3.44E?03 PPIH 0.76 3.36E?03 7.35E?03 SNX1 0.76 4.01E?04 1.44E?03 PRPF31 0.76 1.56E?04 7.33E?04 SYDE1 0.76 1.83E?04 8.13E?04 DDX51 0.76 3.88E?05 2.86E?04 NUP205 0.76 1.75E?05 1.74E?04 PTMA 0.76 4.59E?06 8.09E?05 TUBGCP4 0.76 6.57E?04 2.08E?03 TIMELESS 0.76 2.45E?04 1.00E?03 SMC3 0.76 3.91E?04 1.41E?03 XYLB 0.76 1.22E?03 3.31E?03 APITD1 0.76 3.34E?03 7.32E?03 ABCF2 0.76 3.00E?04 1.15E?03 NAP1L1 0.76 6.60E?06 9.90E?05 PARN 0.76 5.14E?04 1.73E?03 CKAP5 0.76 1.01E?04 5.48E?04 ZNF608 0.76 3.49E?05 2.68E?04 HNRNPM 0.76 1.32E?05 1.51E?04 MTERF3 0.76 7.08E?04 2.19E?03 SF3B3 0.76 2.47E?05 2.14E?04 MTMR2 0.76 1.66E?04 7.65E?04 SFPQ 0.76 1.42E?04 6.82E?04 USP28 0.76 1.65E?04 7.63E?04 HMGCR 0.75 2.06E?05 1.91E?04 NDST1 0.75 1.39E?05 1.56E?04 MY019 0.75 6.81E?04 2.13E?03 AKR7A2 0.75 1.81E?04 8.06E?04 DZIP1 0.75 2.98E?04 1.15E?03 ZNF266 0.75 3.65E?03 7.82E?03 GTF2I 0.75 2.10E?04 8.95E?04 NPM3 0.75 2.33E?04 9.59E?04 LINC01029 0.75 1.73E?03 4.34E?03 ZNF692 0.75 9.05E?04 2.62E?03 SNHG15 0.75 1.25E?03 3.38E?03 ASAP1 0.75 3.50E?03 7.57E?03 VPS37B 0.75 1.09E?04 5.75E?04 ATP5F1 0.75 5.20E?05 3.46E?04 HEATR1 0.75 1.58E?05 1.66E?04 N4BP2L2 0.75 3.84E?03 8.14E?03 STIL 0.75 9.90E?04 2.82E?03 ARHGAP29 0.75 2.65E?03 6.07E?03 SNRPG 0.75 5.58E?04 1.84E?03 PRMT1 0.75 4.62E?07 2.47E?05 ANKRD54 0.75 1.78E?04 7.97E?04 SRSF2 0.75 3.52E?05 2.70E?04 NOL11 0.75 5.77E?04 1.88E?03 PRKACB 0.75 4.33E?03 8.95E?03 LINC00998 0.75 1.72E?03 4.32E?03 GLI3 0.75 3.34E?04 1.25E?03 GNPTAB 0.75 2.33E?05 2.06E?04 U2AF1 0.75 7.08E?04 2.19E?03 DDX46 0.75 8.62E?04 2.52E?03 MRPS15 0.75 3.36E?04 1.26E?03 LYAR 0.75 1.00E?05 1.29E?04 WDR18 0.75 1.59E?04 7.41E?04 AMOTL2 0.75 1.02E?05 1.30E?04 NFYB 0.75 1.77E?03 4.42E?03 MTHFD1L 0.75 4.87E?04 1.67E?03 EIF2S2 0.75 7.23E?05 4.32E?04 GLT8D1 0.75 1.05E?04 5.61E?04 MCCC1 0.75 4.37E?04 1.53E?03 RRP1B 0.75 2.70E?04 1.07E?03 MARS 0.75 8.90E?05 5.01E?04 C3orf14 0.75 2.81E?04 1.10E?03 CCP110 0.75 9.08E?04 2.62E?03 CENPE 0.75 4.94E?04 1.69E?03 DYNLL1 0.75 2.11E?06 5.36E?05 ARHGAP5 0.75 2.02E?03 4.89E?03 NPRL3 0.75 2.22E?04 9.26E?04 RBBP4 0.75 2.81E?05 2.34E?04 PTGES3 0.75 4.07E?05 2.95E?04 PLEKHAS 0.75 3.51E?03 7.59E?03 C1orf112 0.75 4.51E?04 1.57E?03 PYCR1 0.75 8.77E?04 2.56E?03 ATAD2 0.75 4.06E?06 7.53E?05 NUDT21 0.75 1.97E?04 8.55E?04 MLH1 0.75 9.08E?04 2.62E?03 CCDC86 0.75 6.90E?05 4.21E?04 TAF2 0.75 1.86E?06 4.95E?05 SPATS2 0.75 7.47E?04 2.27E?03 SLC25A20 0.75 2.34E?03 5.51E?03 MRPL33 0.75 1.13E?04 5.84E?04 CAMK4 0.75 2.79E?03 6.32E?03 JAGN1 0.75 2.18E?03 5.20E?03 COPS5 0.75 3.65E?04 1.34E?03 OSER1 0.74 1.17E?03 3.20E?03 TMEM50B 0.74 2.42E?04 9.90E?04 MTHFD2 0.74 1.33E?03 3.54E?03 PRIM2 0.74 1.17E?03 3.20E?03 RPP30 0.74 7.20E?04 2.21E?03 RBM12 0.74 3.16E?05 2.53E?04 KCTD20 0.74 3.40E?04 1.27E?03 CYTH1 0.74 1.93E?03 4.73E?03 SRSF3 0.74 3.23E?05 2.56E?04 ERBB2 0.74 1.76E?05 1.74E?04 WBP11 0.74 1.45E?04 6.94E?04 PNN 0.74 6.32E?04 2.02E?03 LENG8 0.74 3.23E?04 1.22E?03 NCL 0.74 4.82E?07 2.51E?05 IFT122 0.74 6.24E?04 2.00E?03 LAS1L 0.74 1.93E?04 8.46E?04 CENPO 0.74 4.06E?03 8.51E?03 LINC01578 0.74 5.97E?04 1.93E?03 POLA1 0.74 1.20E?03 3.26E?03 MGLL 0.74 3.94E?05 2.89E?04 EXOG 0.74 1.26E?03 3.39E?03 BTAF1 0.74 6.48E?04 2.06E?03 B3GALNT2 0.74 2.49E?03 5.79E?03 GPN3 0.74 2.93E?03 6.59E?03 KIF14 0.74 6.70E?04 2.11E?03 MED27 0.74 4.95E?04 1.69E?03 CHAF1A 0.74 5.27E?04 1.76E?03 FAM111B 0.74 3.09E?03 6.87E?03 TCEA2 0.74 1.03E?04 5.54E?04 INTS8 0.74 4.23E?03 8.80E?03 PCNX1 0.74 4.19E?03 8.74E?03 CDKN2C 0.74 5.10E?04 1.72E?03 RAD51C 0.74 6.51E?04 2.06E?03 TNPO1 0.74 1.45E?05 1.58E?04 APEX1 0.74 2.65E?04 1.06E?03 TRMT61B 0.74 2.08E?03 5.01E?03 KHSRP 0.74 2.58E?07 2.14E?05 SNRNP70 0.74 4.68E?05 3.24E?04 CBX6 0.74 3.04E?04 1.16E?03 NUP133 0.74 6.20E?06 9.53E?05 RILPL2 0.74 7.90E?04 2.37E?03 MDC1 0.74 7.38E?04 2.25E?03 IFT22 0.74 2.59E?05 2.21E?04 TULP3 0.74 1.88E?04 8.27E?04 ADCK4 0.74 1.83E?03 4.51E?03 TRAP1 0.74 3.08E?04 1.18E?03 MRTO4 0.74 1.87E?05 1.80E?04 ECD 0.74 4.35E?03 8.98E?03 RANBP1 0.74 3.79E?04 1.38E?03 DARS2 0.74 3.87E?04 1.40E?03 MRPL1 0.74 1.86E?04 8.25E?04 IDI1 0.74 1.65E?03 4.18E?03 HAUSS 0.74 8.29E?04 2.45E?03 CDKN2AIPNL 0.74 6.55E?04 2.07E?03 MAGOH 0.74 1.16E?03 3.19E?03 SNRPD1 0.74 6.38E?05 3.99E?04 SOX11 0.74 1.85E?05 1.79E?04 SKIV2L2 0.74 1.97E?05 1.86E?04 DDX19B 0.74 5.14E?04 1.73E?03 NAT10 0.74 5.56E?05 3.62E?04 TRIP6 0.74 5.11E?04 1.72E?03 EPHA2 0.74 6.25E?06 9.58E?05 TDRD3 0.74 2.85E?03 6.43E?03 SS18L2 0.74 3.90E?03 8.25E?03 SUZ12 0.74 1.91E?04 8.39E?04 ARHGAP12 0.74 7.65E?05 4.50E?04 PPP1R7 0.74 3.17E?04 1.20E?03 USP1 0.74 6.27E?05 3.94E?04 NUP107 0.74 1.20E?03 3.27E?03 ADGRL1 0.74 5.51E?04 1.82E?03 COQ7 0.73 9.09E?04 2.62E?03 NARS2 0.73 1.74E?03 4.37E?03 PTPN3 0.73 3.09E?03 6.87E?03 NRSN2 0.73 1.05E?04 5.61E?04 ENG 0.73 1.25E?04 6.27E?04 EXOSC3 0.73 3.88E?04 1.40E?03 ELMSAN1 0.73 1.62E?05 1.67E?04 PCDH1 0.73 1.41E?05 1.57E?04 THOC2 0.73 3.19E?05 2.54E?04 DNAJB11 0.73 1.82E?04 8.08E?04 NME7 0.73 1.36E?03 3.61E?03 ALDH1B1 0.73 7.06E?05 4.26E?04 EEF1AKMT1 0.73 4.63E?03 9.42E?03 ST3GAL4 0.73 2.18E?05 1.98E?04 NAA15 0.73 8.17E?06 1.14E?04 PCAT7 0.73 4.45E?03 9.14E?03 MAD2L1 0.73 6.05E?05 3.85E?04 AP2S1 0.73 1.91E?05 1.82E?04 RFX1 0.73 2.27E?04 9.40E?04 ZRANB2 0.73 1.02E?03 2.87E?03 POP4 0.73 4.76E?04 1.64E?03 HNRNPA2B1 0.73 2.62E?05 2.23E?04 XPO4 0.73 1.50E?03 3.90E?03 CMTM7 0.73 7.25E?05 4.33E?04 NOP16 0.73 2.63E?04 1.05E?03 HSPA9 0.73 2.47E?06 5.82E?05 EX01 0.73 1.63E?04 7.52E?04 RIOK1 0.73 1.96E?03 4.78E?03 WDR12 0.73 1.47E?03 3.83E?03 INTS12 0.73 2.00E?04 8.64E?04 LUC7L 0.73 2.76E?04 1.08E?03 TIA1 0.73 4.17E?04 1.48E?03 ETAA1 0.73 1.30E?05 1.49E?04 NUP93 0.73 5.31E?06 8.71E?05 LARS 0.73 2.70E?06 6.04E?05 MAD2L2 0.73 4.36E?04 1.53E?03 HMCES 0.73 7.67E?04 2.32E?03 SDHD 0.73 7.52E?04 2.28E?03 PPP2R4 0.73 1.36E?05 1.54E?04 SRSF7 0.73 5.77E?05 3.72E?04 MKNK2 0.73 5.17E?04 1.74E?03 SF3A3 0.73 9.50E?05 5.26E?04 H2AFV 0.73 2.00E?05 1.87E?04 SEH1L 0.73 4.80E?05 3.27E?04 SAPCD2 0.73 1.93E?03 4.72E?03 TGS1 0.73 6.97E?05 4.24E?04 PSPC1 0.73 7.92E?05 4.61E?04 NAA38 0.73 4.22E?04 1.49E?03 FJX1 0.73 1.69E?03 4.25E?03 CBX1 0.73 5.23E?04 1.75E?03 MKKS 0.73 2.75E?03 6.25E?03 ACP6 0.73 1.10E?03 3.04E?03 PCDHA6 0.73 4.18E?03 8.71E?03 RAPGEF6 0.72 1.19E?03 3.25E?03 DTYMK 0.72 7.25E?04 2.22E?03 MRPL13 0.72 1.19E?04 6.04E?04 UBXN2A 0.72 4.04E?04 1.45E?03 NACC1 0.72 1.15E?05 1.40E?04 C16orf59 0.72 4.21E?03 8.77E?03 MBNL1 0.72 1.89E?04 8.32E?04 SNRNP40 0.72 9.99E?06 1.29E?04 FAM126A 0.72 4.02E?03 8.45E?03 ECSIT 0.72 6.10E?05 3.87E?04 MCM5 0.72 2.49E?04 1.01E?03 OSGEP 0.72 7.63E?04 2.31E?03 PRPF38A 0.72 2.11E?04 8.97E?04 THOC1 0.72 1.62E?03 4.13E?03 CYP51A1 0.72 1.30E?04 6.42E?04 CENPL 0.72 1.45E?03 3.78E?03 TIMM9 0.72 3.79E?03 8.06E?03 FUBP1 0.72 2.59E?04 1.04E?03 KHDRBS3 0.72 1.84E?03 4.54E?03 LIMA1 0.72 5.53E?04 1.83E?03 AIMP2 0.72 6.23E?05 3.92E?04 DNAAF5 0.72 7.08E?05 4.27E?04 PGAM5 0.72 2.15E?05 1.96E?04 CHSY1 0.72 1.74E?04 7.86E?04 GNL3 0.72 1.55E?04 7.28E?04 METTL17 0.72 7.73E?04 2.33E?03 ZNF146 0.72 1.20E?04 6.09E?04 NOM1 0.72 1.24E?03 3.36E?03 PCGF6 0.72 3.36E?04 1.26E?03 CDK2 0.72 5.18E?04 1.74E?03 ING3 0.72 1.29E?03 3.46E?03 CALM3 0.72 3.66E?06 7.07E?05 EIF4A3 0.72 2.92E?05 2.41E?04 POLE 0.72 2.22E?03 5.28E?03 TSPAN4 0.72 1.57E?03 4.05E?03 CEP85 0.72 2.14E?04 9.04E?04 APOBEC3G 0.72 2.98E?03 6.66E?03 FUS 0.72 1.39E?05 1.56E?04 LYRM1 0.72 3.48E?04 1.29E?03 DBF4 0.72 1.11E?03 3.07E?03 PKP4 0.72 6.59E?04 2.08E?03 NUP88 0.72 1.67E?07 1.75E?05 CDT1 0.72 1.49E?04 7.09E?04 TTC27 0.72 2.82E?04 1.10E?03 NEDD4 0.72 5.89E?04 1.91E?03 LTV1 0.72 1.07E?03 3.00E?03 DDX55 0.72 1.80E?03 4.47E?03 IQSEC1 0.72 9.04E?05 5.07E?04 PRDX3 0.72 2.32E?05 2.06E?04 FAM133B 0.72 1.94E?04 8.48E?04 RBMXL1 0.71 7.86E?05 4.59E?04 NUP85 0.71 7.96E?04 2.38E?03 CSE1L 0.71 2.73E?05 2.29E?04 MTRR 0.71 5.76E?04 1.88E?03 GGA2 0.71 3.45E?04 1.28E?03 TAPT1 0.71 8.77E?04 2.56E?03 THEM4 0.71 1.81E?03 4.48E?03 HSPE1 0.71 1.41E?04 6.81E?04 SUPV3L1 0.71 5.74E?04 1.88E?03 SNUPN 0.71 3.76E?04 1.37E?03 ALDH18A1 0.71 3.73E?05 2.79E?04 SLC25A25 0.71 1.12E?04 5.82E?04 PA2G4 0.71 1.64E?06 4.75E?05 RRM1 0.71 2.05E?04 8.79E?04 GABPA 0.71 3.38E?04 1.26E?03 TECR 0.71 5.21E?04 1.75E?03 PKMYT1 0.71 3.60E?03 7.74E?03 SUV39H2 0.71 8.40E?04 2.47E?03 NEAT1 0.71 2.18E?03 5.21E?03 KDM1A 0.71 5.41E?05 3.55E?04 MRPL4 0.71 8.11E?04 2.41E?03 NUDCD2 0.71 3.04E?04 1.16E?03 USP39 0.71 1.72E?04 7.79E?04 AARSD1 0.71 2.52E?04 1.02E?03 GTPBP6 0.71 1.02E?03 2.88E?03 SMC4 0.71 1.37E?04 6.69E?04 PUS7 0.71 3.05E?04 1.17E?03 SLC5A6 0.71 9.86E?05 5.37E?04 SHISA4 0.71 1.94E?04 8.48E?04 ILF3 0.71 2.68E?06 6.02E?05 ZNF274 0.71 5.33E?04 1.78E?03 PNPT1 0.71 3.21E?03 7.10E?03 NTMT1 0.71 2.32E?04 9.58E?04 NCAPG 0.71 1.54E?06 4.67E?05 ZNF362 0.71 1.05E?03 2.95E?03 TIMM50 0.71 1.03E?04 5.55E?04 CTSC 0.71 2.03E?05 1.89E?04 FOXRED2 0.71 3.51E?04 1.30E?03 KPTN 0.71 2.12E?04 8.98E?04 CCNL1 0.71 7.32E?04 2.24E?03 MRPL11 0.71 1.35E?03 3.58E?03 FCF1 0.71 3.86E?04 1.40E?03 ASF1B 0.71 8.55E?05 4.87E?04 RBL1 0.71 1.26E?03 3.39E?03 TRA2B 0.71 2.97E?05 2.43E?04 HSPD1 0.71 4.48E?05 3.13E?04 GPD2 0.71 2.21E?04 9.24E?04 PFN2 0.71 7.50E?05 4.44E?04 KIF20B 0.71 6.27E?04 2.01E?03 SLC25A33 0.71 2.04E?03 4.95E?03 ANAPC7 0.71 2.21E?04 9.25E?04 FBXO5 0.71 4.27E?04 1.51E?03 SNRNP25 0.71 3.18E?05 2.54E?04 PAXBP1 0.71 3.87E?04 1.40E?03 CENPN 0.71 1.78E?03 4.43E?03 KNTC1 0.71 1.98E?03 4.81E?03 ABTB2 0.71 6.57E?05 4.07E?04 XPNPEP3 0.71 1.09E?03 3.02E?03 GCSH 0.70 1.37E?03 3.62E?03 IFT52 0.70 4.52E?04 1.58E?03 RND3 0.70 3.90E?04 1.40E?03 GPSM3 0.70 7.69E?04 2.32E?03 RUVBL1 0.70 1.02E?05 1.30E?04 SPARC 0.70 6.13E?07 2.83E?05 HNRNPH3 0.70 1.45E?04 6.91E?04 SRRD 0.70 5.90E?04 1.91E?03 MPDZ 0.70 9.07E?04 2.62E?03 CWF19L1 0.70 2.56E?04 1.03E?03 RPIA 0.70 4.44E?03 9.14E?03 TYMS 0.70 5.10E?05 3.40E?04 THADA 0.70 3.66E?03 7.82E?03 KBTBD6 0.70 1.03E?03 2.90E?03 STAG1 0.70 1.65E?03 4.18E?03 CASC5 0.70 5.18E?05 3.44E?04 FAM171A1 0.70 1.35E?03 3.58E?03 HJURP 0.70 7.92E?05 4.61E?04 RBM17 0.70 1.50E?04 7.12E?04 FADS1 0.70 4.08E?05 2.95E?04 PCNA 0.70 1.04E?05 1.30E?04 PROSER3 0.70 1.84E?03 4.54E?03 RITA1 0.70 6.61E?05 4.08E?04 KIFC1 0.70 4.98E?05 3.35E?04 NCAPD3 0.70 7.77E?06 1.11E?04 FHL3 0.70 3.13E?04 1.19E?03 POLR3B 0.70 2.93E?04 1.13E?03 NUDT3 0.70 4.46E?03 9.15E?03 TTLL4 0.70 2.05E?03 4.95E?03 CCNE2 0.70 4.67E?03 9.47E?03 VRK1 0.70 3.22E?03 7.11E?03 KIAA0101 0.70 1.13E?04 5.83E?04 NT5C2 0.70 2.09E?05 1.93E?04 NECTIN2 0.70 3.29E?04 1.24E?03 PNISR 0.70 1.98E?03 4.82E?03 SSRP1 0.70 4.33E?06 7.81E?05 LRR1 0.70 1.59E?03 4.09E?03 CARS 0.70 4.14E?05 2.98E?04 LOC105369205 0.70 2.80E?05 2.33E?04 RUVBL2 0.70 1.04E?05 1.30E?04 CPSF4 0.70 1.82E?03 4.51E?03 POLR3K 0.70 1.03E?04 5.55E?04 DONSON 0.70 1.96E?03 4.78E?03 HADH 0.70 1.07E?04 5.65E?04 HSPBP1 0.70 9.03E?05 5.07E?04 HNRNPD 0.70 1.31E?06 4.29E?05 ETFA 0.70 8.68E?06 1.18E?04 TTC31 0.70 1.99E?05 1.87E?04 CDON 0.69 1.66E?04 7.64E?04 NOL4L 0.69 7.36E?04 2.25E?03 POLD1 0.69 8.12E?05 4.68E?04 ETV4 0.69 2.63E?04 1.05E?03 ANO6 0.69 2.65E?06 5.98E?05 TYSND1 0.69 6.48E?04 2.06E?03 C7orf50 0.69 4.94E?05 3.33E?04 NR2F6 0.69 1.59E?04 7.41E?04 APOBEC3B 0.69 3.41E?03 7.42E?03 ANXA6 0.69 1.47E?05 1.59E?04 MVK 0.69 2.48E?04 1.01E?03 JUND 0.69 1.79E?04 8.00E?04 KPNB1 0.69 1.11E?05 1.36E?04 LIG3 0.69 7.35E?05 4.38E?04 SNAI1 0.69 1.07E?04 5.67E?04 RAD54L 0.69 8.71E?05 4.93E?04 ZNF227 0.69 1.47E?03 3.83E?03 NLGN2 0.69 4.46E?07 2.46E?05 SMC2 0.69 2.39E?05 2.09E?04 NFIX 0.69 1.66E?05 1.68E?04 TAF1D 0.69 3.14E?04 1.19E?03 CENPW 0.69 1.58E?03 4.07E?03 MRPS30 0.69 2.56E?04 1.03E?03 GTF2H3 0.69 3.92E?05 2.89E?04 SHC1 0.69 7.35E?07 3.08E?05 MAGED1 0.69 4.74E?06 8.23E?05 JUN 0.69 6.49E?04 2.06E?03 NUP160 0.69 5.43E?06 8.80E?05 TAB3 0.69 4.97E?04 1.69E?03 MELK 0.69 5.94E?04 1.92E?03 NSMCE4A 0.69 7.78E?04 2.34E?03 CADM1 0.69 9.99E?05 5.43E?04 GINS1 0.69 3.65E?04 1.34E?03 FMNL2 0.69 8.53E?06 1.17E?04 FOXM1 0.68 6.16E?05 3.89E?04 TPCN1 0.68 7.05E?04 2.18E?03 FASTKD3 0.68 4.69E?03 9.51E?03 PARP1 0.68 4.21E?07 2.46E?05 PFAS 0.68 3.73E?05 2.79E?04 PIDD1 0.68 6.40E?04 2.04E?03 PCID2 0.68 1.15E?03 3.16E?03 SUFU 0.68 7.28E?04 2.23E?03 HSPB1 0.68 4.39E?05 3.09E?04 LMNB2 0.68 1.19E?05 1.42E?04 TSEN2 0.68 3.75E?03 8.00E?03 RAB34 0.68 1.30E?04 6.42E?04 EARS2 0.68 1.26E?03 3.39E?03 TCF12 0.68 4.31E?05 3.05E?04 PRIM1 0.68 2.58E?03 5.94E?03 CBWD5 0.68 3.50E?04 1.30E?03 RTKN 0.68 1.10E?04 5.78E?04 MCM8 0.68 1.13E?03 3.13E?03 SRGAP2 0.68 5.21E?06 8.68E?05 DNAJC2 0.68 3.77E?05 2.81E?04 ARHGAP5-AS1 0.68 2.76E?03 6.28E?03 HMGB1 0.68 2.76E?07 2.17E?05 GCLM 0.68 3.31E?04 1.24E?03 CCNC 0.68 2.91E?03 6.55E?03 WDR90 0.68 2.06E?03 4.97E?03 DPYSL5 0.68 3.58E?04 1.32E?03 RPA3 0.68 3.20E?03 7.08E?03 RRAS2 0.68 1.17E?04 5.99E?04 GPX8 0.68 2.65E?03 6.08E?03 CCDC59 0.68 1.59E?04 7.42E?04 PREP 0.68 3.79E?06 7.17E?05 CTU2 0.68 4.54E?03 9.28E?03 HN1 0.68 9.54E?05 5.27E?04 STAG3L2 0.68 4.75E?03 9.60E?03 CSPP1 0.68 6.98E?04 2.17E?03 ANP32E 0.68 1.36E?05 1.54E?04 EXOSC7 0.68 1.03E?03 2.91E?03 PKP3 0.68 2.43E?05 2.11E?04 LPIN1 0.68 1.30E?04 6.42E?04 XPO1 0.67 4.69E?05 3.25E?04 EFHD2 0.67 1.70E?04 7.74E?04 NUP37 0.67 5.05E?04 1.71E?03 GALNT2 0.67 2.14E?06 5.42E?05 GORAB 0.67 1.59E?03 4.07E?03 FH 0.67 2.06E?05 1.91E?04 FAM210A 0.67 3.52E?03 7.60E?03 COQ2 0.67 7.76E?05 4.55E?04 VOPP1 0.67 5.89E?04 1.91E?03 LPIN2 0.67 1.33E?05 1.51E?04 SRRT 0.67 6.69E?06 9.99E?05 ANK3 0.67 7.14E?05 4.30E?04 GLUD1 0.67 2.56E?06 5.86E?05 COASY 0.67 2.29E?04 9.47E?04 ZNF706 0.67 1.25E?03 3.36E?03 SH3TC1 0.67 9.49E?04 2.73E?03 TP53 0.67 1.60E?04 7.43E?04 TIPIN 0.67 3.34E?03 7.30E?03 ALDH7A1 0.67 5.39E?06 8.78E?05 CHAC2 0.67 7.94E?05 4.61E?04 PXYLP1 0.67 6.97E?05 4.24E?04 ESPL1 0.67 3.48E?04 1.29E?03 PAK1IP1 0.67 3.83E?04 1.39E?03 ALYREF 0.67 1.24E?04 6.26E?04 LOC107987001 0.67 3.34E?03 7.31E?03 HSF2 0.67 8.35E?04 2.46E?03 TSEN15 0.67 1.04E?03 2.93E?03 MCM2 0.67 6.27E?05 3.94E?04 DLEU2L 0.67 1.19E?03 3.25E?03 NDC1 0.67 2.99E?04 1.15E?03 SGO2 0.67 2.74E?04 1.08E?03 DNAJC6 0.67 4.00E?05 2.91E?04 PRMT5 0.66 3.78E?04 1.37E?03 CEP55 0.66 7.42E?05 4.41E?04 L1CAM 0.66 2.95E?05 2.42E?04 CCDC58 0.66 1.38E?04 6.72E?04 SLC30A1 0.66 7.96E?05 4.62E?04 CCDC88A 0.66 5.73E?05 3.71E?04 NDUFAF7 0.66 1.04E?04 5.58E?04 9-Sep 0.66 3.45E?06 6.77E?05 NUP54 0.66 2.27E?03 5.37E?03 PLK4 0.66 3.17E?03 7.03E?03 MRPL57 0.66 6.98E?04 2.17E?03 ANP32B 0.66 5.94E?06 9.35E?05 SEPHS1 0.66 5.25E?04 1.76E?03 RFC2 0.66 7.08E?04 2.19E?03 SKA2 0.66 9.09E?05 5.08E?04 TRIM74 0.66 2.58E?04 1.04E?03 LRP6 0.66 3.93E?06 7.37E?05 AARS 0.66 9.65E?06 1.27E?04 ECI1 0.66 1.05E?04 5.61E?04 SHTN1 0.66 8.24E?04 2.44E?03 ABI2 0.66 3.67E?04 1.35E?03 NOL12 0.66 1.89E?03 4.65E?03 NEDD4L 0.66 1.13E?04 5.82E?04 TACC3 0.66 5.87E?05 3.76E?04 BAGE2 0.66 6.50E?04 2.06E?03 MAGOHB 0.66 2.54E?03 5.87E?03 CYB5B 0.66 2.96E?05 2.43E?04 HIBADH 0.66 2.32E?05 2.06E?04 RHPN2 0.66 2.70E?04 1.07E?03 HSP90AA1 0.66 4.37E?06 7.86E?05 TIMM44 0.66 6.82E?06 1.01E?04 CCNG1 0.66 1.49E?06 4.62E?05 ZNF473 0.65 3.55E?05 2.71E?04 FRMD6 0.65 6.31E?05 3.96E?04 NUF2 0.65 2.46E?06 5.82E?05 ST3GAL2 0.65 1.71E?05 1.72E?04 RIMKLB 0.65 7.01E?04 2.18E?03 FBXL5 0.65 5.04E?05 3.38E?04 ALDH3B1 0.65 2.21E?03 5.26E?03 IFITM3 0.65 5.47E?06 8.84E?05 CDC45 0.65 1.01E?03 2.86E?03 EXOSC8 0.65 5.53E?04 1.83E?03 PACSIN3 0.65 1.28E?06 4.28E?05 FAM188B 0.65 2.64E?03 6.06E?03 SOCS5 0.65 1.20E?05 1.42E?04 HELLS 0.65 1.10E?04 5.78E?04 TOB1 0.65 6.36E?04 2.03E?03 FAM64A 0.65 6.92E?05 4.22E?04 TKT 0.65 7.66E?07 3.12E?05 CDCA8 0.65 4.83E?06 8.32E?05 AKR1C3 0.65 8.97E?04 2.60E?03 STK11IP 0.65 7.14E?05 4.30E?04 SLC6A6 0.65 2.47E?03 5.74E?03 CKS2 0.65 5.18E?05 3.44E?04 DAB2 0.65 6.52E?04 2.06E?03 WDR62 0.65 4.35E?05 3.07E?04 BRCA1 0.65 2.84E?04 1.11E?03 MRC2 0.65 3.41E?04 1.27E?03 GINS4 0.65 1.07E?04 5.66E?04 OIP5 0.65 1.34E?03 3.57E?03 DTWD1 0.64 2.47E?03 5.74E?03 GDF11 0.64 1.15E?04 5.91E?04 MMAB 0.64 7.40E?04 2.25E?03 NAT14 0.64 1.78E?03 4.43E?03 ENAH 0.64 1.19E?05 1.42E?04 KDELC2 0.64 1.84E?04 8.17E?04 RFC4 0.64 6.38E?04 2.03E?03 EZH2 0.64 1.93E?04 8.45E?04 ROCK2 0.64 2.98E?06 6.27E?05 ZNF286A 0.64 5.47E?04 1.81E?03 SLC26A2 0.64 2.34E?07 2.12E?05 PRELID3B 0.64 2.37E?05 2.09E?04 PARP2 0.64 4.52E?04 1.58E?03 CIITA 0.64 1.27E?05 1.48E?04 KANK1 0.64 4.25E?05 3.02E?04 DEPDC1B 0.64 1.89E?07 1.88E?05 WDR4 0.64 2.67E?05 2.26E?04 OSMR 0.64 1.89E?03 4.65E?03 TSPAN14 0.64 6.17E?05 3.89E?04 CDCA2 0.64 2.83E?06 6.18E?05 ZNF254 0.64 1.77E?03 4.42E?03 RBBP8 0.64 5.67E?04 1.86E?03 SMG1P2 0.64 4.05E?03 8.49E?03 ECT2 0.64 2.18E?04 9.18E?04 HIST1H4C 0.64 6.89E?04 2.15E?03 DHRS11 0.64 1.66E?04 7.63E?04 ARHGEF39 0.63 4.15E?03 8.67E?03 CENPU 0.63 1.39E?04 6.75E?04 CDCA3 0.63 1.83E?04 8.13E?04 TYRO3 0.63 1.27E?05 1.48E?04 MFSD12 0.63 1.58E?05 1.66E?04 TMA16 0.63 1.96E?05 1.86E?04 CCNH 0.63 2.11E?04 8.95E?04 PRC1 0.63 4.85E?06 8.34E?05 POU2F1 0.63 2.99E?03 6.69E?03 LINC00839 0.63 3.76E?03 8.00E?03 C6orf120 0.63 1.36E?05 1.54E?04 LAPTM4B 0.63 2.61E?06 5.95E?05 GNAQ 0.63 1.67E?04 7.65E?04 MCM7 0.63 2.08E?07 2.00E?05 EGR3 0.63 5.99E?04 1.93E?03 XAGE1B 0.63 1.65E?05 1.68E?04 XAGE1E 0.63 1.65E?05 1.68E?04 ZNF326 0.63 4.75E?04 1.64E?03 SLC2A1 0.63 1.50E?05 1.61E?04 NXPE3 0.63 3.26E?05 2.57E?04 ITPK1 0.63 8.34E?06 1.15E?04 ATAD3B 0.63 1.45E?05 1.58E?04 OMA1 0.63 1.80E?03 4.47E?03 HSD17B4 0.63 1.64E?05 1.68E?04 CMSS1 0.63 4.00E?03 8.42E?03 PLEKHH3 0.63 4.36E?04 1.53E?03 DYRK2 0.63 2.08E?04 8.89E?04 PTEN 0.63 2.23E?06 5.50E?05 MKI67 0.63 1.46E?05 1.58E?04 CSGALNACT1 0.63 1.38E?05 1.55E?04 PARPBP 0.63 2.85E?04 1.11E?03 CEP95 0.63 5.89E?04 1.91E?03 PTPN14 0.63 7.67E?06 1.10E?04 PAICS 0.63 9.06E?06 1.20E?04 KIF18B 0.62 5.90E?05 3.78E?04 ARRB2 0.62 2.98E?03 6.66E?03 CENPK 0.62 4.01E?03 8.43E?03 RACGAP1 0.62 5.23E?06 8.68E?05 BCCIP 0.62 6.21E?05 3.91E?04 NOTCH1 0.62 2.56E?06 5.86E?05 TMPO 0.62 2.55E?05 2.19E?04 MT2A 0.62 3.48E?05 2.68E?04 SLFN12 0.62 2.00E?04 8.61E?04 CXXC5 0.62 6.46E?06 9.81E?05 DGKD 0.62 8.46E?05 4.83E?04 PHGDH 0.62 2.08E?06 5.34E?05 RHBDF1 0.62 1.43E?05 1.57E?04 MMP2 0.62 3.48E?05 2.68E?04 HOXB3 0.62 1.95E?04 8.51E?04 SPAG5 0.62 2.56E?04 1.03E?03 HOXC13 0.62 7.07E?05 4.27E?04 MSH2 0.62 2.72E?05 2.29E?04 NDRG4 0.62 2.26E?04 9.40E?04 KIF23 0.62 7.67E?05 4.51E?04 CNN2 0.62 3.36E?07 2.27E?05 CCNF 0.62 2.92E?05 2.41E?04 TENM3 0.62 5.91E?06 9.34E?05 NCAPD2 0.62 2.32E?08 9.89E?06 HOXA5 0.62 4.70E?04 1.63E?03 PER1 0.61 4.92E?05 3.32E?04 SLC7A5 0.61 1.55E?06 4.67E?05 LOC101927809 0.61 2.65E?03 6.07E?03 MRPL39 0.61 2.01E?04 8.65E?04 TRIT1 0.61 1.20E?04 6.07E?04 AURKB 0.61 1.06E?04 5.65E?04 ITGA3 0.61 6.12E?06 9.48E?05 ITGB5 0.61 3.85E?06 7.27E?05 MTERF1 0.61 2.17E?03 5.18E?03 ARL13B 0.61 1.42E?05 1.57E?04 ORC1 0.61 3.55E?04 1.31E?03 C11orf71 0.61 5.03E?04 1.71E?03 RBMS2 0.61 1.81E?03 4.48E?03 PLEKHO1 0.61 1.80E?04 8.02E?04 FDFT1 0.61 6.24E?05 3.92E?04 GTSE1 0.61 8.02E?05 4.64E?04 POLD3 0.61 3.19E?03 7.07E?03 MIR548XHG 0.61 2.26E?04 9.40E?04 THEM6 0.61 2.60E?04 1.04E?03 FASN 0.61 2.79E?06 6.13E?05 ARHGEF40 0.61 2.02E?05 1.89E?04 PCDH10 0.61 8.11E?04 2.41E?03 HMGN2 0.61 3.57E?05 2.71E?04 SLC7A1 0.61 1.53E?06 4.67E?05 MAPILC3A 0.60 3.60E?03 7.74E?03 RAD51AP1 0.60 6.28E?04 2.01E?03 SNHG4 0.60 1.78E?03 4.42E?03 ARHGAP19 0.60 5.08E?05 3.40E?04 DAP 0.60 9.97E?07 3.67E?05 CDC42EP4 0.60 6.31E?05 3.96E?04 SMAD3 0.60 1.59E?08 8.56E?06 TRIM16L 0.60 5.06E?04 1.71E?03 CSPG4 0.60 3.76E?06 7.17E?05 TBL1X 0.60 3.20E?06 6.54E?05 TEAD4 0.60 1.54E?04 7.26E?04 PSAT1 0.60 1.23E?05 1.46E?04 SCLY 0.60 3.18E?04 1.20E?03 SLC3A2 0.60 1.62E?05 1.67E?04 SSBP4 0.60 2.11E?04 8.96E?04 MEX3A 0.60 4.11E?04 1.46E?03 PTPRJ 0.60 1.70E?04 7.74E?04 PBK 0.60 9.52E?04 2.73E?03 FANCD2 0.60 1.14E?04 5.88E?04 GOT1 0.59 3.03E?05 2.46E?04 IFT81 0.59 2.00E?06 5.19E?05 CENPF 0.59 2.10E?06 5.36E?05 MBNL2 0.59 4.16E?04 1.48E?03 HMMR 0.59 1.56E?04 7.31E?04 B9D1 0.59 9.32E?05 5.17E?04 TGFBR2 0.59 8.25E?05 4.74E?04 ZFP36L2 0.59 4.30E?05 3.04E?04 HMG20B 0.59 3.00E?05 2.45E?04 CDCA7L 0.59 1.25E?05 1.47E?04 TAF5 0.59 4.70E?05 3.25E?04 PPT2 0.59 5.68E?04 1.86E?03 TSPAN12 0.59 2.03E?03 4.92E?03 TSPYL2 0.59 8.43E?07 3.29E?05 SAV1 0.59 7.85E?07 3.14E?05 SIDT2 0.59 1.94E?05 1.84E?04 UACA 0.59 3.10E?05 2.51E?04 BUB1 0.59 6.40E?05 4.00E?04 HPCAL1 0.59 7.53E?07 3.10E?05 CDH19 0.59 5.76E?04 1.88E?03 HPDL 0.59 1.26E?04 6.30E?04 MYH10 0.59 1.75E?06 4.84E?05 COL4A2 0.59 5.44E?07 2.66E?05 RNF157 0.59 2.36E?05 2.08E?04 KIF2C 0.58 1.42E?05 1.57E?04 TRAF1 0.58 1.12E?04 5.82E?04 CT45A3 0.58 3.19E?03 7.06E?03 IFRD1 0.58 4.06E?04 1.45E?03 SHB 0.58 3.14E?04 1.19E?03 C8orf58 0.58 4.47E?05 3.13E?04 KRT8 0.58 6.79E?05 4.17E?04 NLK 0.58 4.49E?05 3.14E?04 NDC80 0.58 2.47E?03 5.75E?03 HOXB6 0.58 3.53E?05 2.70E?04 BLMH 0.58 3.22E?05 2.55E?04 SNX5 0.58 3.34E?05 2.62E?04 MTSS1L 0.58 1.18E?04 5.99E?04 FBXW9 0.58 2.01E?04 8.65E?04 RHOBTB3 0.58 2.28E?05 2.04E?04 CDC25B 0.58 1.12E?06 3.95E?05 ZFP42 0.58 1.36E?03 3.61E?03 KIAA0586 0.58 3.67E?04 1.35E?03 RAI1 0.58 5.30E?06 8.71E?05 MIS18BP1 0.58 2.25E?03 5.33E?03 ADARB1 0.58 2.47E?04 1.00E?03 IFT172 0.58 7.98E?04 2.38E?03 OSBPL10 0.57 7.53E?06 1.09E?04 PXMP2 0.57 6.44E?05 4.01E?04 STK40 0.57 1.33E?05 1.51E?04 SKA3 0.57 8.04E?04 2.39E?03 SPDL1 0.57 1.60E?04 7.43E?04 TGIF2 0.57 1.91E?04 8.39E?04 SOD3 0.57 5.22E?05 3.46E?04 PHF19 0.57 4.14E?04 1.47E?03 METTL7B 0.57 9.95E?05 5.41E?04 LMNB1 0.57 8.93E?05 5.02E?04 AMIGO2 0.57 8.23E?06 1.14E?04 HKR1 0.57 5.34E?04 1.78E?03 PXDC1 0.57 9.21E?05 5.13E?04 PDK4 0.57 1.01E?04 5.48E?04 NEK2 0.57 1.14E?06 3.99E?05 DHCR7 0.57 1.79E?04 8.00E?04 SPATS2L 0.57 1.03E?05 1.30E?04 TPX2 0.57 2.88E?06 6.19E?05 LRIG3 0.57 5.29E?05 3.50E?04 P3H3 0.57 1.03E?05 1.30E?04 NEK6 0.57 1.08E?04 5.69E?04 TK1 0.56 1.08E?05 1.34E?04 SPC24 0.56 2.20E?06 5.45E?05 ECH1 0.56 3.32E?06 6.64E?05 INPP5F 0.56 1.04E?06 3.80E?05 BCAT1 0.56 2.01E?04 8.66E?04 AKR1B1 0.56 1.66E?05 1.68E?04 TSPAN13 0.56 3.32E?05 2.61E?04 SLMO2-ATP5E 0.56 2.98E?03 6.67E?03 SOGA1 0.56 1.67E?05 1.69E?04 PLK1 0.56 1.04E?05 1.30E?04 SSB 0.56 5.33E?05 3.51E?04 PLTP 0.56 3.47E?05 2.68E?04 SERTAD4-AS1 0.56 6.01E?05 3.83E?04 GEMIN2 0.55 1.88E?03 4.62E?03 FAM92A1 0.55 7.69E?04 2.32E?03 VEGFC 0.55 6.85E?04 2.14E?03 DHCR24 0.55 5.07E?07 2.56E?05 BTBD3 0.55 4.03E?05 2.92E?04 SGCE 0.55 3.01E?03 6.72E?03 ADM 0.55 2.37E?03 5.56E?03 FARP1 0.55 7.91E?05 4.61E?04 TMPRSS5 0.55 1.55E?03 4.00E?03 KIF11 0.55 7.29E?07 3.07E?05 TWIST1 0.55 8.79E?04 2.56E?03 CCNA2 0.55 3.45E?05 2.67E?04 TPD52L1 0.55 1.55E?03 4.00E?03 TFB1M 0.55 4.29E?04 1.51E?03 NES 0.54 1.03E?06 3.76E?05 LOC105369647 0.54 1.44E?04 6.90E?04 CENPA 0.54 5.48E?05 3.59E?04 GNAS 0.54 7.69E?07 3.12E?05 ARHGEF3 0.54 3.42E?05 2.66E?04 MYO1B 0.54 1.28E?05 1.48E?04 BTD 0.54 8.68E?04 2.53E?03 ZFPM2-AS1 0.54 1.80E?03 4.48E?03 TACC2 0.54 4.17E?05 2.99E?04 ZBTB18 0.54 5.40E?06 8.78E?05 CUTC 0.54 1.69E?04 7.73E?04 NUSAP1 0.54 1.44E?05 1.58E?04 RCAN1 0.54 2.10E?05 1.93E?04 CTNNBIP1 0.53 4.78E?05 3.27E?04 SNX10 0.53 1.13E?04 5.84E?04 SSFA2 0.53 9.17E?06 1.21E?04 BAG2 0.53 1.06E?04 5.63E?04 EGR1 0.53 9.90E?05 5.39E?04 TNFRSF19 0.53 1.65E?05 1.68E?04 WWP2 0.53 1.61E?05 1.67E?04 DEPDC1 0.53 1.10E?04 5.77E?04 QKI 0.53 2.87E?04 1.12E?03 CCNB2 0.53 2.50E?05 2.15E?04 HSDL2 0.53 5.89E?06 9.32E?05 ACSS2 0.53 3.90E?05 2.88E?04 AKAP2 0.52 5.78E?05 3.73E?04 STAG3L5P-PVRIG2P- 0.52 5.64E?04 1.85E?03 PILRB DOCK4 0.52 5.18E?05 3.44E?04 FNBP1L 0.52 1.66E?05 1.69E?04 GPC1 0.52 3.67E?05 2.76E?04 VEGFA 0.52 1.28E?04 6.37E?04 KIF15 0.52 1.12E?04 5.82E?04 ELMO1 0.52 8.90E?05 5.01E?04 PHC2 0.52 1.70E?06 4.78E?05 TMEM135 0.52 8.62E?05 4.90E?04 PCDH7 0.52 1.39E?04 6.74E?04 TNFRSF21 0.52 2.73E?06 6.08E?05 BMP8B 0.52 2.49E?04 1.01E?03 SNHG1 0.52 4.75E?04 1.64E?03 ST5 0.51 2.19E?04 9.20E?04 STX3 0.51 2.66E?04 1.06E?03 COL4A1 0.51 2.62E?08 9.89E?06 PSRC1 0.51 2.75E?06 6.08E?05 PFKFB3 0.51 2.28E?05 2.04E?04 FAM84B 0.51 1.16E?05 1.40E?04 TNC 0.51 4.25E?06 7.73E?05 CDH2 0.51 5.80E?06 9.21E?05 NECTIN3 0.51 2.48E?05 2.14E?04 DOK1 0.50 8.82E?05 4.98E?04 CDKN3 0.50 3.14E?03 6.97E?03 GAS7 0.50 5.98E?07 2.78E?05 ASB9 0.50 2.24E?05 2.02E?04 SREBF1 0.50 3.57E?06 6.94E?05 ANKRD50 0.50 7.31E?06 1.07E?04 KIF20A 0.50 7.43E?06 1.08E?04 FTH1 0.50 2.47E?07 2.12E?05 CDC20 0.50 4.25E?06 7.73E?05 LINC00923 0.50 5.59E?04 1.84E?03 ACACA 0.49 1.06E?07 1.51E?05 IGF2BP3 0.49 5.25E?06 8.68E?05 RARA 0.49 1.93E?04 8.46E?04 NR1H3 0.49 4.69E?04 1.62E?03 AURKA 0.49 1.17E?05 1.41E?04 ETNK2 0.49 9.46E?06 1.25E?04 PTX3 0.49 8.56E?04 2.51E?03 SNHG12 0.49 4.11E?04 1.46E?03 CEP70 0.49 8.49E?04 2.49E?03 ME1 0.48 1.45E?05 1.58E?04 PALLD 0.48 7.73E?05 4.54E?04 COL12A1 0.48 5.43E?07 2.66E?05 TPM1 0.48 3.47E?06 6.78E?05 ITGA1 0.48 1.19E?05 1.42E?04 LEF1 0.48 1.23E?04 6.19E?04 WDR35 0.48 4.29E?05 3.04E?04 SLC2A3 0.48 4.76E?05 3.26E?04 RASSF8 0.48 2.77E?07 2.17E?05 CAMK2D 0.48 5.28E?05 3.49E?04 SPON2 0.48 8.68E?05 4.92E?04 TNS2 0.48 8.20E?05 4.72E?04 SMAD6 0.47 1.37E?04 6.67E?04 HACL1 0.47 3.54E?06 6.88E?05 TTC8 0.47 3.15E?03 6.99E?03 TGFA 0.47 7.99E?07 3.17E?05 DDIT3 0.47 5.55E?04 1.83E?03 FZD2 0.47 8.75E?05 4.95E?04 SYTL5 0.47 1.21E?05 1.43E?04 DNM1 0.47 5.23E?06 8.68E?05 DHRS3 0.47 1.37E?06 4.42E?05 SCD 0.46 3.65E?07 2.32E?05 RUNX3 0.46 7.06E?06 1.04E?04 MARCKS 0.46 5.47E?05 3.58E?04 LOXL2 0.46 3.46E?07 2.29E?05 HR 0.46 6.49E?06 9.84E?05 TNFSF9 0.46 4.19E?04 1.48E?03 SHROOM2 0.46 1.64E?06 4.75E?05 IERSL 0.46 1.42E?05 1.57E?04 CDCA7 0.45 1.54E?04 7.26E?04 PDE1C 0.45 1.55E?06 4.67E?05 LBR 0.45 1.03E?05 1.30E?04 NOX4 0.45 3.08E?04 1.18E?03 ZNF92 0.45 1.07E?04 5.67E?04 LOC101929322 0.45 5.70E?05 3.69E?04 NCOA7 0.45 8.92E?06 1.20E?04 PLA2G16 0.44 2.94E?05 2.42E?04 LPCAT3 0.44 1.32E?05 1.50E?04 PRSS23 0.44 1.56E?06 4.67E?05 CPT1A 0.44 8.10E?05 4.68E?04 RAMP1 0.44 1.49E?05 1.60E?04 FTL 0.44 3.12E?07 2.21E?05 CLIP2 0.44 7.00E?07 3.00E?05 LY6K 0.43 5.96E?06 9.37E?05 CNN3 0.43 6.52E?07 2.89E?05 UQCC1 0.43 5.64E?05 3.67E?04 SPATA6 0.43 5.05E?04 1.71E?03 COL5A2 0.42 1.70E?06 4.79E?05 TLE4 0.42 3.62E?05 2.73E?04 MYOF 0.42 4.13E?07 2.43E?05 SYNM 0.42 1.70E?05 1.71E?04 GALNT10 0.42 3.97E?05 2.90E?04 ITGA6 0.42 4.07E?07 2.42E?05 ZEB2 0.42 4.45E?04 1.56E?03 COL6A1 0.42 8.29E?06 1.15E?04 NO01 0.42 2.92E?06 6.19E?05 FOSL2 0.41 2.31E?05 2.05E?04 DNAH9 0.41 1.25E?04 6.27E?04 AK4 0.41 3.41E?05 2.66E?04 ERO1B 0.41 2.22E?04 9.26E?04 WWTR1 0.41 1.58E?08 8.56E?06 ACAA2 0.41 8.76E?06 1.18E?04 LOC105369782 0.41 2.43E?03 5.67E?03 B3GNT7 0.41 4.19E?05 3.00E?04 TBC1D4 0.41 3.68E?06 7.09E?05 MDK 0.40 3.07E?06 6.38E?05 ERBB3 0.40 1.10E?05 1.35E?04 MIR4435-2HG 0.40 8.52E?05 4.86E?04 MEIS2 0.40 5.09E?06 8.59E?05 SYNPO 0.40 1.43E?05 1.57E?04 MGAT5B 0.40 1.25E?05 1.47E?04 ZCCHC24 0.40 1.68E?06 4.78E?05 LINC00152 0.39 1.57E?04 7.34E?04 SEMA3C 0.39 7.49E?07 3.10E?05 IMPA2 0.39 1.03E?04 5.55E?04 RHOF 0.39 3.42E?05 2.66E?04 CNTRL 0.39 1.12E?06 3.95E?05 S100B 0.39 4.17E?05 2.99E?04 PYROXD2 0.39 4.08E?04 1.45E?03 TRIM62 0.38 5.44E?06 8.81E?05 USP53 0.38 1.26E?05 1.48E?04 FLRT3 0.37 3.08E?06 6.38E?05 PPP2R3A 0.37 6.72E?06 1.00E?04 MICAL3 0.36 8.02E?07 3.17E?05 ANXA1 0.36 3.27E?08 1.05E?05 SOCS3 0.36 1.40E?05 1.56E?04 DDIT4 0.36 1.57E?07 1.73E?05 TLR4 0.36 1.46E?08 8.56E?06 NID1 0.36 8.81E?07 3.39E?05 KIRREL 0.36 7.65E?08 1.25E?05 TANC2 0.36 2.24E?05 2.02E?04 FAM129A 0.36 1.19E?06 4.10E?05 ARHGAP23 0.36 5.26E?06 8.68E?05 TPT1-AS1 0.36 1.39E?04 6.74E?04 LOC105371703 0.35 1.36E?03 3.60E?03 KIF21B 0.35 3.38E?06 6.69E?05 EMP2 0.35 1.84E?05 1.78E?04 NFATC2 0.35 1.63E?06 4.75E?05 EPHB3 0.35 1.85E?05 1.79E?04 HOXB9 0.35 3.61E?05 2.72E?04 SNCA 0.34 1.56E?05 1.65E?04 AIM1 0.34 6.10E?06 9.47E?05 TIAM1 0.34 3.25E?06 6.59E?05 LMCD1 0.34 1.42E?05 1.57E?04 TINAGL1 0.34 1.48E?07 1.73E?05 BCAR3 0.33 7.03E?06 1.04E?04 SERPINE2 0.33 2.17E?06 5.42E?05 KIAA1217 0.33 2.51E?06 5.85E?05 PCDHGC3 0.33 7.93E?06 1.13E?04 EXTL1 0.33 1.82E?06 4.92E?05 HIVEP3 0.33 3.97E?06 7.38E?05 IL1RAP 0.32 8.94E?06 1.20E?04 AJUBA 0.32 4.35E?08 1.17E?05 TGM2 0.31 1.10E?06 3.92E?05 PIR 0.31 1.22E?05 1.44E?04 PLEKHA4 0.31 6.07E?06 9.46E?05 C1orf106 0.30 1.52E?04 7.18E?04 POU3F2 0.30 4.73E?05 3.26E?04 EYA1 0.30 4.43E?06 7.94E?05 SDC3 0.30 1.85E?06 4.95E?05 COTL1 0.29 1.41E?07 1.71E?05 MAF 0.29 4.51E?06 7.98E?05 FAM46B 0.29 1.27E?05 1.48E?04 PDP1 0.29 5.98E?06 9.38E?05 GPNMB 0.29 8.05E?06 1.13E?04 CNTNAP3B 0.29 1.10E?06 3.92E?05 ADAMTS12 0.29 1.51E?05 1.62E?04 FOXD3 0.28 3.25E?05 2.56E?04 RAB20 0.28 1.49E?05 1.60E?04 TRIB2 0.27 9.23E?07 3.51E?05 PTPRF 0.26 3.36E?07 2.27E?05 GDF15 0.26 1.26E?04 6.29E?04 CDC42EP3 0.26 1.53E?09 3.61E?06 TESC 0.26 1.25E?05 1.47E?04 DMRT2 0.24 4.15E?05 2.98E?04 PTGES 0.24 4.53E?07 2.47E?05 AFAP1 0.23 2.38E?07 2.12E?05 KRT80 0.23 1.56E?06 4.67E?05 S100A3 0.23 6.46E?04 2.05E?03 C10orf90 0.22 3.25E?05 2.56E?04 WNK4 0.22 9.75E?08 1.41E?05 THBS1 0.22 8.67E?08 1.36E?05 LOXL3 0.21 4.70E?08 1.23E?05 LINC00473 0.20 3.96E?05 2.90E?04 KLF9 0.20 8.42E?07 3.29E?05 MEOX2 0.19 3.30E?06 6.64E?05 PLK2 0.19 1.16E?06 4.05E?05 MOXD1 0.19 7.58E?06 1.09E?04 FAM20C 0.18 5.36E?07 2.64E?05 LZTS1 0.17 2.93E?06 6.20E?05 ABCC2 0.17 5.14E?06 8.64E?05 SERPINA3 0.16 4.19E?06 7.69E?05 TNS3 0.16 1.21E?08 8.56E?06 ADORA2B 0.16 1.18E?07 1.62E?05 CPA4 0.14 3.22E?05 2.55E?04 F2R 0.13 1.54E?07 1.73E?05 EPS8 0.13 4.47E?07 2.46E?05 LIMCH1 0.13 1.28E?06 4.28E?05 AGMO 0.13 4.29E?06 7.79E?05 ANKRD1 0.12 1.79E?05 1.76E?04 MGAM2 0.11 1.84E?08 8.62E?06 CDKN1C 0.11 2.99E?07 2.21E?05 LOXL4 0.10 6.14E?06 9.50E?05 FST 0.07 2.55E?06 5.86E?05 LOC102723854 0.07 2.70E?04 1.07E?03 HAPLN1 0.05 5.87E?09 5.95E?06 NGFR 0.04 7.56E?08 1.25E?05 SEMA6B 0.04 8.98E?07 3.43E?05 NNMT 0.03 6.72E?07 2.95E?05 LOC105372338 0.03 2.13E?05 1.95E?04

    TABLE-US-00010 TABLE 7 Co-IP followed by mass spectrometry characterization of B3GNT2 target genes. Alternate MW N-term N-term C-term C-term Alternate MW N-term N-term C-term C-term Accession Number ID kDa IgG FLAG IgG flag Accession Number ID kDa IgG FLAG IgG flag NP_006568.2 B3GNT2 46 0 130 0 132 NP_001265398.1 (+7) MON2 186 0 0 0 3 NP_006077.2 TUBB3 50 0 115 0 82 NP_872590.1 PCNA 29 0 3 0 0 NP_001060.1 TUBB2A 50 0 128 0 0 NP_001180499.1 (+1) CSRP1 20 0 0 0 3 NP_001290453.1 TUBB6 50 0 63 0 42 NP_002262.4 (+1) IPO5 124 0 0 0 3 NP_003312.3 TUFM 50 0 56 0 26 NP_066964.1 XRCC5 83 0 0 0 3 NP_006073.2 TUBA1B 50 0 76 0 0 NP_006861.1 DSTN 19 0 0 0 3 NP_003290.1 HSP90B1 92 0 9 0 56 NP_002782.1 PSMA6 27 0 3 0 0 NP_733765.1 ATP2A2 115 0 8 0 45 NP_002800.2 PSMD3 61 0 3 0 0 NP_005304.3 PDIA3 57 0 14 0 24 NP_006494.1 PSMC4 47 0 3 0 0 NP_006614.2 PHGDH 57 0 29 0 7 NP_004658.3 (+3) HERC2 527 0 0 0 3 NP_006079.1 TUBB4B 50 0 161 13 119 NP_001120869.1 (+2) ERLEC1 52 0 0 0 3 NP_008835.5 PRKDC 469 0 24 0 11 NP_001350685.1 (+3) ECPAS 204 0 3 0 0 NP_001627.2 SLC25A6 33 0 15 0 19 XP_011541145.1 ATM 334 0 3 0 0 NP_817092.1 PPM1G 59 0 9 0 22 NP_005207.2 DDOST 51 0 0 0 3 NP_060555.2 IPO9 116 0 6 0 24 NP_001307539.1 (+3) CHCHD6 27 0 0 0 3 NP_006380.1 (+1) HYOU1 111 0 0 0 27 NP_001153682.1 (+5) SLC25A13 74 0 3 0 0 NP_001269241.1 FAM3A 25 0 9 0 18 NP_006088.2 MYL9 20 0 3 0 0 NP_004334.1 CALR 48 0 6 0 20 NP_002793.2 PSMC1 49 0 3 0 0 NP_000909.2 P4HB 57 0 3 0 23 NP_001035933.3 (+2) SUMF2 34 0 0 0 3 NP_001035109.1 FAM3C 25 0 2 0 23 NP_001000.2 RPS5 23 3 4 0 6 NP_821133.1 TUBB 50 10 164 10 117 NP_005800.3 PRDX2 22 5 9 0 5 NP_001186600.1 (+1) CALU 38 0 10 0 13 NP_859048.1 PRDX1 22 5 8 0 6 NP_000692.2 (+2) ATP1A1 113 0 11 0 12 NP_003236.3 TGM3 77 2 9 3 5 NP_001258766.1 (+1) RCN2 39 0 7 0 16 NP_001269091.1 CAPZB 34 2 2 0 5 NP_001142.2 SLC25A4 33 0 9 0 14 NP_002643.1 PIP 17 0 4 2 3 NP_057226.1 (+1) HSD17B12 34 0 10 0 10 NP_001009.1 RPS15 17 5 7 2 11 NP_078934.3 IPO4 119 0 3 0 17 NP_000977.1 RPL24 18 4 4 3 14 NP_006450.2 ERLIN1 39 0 11 0 9 NP_001007.2 RPS12 15 0 3 4 8 NP_001269633.1 (+4) PDIA6 54 0 5 0 14 NP_036246.1 CASP14 28 3 8 4 9 NP_006827.1 GCN1 293 0 14 0 4 NP_000997.1 RPS3A 30 9 12 10 29 NP_003891.1 SQSTM1 48 0 3 3 43 NP_001030168.1 RPL14 23 7 11 8 21 NP_036555.1 RPL13A 24 0 4 0 13 NP_000980.1 RPL30 13 6 8 4 14 NP_001349807.1 ERLIN2 38 0 8 0 9 NP_000967.1 RPL12 18 4 9 5 11 NP_001350924.1 CANX 71 0 6 0 11 NP_001002.1 RPS7 22 2 8 5 8 NP_003357.2 UQCRC2 48 0 13 0 4 NP_000975.2 RPL23A 18 3 6 4 10 NP_006816.2 CKAP4 66 0 2 0 14 NP_001004.2 RPS9 23 3 2 0 6 NP_000993.1 RPLPO 34 0 6 0 10 NP_006187.2 PCBP1 37 0 4 3 4 NP_001530.1 DNAJA1 45 0 6 0 10 NP_006126.1 (+1) CAPZA1 33 0 2 0 0 NP_068758.3 (+1) FKBP10 64 0 0 0 16 NP_002323.2 (+1) LRP1 505 0 2 0 0 NP_005338.1 HSPA5 72 9 70 12 130 NP_009175.2 PRR4 15 0 2 0 0 NP_000971.1 RPL18A 21 0 3 0 12 NP_001026854.1 (+1) SRSF7 27 0 2 0 0 NP_001273432.1 (+3) HSPH1 92 0 8 0 7 NP_002924.1 RNASE1 18 0 0 0 2 NP_001130000.1 (+1) SERPINE2 44 0 4 0 11 XP_016858423.1 CEP170 176 0 0 0 2 NP_001888.2 CSPG4 251 0 2 0 12 NP_004516.2 LRP2 522 0 0 0 2 NP_005879.1 (+1) SLC25A3 40 0 4 0 9 NP_005900.2 MAP1B 271 0 0 0 2 NP_001243463.1 SLC25A1 35 0 5 0 8 NP_002777.1 (+1) PSMA1 30 0 2 0 0 NP_115587.6 (+1) LOXL4 84 0 5 0 8 NP_002130.2 RBMX 42 0 0 0 2 NP_001317145.1 (+1) CNP 45 0 5 0 7 NP_001292553.1 CALM2 22 0 0 0 2 NP_001017958.1 (+3) OS9 74 0 3 0 9 NP_001230106.1 (+1) ALDOA 45 0 2 0 0 NP_005753.1 (+1) TRIM28 89 0 4 0 8 XP_016873867.1 RAB1B 26 0 0 0 2 NP_001303963.1 (+3) DPM1 33 0 4 0 8 NP_536350.2 (+3) GNAS 111 0 0 0 2 NP_001284644.1 (+3) SMN1 30 0 10 2 14 NP_690601.1 ARPC2 34 0 0 0 2 NP_573566.2 (+1) LRPPRC 158 0 2 0 9 NP_000282.1 PGK1 45 0 0 0 2 NP_064508.3 (+1) TM9SF3 68 0 0 0 11 NP_056009.1 (+1) MYO1D 116 0 0 0 2 NP_005372.2 NCL 77 0 0 0 11 NP_001263347.1 (+15) SEC16A 249 0 2 0 0 NP_001257817.1 (+1) SLC25A10 32 0 5 0 6 NP_001020262.1 (+1) ABCF1 96 0 0 0 2 NP_002151.2 (+4) TNC 241 0 0 0 10 NP_002780.1 PSMA4 29 0 2 0 0 NP_000983.1 (+1) RPL29 18 0 4 0 6 NP_002282.2 (+1) LAMB1 198 0 0 0 2 XP_024308303.1 HLA-A 48 0 6 0 4 NP_000933.1 PPIB 24 0 0 0 2 NP_002256.2 KPNB1 97 0 3 0 7 NP_006808.1 ERP29 29 0 2 0 0 NP_004199.1 (+1) AIFM1 67 0 5 0 5 NP_112233.2 SFXN3 36 0 0 0 2 NP_001341088.1 ACSL3 80 0 5 0 5 NP_001177990.1 SLC25A22 34 0 0 0 2 NP_001290043.1 (+2) TUBA1C 58 8 76 14 63 NP_001191791.1 ELOC 12 0 0 0 2 NP_001240312.1 RPL15 24 0 6 2 15 NP_001316381.1 (+2) NTPCR 21 0 0 0 2 NP_001258901.1 (+1) HSP90AB1 82 0 10 2 11 NP_001306165.1 RPL34 13 0 0 0 2 NP_001001.2 RPS6 29 2 11 2 20 NP_001128582.1 (+1) DNAJA3 50 0 0 0 2 NP_612510.1 (+2) TECR 36 0 0 0 9 NP_002781.2 PSMA5 26 0 2 0 0 NP_001164014.1 (+1) PGAM5 32 0 4 0 5 NP_001339250.1 (+6) LARP4 63 0 0 0 2 NP_001158886.1 (+1) LDHA 40 0 5 0 4 NP_002794.1 PSMC2 49 0 2 0 0 NP_002892.1 RCN1 39 0 0 0 9 NP_001193496.1 (+3) IFI16 83 0 0 0 2 NP_001164006.1 (+2) ATAD3A 66 0 0 0 9 NP_001001520.1 (+4) HDGFL2 74 0 0 0 2 NP_060908.1 FBXO6 34 0 4 0 5 NP_001070151.1 (+3) UBTF 85 0 0 0 2 NP_006382.1 IPO7 120 0 0 0 9 NP_006017.1 H1FX 22 0 0 0 2 XP_006716248.1 PDIA4 73 0 0 0 9 NP_002787.2 PSMB4 29 0 2 0 0 NP_001352542.1 RRBP1 152 0 2 2 16 XP_006719595.1 (+5) PXN 121 0 2 0 0 NP_001952.1 EEF2 95 0 3 0 5 NP_001072989.1 (+5) KTN1 156 0 0 0 2 NP_005446.2 ZRANB2 36 0 5 0 3 NP_055866.1 ERP44 47 0 0 0 2 NP_002789.1 PSMB6 25 0 5 0 3 NP_006691.1 TRAFD1 65 0 0 0 2 NP_001309856.1 (+1) STAU1 56 0 2 0 6 NP_000024.2 ABCD1 83 0 0 0 2 NP_938148.1 (+1) GANAB 107 0 0 0 8 NP_001157852.1 (+4) STAU2 63 0 0 0 2 NP_001021.1 RPS27 9 0 2 0 6 NP_055634.3 PJA2 78 0 0 0 2 NP_001407.1 EIF4A1 46 0 2 0 6 NP_001243028.1 (+1) CTHRC1 25 0 0 0 2 XP_005268045.1 SEL1L 87 0 3 0 5 NP_001138586.1 (+4) RRP12 137 0 0 0 2 NP_001651.1 ARF4 21 0 4 0 4 NP_000173.2 HADHA 83 0 0 0 2 NP_001341935.1 (+1) NPM1 33 0 0 0 8 NP_001185771.1 (+1) CCT2 53 0 0 0 2 NP_001143.2 SLC25A5 33 6 19 3 30 NP_004981.2 MARS 101 0 2 0 0 NP_002147.2 HSPD1 61 0 10 2 6 NP_001243.1 CD70 21 0 0 0 2 NP_002435.1 (+2) MSN 68 0 3 0 4 NP_055467.3 IPO13 108 0 0 0 2 NP_001074419.1 MYO1C 120 0 4 0 3 NP_001159757.1 (+1) CCT7 55 0 0 0 2 NP_001007074.1 RPL32 16 0 0 0 7 XP_024306583.1 (+1) ARHGEF2 104 0 0 0 2 NP_001186757.1 SPRR1A 10 0 4 0 3 NP_115497.4 MAGT1 42 0 0 0 2 NP_036350.2 (+2) ILF3 95 0 2 0 5 NP_005085.2 SLC27A4 72 0 0 0 2 NP_001350420.1 ZC3HAV1 114 0 3 0 4 NP_001278795.1 (+1) GALNT2 61 0 0 0 2 NP_001020092.1 (+1) RPL9 22 0 0 0 7 NP_001336864.1 (+1) TOR1AIP2 51 0 0 0 2 NP_057260.2 (+2) SDF4 42 0 0 0 7 NP_001317621.1 (+1) PSMD4 41 0 2 0 0 NP_002635.2 PIGR 83 0 2 0 5 NP_002878.2 RARS 75 0 0 0 2 NP_004437.2 EPRS 171 0 3 0 4 NP_000978.1 RPL26 17 5 7 4 12 NP_064505.1 (+3) UGGT1 177 0 2 0 5 NP_001344872.1 (+1) GAPDH 34 11 18 6 16 NP_057390.1 DNAJB11 41 0 3 0 4 NP_000998.1 RPS4X 30 12 14 7 23 NP_002941.1 RPN1 69 0 0 0 7 XP_016882687.1 UBA52 22 5 4 7 20 NP_009109.3 STRAP 38 0 4 0 3 NP_000230.1 LYZ 17 4 3 0 6 NP_003135.2 SSR1 32 0 3 0 4 NP_001025180.1 RPS15A 15 2 3 2 6 XP_016875611.1 (+1) YBX3 40 0 0 0 7 NP_001419.1 ENO1 47 2 5 2 4 NP_000995.1 RPLP2 12 3 6 0 13 NP_002955.2 S100A8 11 4 15 5 3 NP_002956.1 S100A9 13 0 18 5 9 NP_001019380.2 SPRR2E 8 3 16 5 0 NP_009035.3 RPL10A 25 4 6 0 16 NP_112420.1 HNRNPA1 39 4 7 4 9 NP_001435.1 FABP5 15 2 6 0 8 NP_000549.1 HBA1 15 3 3 0 4 NP_066357.3 RPL36A 12 2 3 0 11 NP_001900.1 CTSD 45 3 3 0 4 NP_001254792.1 (+1) SLIRP 12 0 0 0 6 NP_001091676.1 HNRNPF 46 0 0 3 7 NP_000984.1 (+2) RPL31 14 0 0 0 6 NP_000973.2 RPL21 19 5 8 5 11 NP_066953.1 PPIA 18 0 6 0 0 NP_001186731.1 RPL11 20 3 5 3 7 NP_001294857.1 (+3) SERPINB12 48 0 4 0 2 NP_001611.1 AHNAK 629 0 3 2 2 NP_663723.1 YWHAZ 28 0 2 0 4 NP_000356.1 (+2) TPI1 27 2 3 0 2 NP_000987.2 RPL35A 13 0 0 0 6 NP_001006.1 RPS11 18 8 13 9 18 NP_378669.1 RPL36 12 0 0 0 6 NP_001393.1 EEF1A1 50 8 13 5 11 NP_001238978.1 (+3) PCMT1 30 0 4 0 2 NP_009176.2 ATXN2L 113 3 5 2 5 NP_003132.2 TRIM21 54 0 6 0 0 NP_001264069.1 (+1) ACTR3 42 3 3 2 7 NP_001677.2 ATP5F1B 57 0 2 0 4 NP_001012.1 RPS17 16 3 5 5 10 NP_061185.1 RCC2 56 0 0 0 6 NP_001308051.1 LTF 77 6 8 2 7 NP_009135.4 DDX20 92 0 0 0 6 NP_001308412.1 RPS19 16 5 5 3 10 NP_001291972.1 TMEM59 36 0 6 0 0 NP_001003.1 RPS8 24 7 6 6 17 NP_002783.1 PSMA7 28 0 4 0 2 NP_003008.1 SRSF3 19 4 6 3 7 NP_005871.1 DNAJA2 46 0 3 0 3 NP_000989.1 RPL37A 10 4 6 3 7 XP_011518263.1 MTCH2 30 0 4 0 2 NP_001001414.1 NCCRP1 31 4 4 0 4 NP_003137.1 (+3) SSRP1 81 0 0 0 6 NP_001278086.1 EIF4G1 171 2 2 2 6 NP_000960.2 RPL5 34 0 0 0 6 NP_002943.2 RPS2 31 10 13 12 24 NP_000203.2 ITGB3 87 0 3 0 3 NP_005498.1 CFL1 19 3 5 3 6 NP_001350066.1 (+2) MTDH 67 0 0 0 6 NP_000036.2 (+1) ARG1 35 4 8 4 6 NP_001304663.1 (+2) PBXIP1 78 0 2 0 4 NP_001107018.1 (+1) LIMA1 85 3 4 0 2 NP_000981.1 RPL27A 17 3 7 0 10 NP_003320.2 TXN 12 3 3 0 3 NP_000958.1 RPL3 46 3 8 5 25 NP_072045.1 RPS18 18 11 15 9 18 NP_000972.1 (+1) RPL19 23 2 8 2 11 NP_001016.1 RPS23 16 6 9 9 16 NP_114032.2 HNRNPU 91 2 0 0 12 NP_001011.1 RPS16 16 10 9 8 20 NP_009140.1 RPL35 15 2 7 0 5 NP_005208.1 (+1) DEFA3 10 3 5 5 8 NP_005312.1 HIST1H1E 22 2 6 0 6 NP_008855.1 SRSF1 28 5 4 3 9 NP_001255.4 CDSN 52 0 5 0 0 NP_203754.2 TNKS1BP1 182 4 2 2 8 NP_000974.1 RPL22 15 0 0 0 5 NP_001531.1 HSPB1 23 4 3 0 4 NP_001001522.1 TAGLN 23 0 2 0 3 NP_001008.1 RPS13 17 2 3 2 4 NP_001294869.1 (+2) POF1B 69 0 5 0 0 NP_000108.1 EMD 29 0 2 2 2 NP_061865.1 KCTD5 26 0 2 0 3 NP_005608.1 RPS14 16 9 11 10 18 NP_000168.1 (+9) GSN 86 0 2 0 3 NP_000990.1 RPL38 8 5 9 6 8 NP_000631.1 IL13RA2 44 0 3 0 2 NP_001093639.1 (+3) IMMT 84 17 23 16 26 NP_001348.2 DHX9 141 0 0 0 5 NP_705935.1 TPM3 29 5 6 2 5 XP_011532005.1 (+6) MAP4 248 0 0 0 5 NP_001035972.1 LGALS7B 15 4 7 3 4 NP_056536.2 (+2) GEMIN4 120 0 0 0 5 NP_004930.1 DDX1 82 2 7 5 4 NP_008977.1 EMILIN1 107 0 2 0 3 NP_001304106.1 (+1) CHCHD3 27 10 16 11 15 NP_001185845.1 (+1) PPFIBP1 110 0 2 0 3 NP_002007.1 FLG 435 20 29 15 22 NP_057195.2 (+1) TELO2 92 0 2 0 3 NP_002954.2 S100A7 11 2 3 3 5 NP_036585.1 TBL2 50 0 0 0 5 NP_001153148.1 (+1) SYNCRIP 63 6 2 4 13 NP_005989.3 CCT3 61 0 0 0 5 XP_011516977.1 LCN1 32 9 11 6 11 NP_006089.1 RACK1 35 0 2 0 3 NP_003741.1 EIF3A 167 3 2 0 3 NP_001339204.1 (+4) RHOT2 68 0 3 0 2 NP_057342.2 YTHDF2 62 4 5 2 4 NP_001186307.1 (+13) GBF1 206 0 0 0 5 NP_001170884.1 RPS27A 18 11 8 14 27 NP_001304711.1 RPL8 28 3 10 3 15 NP_000969.1 RPL23 15 5 7 4 6 NP_000962.2 RPL7 29 5 10 3 21 NP_005959.2 (+1) HNRNPM 78 5 6 5 8 NP_001350626.1 RPL28 19 3 8 3 16 NP_663780.2 SYNM 173 5 5 2 5 NP_001020.2 RPS26 13 4 6 0 11 NP_001193725.1 (+3) PKM 66 2 3 2 3 NP_008850.1 SERPINB3 45 3 10 2 9 XP_016864497.1 SYNPO 122 4 4 4 7 NP_059118.2 CALML5 16 0 0 0 4 NP_004550.2 YBX1 36 3 2 5 9 NP_001288155.1 TPM2 33 0 0 0 4 NP_00159506.1 (+2) SBSN 61 25 27 15 25 NP_000509.1 HBB 16 0 4 0 0 NP_000350.1 TGM1 90 9 17 10 8 NP_004986.1 MMP14 66 0 2 0 2 NP_001317259.1 (+2) LUC7L3 58 2 4 3 3 NP_002779.1 (+1) PSMA3 28 0 4 0 0 NP_001135757.1 RPS24 32 4 0 2 8 NP_002284.3 LAMC1 178 0 0 0 4 NP_001186273.1 (+1) RPL17 21 0 3 2 0 NP_001296372.1 (+1) SPARC 35 0 0 0 4 NP_005850.1 PURA 35 2 0 0 3 NP_002788.1 PSMB5 28 0 4 0 0 P0AA25.2 NA 12 3 7 8 7 NP_001294853.1 (+1) NAP1L1 45 0 0 0 4 NP_055987.2 (+10) PRRC2C 309 11 6 6 15 NP_001116307.2 (+5) TTC13 91 0 0 0 4 NP_001129512.1 (+5) CPSF7 52 8 12 9 9 NP_000293.2 (+1) PLOD1 84 0 0 0 4 P01837.1 NA 12 87 89 108 146 NP_006657.1 RUVBL2 51 0 0 0 4 NP_006266.2 SRSF6 40 3 6 5 4 NP_009166.2 XPOT 110 0 2 0 2 NP_001339702.1 JUP 82 39 47 36 43 NP_001276332.1 (+9) MMS19 108 0 4 0 0 NP_001180345.1 (+1) DDX3X 73 19 18 15 23 NP_001352606.1 (+3) P4HA2 61 0 0 0 4 NP_001014.1 (+1) RPS20 13 4 4 5 7 NP_001027017.1 (+3) CPT1A 86 0 2 0 2 NP_001091974.1 DDX17 80 23 23 22 30 NP_004362.2 COPA 138 0 2 0 2 NP_001351158.1 (+2) HNRNPH1 51 11 11 11 15 NP_003391.1 (+3) XPO1 123 0 2 0 2 NP_016868724.1 PUF60 63 5 6 5 6 NP_001014842.1 (+1) TM9SF1 55 0 0 0 4 NP_005711.1 ARPC1B 41 2 0 2 5 NP_000963.1 RPL7A 30 4 8 5 22 XP_006319.1 RBM14 69 4 3 0 2 NP_001307067.1 RPL6 33 5 10 4 20 NP_001275582.1 (+2) CLTC 192 6 6 5 7 NP_001019850.1 C1orf68 26 0 13 4 2 NP_001305115.1 (+1) HNRNPK 49 8 9 10 12 NP_000959.2 RPL4 48 11 15 6 36 NP_00546.2 KRT6B 60 316 370 295 331 NP_006588.1 HSPA8 71 16 41 15 49 NP_001743.1 CAT 60 2 6 3 0 NP_002263.3 KRT4 56 21 22 0 37 NP_002128.1 (+1) HNRNPA2B1 36 4 7 9 8 NP_000970.1 RPL18 22 5 11 7 24 NP_002810.1 (+4) PRBP1 60 7 6 6 9 NP_001290554.1 RPL10 25 3 4 3 15 NP_733821.1 LMNA 74 11 11 18 22 NP_000968.2 RPL13 24 6 15 8 23 NP_004629.3 (+1) PRRC2A 229 3 2 3 5 NP_689557.1 LSM12 22 2 4 0 4 NP_002964.3 ATXN2 140 3 4 3 3 NP_006251.1 (+4) DNAJC3 58 0 0 0 3 NP_001273001.1 (+1) MOV10 107 3 4 3 3 NP_001123910.1 (+10) SPTAN1 285 0 0 0 3 NP_003925.1 (+2) FUBP3 62 8 8 7 9 NP_076956.1 GGCT 21 0 3 0 0 NP_001307526.1 DDX5 69 18 16 16 22 NP_056195.3 SAMM50 52 0 3 0 0 NP_065823.1 NUFIP2 76 3 3 4 5 NP_056988.3 EIF5B 139 0 0 0 3 NP_055662.3 (+3) UBAP2L 115 20 20 15 19 NP_00108494.1 (+1) PUM1 127 0 0 0 3 NP_005745.1 G3BP1 52 29 27 25 33 NP_001022.1 RPS28 8 0 0 0 3 NP_001310351.1 (+3) RBM39 56 5 4 3 5 NP_001243064.1 (+2) CSE1L 104 0 0 0 3 NP_001035202.1 (+4) MYH11 224 3 2 5 7 NP_000174.1 (+3) HADHB 51 0 0 0 3 NP_001243731.1 (+1) RPS3 27 13 10 17 23 NP_001609.2 PARP1 113 0 0 0 3 NP_001018077.1 (+1) SERBP1 45 4 0 5 10 NP_001185709.1 (+1) ARPC4 22 0 0 0 3 NP_001186883.1 ACTG1 42 103 82 71 107 NP_113584.3 (+11) HUWE1 482 0 3 0 0 NP_001988.1 FAU 14 6 5 5 7 NP_009123.1 (+1) SUPT16H 120 0 0 0 3 NP_002559.2 PABPC1 71 37 31 30 41 NP_003192.1 TFAM 29 0 0 0 3 NP_005889.3 (+1) CAPRIN1 78 6 7 6 6 NP_003748.1 EIF3I 37 0 0 0 3 NP_001287876.1 (+3) CPSF6 63 28 30 33 35 NP_803182.1 MAGED2 65 0 0 0 3 NP_003478.1 (+1) TAF15 62 10 5 4 10 NP_003125.3 SRP14 15 0 0 0 3 NP_006550.1 KHDRBS1 48 10 9 7 9 NP_031385.2 CASC3 76 0 3 0 0 NP_001604.1 (+2) ACTA2 42 77 64 63 81 NP_000353.1 TIMP3 24 0 0 0 3 NP_003371.2 VIM 54 452 402 337 411 NP_110379.2 TCP1 60 0 0 0 3 NP_001002858.1 (+1) ANXA2 40 15 17 16 15

    Methods

    Sequences and Cloning

    [0479] The plasmids lenti dCAS-VP64_Blast (Addgene 61425), lenti sgRNA(MS2)_zeo backbone (Addgene 61427), and lentiMPHv2 (Addgene 89308) were used for CRISPR-Cas9 activation. The human SAM CRISPR activation library (Addgene 1000000057) was used for CRISPR-Cas9 activation screening. LentiCRISPRv2 (Addgene 52961) was used for CRISPR-Cas9 knockout. The Cas9 in lentiCRISPRv2 was replaced with dCas9-KRAB (Addgene 46911) and the Puromycin resistance gene was replaced with Blasticidin resistance gene (Addgene 75112) for CRISPR-Cas9 knockdown. Single guide RNA (sgRNA) spacer sequences used in this study are listed in Table 8, and were cloned into the respective vectors as previously described (Joung et al., 2017). The NY-ESO-1 T cell receptor (TCR) clone 1G4 (Robbins et al., 2008), AXL chimeric antigen receptor (CAR) (Cho et al., 2018), and HER2 CAR (Cho et al., 2018) were synthesized and cloned into the pHR TCR vector (Addgene 89347). The respective ORFs of candidate genes [CD274 (NM_014143), MCL1 (NM_021960), JUNB (NM_002229), and B3GNT2 (NM_006577)] were synthesized and cloned into the plasmid pLX_TRC209 (Broad Genetic Perturbation Platform) for overexpression. HLA-A2 (Addgene 85162), ESO:HLA-A2, and Gaussia luciferase were cloned into pLX_TRC209 for stable expression. For dox-inducible upregulation, the EF1a promoter in pLX_TRC209 was replaced with the pTight promoter (Addgene 31877) and the plasmid pUltra-puro-RTTA3 (Addgene 58750) was used for rtTA.

    TABLE-US-00011 TABLE8 ListofsgRNAsusedinthestudy. sgRNAID,perturbation,target sequences,andtargetgenes. Target sgRNA Targetsequence gene ID Perturbation (5to3) CTAG1A/B sg1 knockout GCGGGGTCCGCATGGCGGCG (SEQIDNO:20) CTAG1A/B sg2 knockout CAGAATACAACTCAAGCAGG (SEQIDNO:21) CTAG1A/B sg3 knockout GAATGGATGCTGCAGATGCG (SEQIDNO:22) CD274 sg1 activation CTGACCTTCGGTGAAATCGG (SEQIDNO:23) CD274 sg2 activation TCAGTTTAGGTATCTAGTGT (SEQIDNO:24) CD274 sg3 activation CTATACACAGCTTTATTCCT (SEQIDNO:25) MCL1 sg1 activation CATGGAAAGAGCTCGAGCCC (SEQIDNO:26) MCL1 sg2 activation CACTCAGAGCCTCCGAAGAC (SEQIDNO:27) MCL1 sg3 activation CGGAGCCGCCGTTACGTAAC (SEQIDNO:28) JUNB sg1 activation CCCCTCCTCGAGCGTGGGGA (SEQIDNO:29) JUNB sg2 activation AGGCGGCTCGCGTCACTGTC (SEQIDNO:30) JUNB sg3 activation GCGCGTGTCCTTGTAAACAG (SEQIDNO:31) B3GNT2 sg1 activation GCCGCAGGGAGCGCGGGCCC (SEQIDNO:32) B3GNT2 sg2 activation GTGGGTCCTGGTACCGGGTG (SEQIDNO:33) B3GNT2 sg3 activation CGGAACCCTCCCAAAACTTG (SEQIDNO:34) CD274 sg1 knockdown AGCAGCTGGCGCGTCCCGCG (SEQIDNO:35) CD274 sg2 knockdown TCGGGAAGCTGCGCAGAACT (SEQIDNO:36) MCL1 sg1 knockdown AGCTTCCGGAGGGTTGCGCA (SEQIDNO:37) MCL1 sg2 knockdown CCTTTATCACGGTTTTAGGG (SEQIDNO:38) JUNB sg1 knockdown CTGGGACCTTGAGAGCGGCC (SEQIDNO:39) JUNB sg2 knockdown TATCGCGCCAGAGAGGGCGA (SEQIDNO:40) B3GNT2 sg1 knockdown CTGCGCCTCACTCCAGGCTC (SEQIDNO:41) B3GNT2 sg2 knockdown GGAGTGAGGCGCAGCGGCAG (SEQIDNO:42) BCL2A1 sg1 knockdown TACGCACGAAAGTGACTAGG (SEQIDNO:43) BCL2A1 sg2 knockdown ACATGATGATACATGGAGGC (SEQIDNO:44) BCL2A1 sg3 knockdown GGCTCACCTTGAAGCTGTTG (SEQIDNO:45) BCL2A1 sg4 knockdown TCAAGACTTTGCTCTCCACC (SEQIDNO:46) CD276 sg1 knockdown GCGGCTCCGGTGCGTCCCTG (SEQIDNO:47) CD276 sg2 knockdown GCGTCCCTGAGTCCCAGAGT (SEQIDNO:48) CD274 sg1 knockout ACATGTCAGTTCATGTTCAG (SEQIDNO:49) CD274 sg2 knockout GGTTCCCAAGGACCTATATG (SEQIDNO:50) MCL1 sg1 knockout AGTCGCTGGAGATTATCTCT (SEQIDNO:51) MCL1 sg2 knockout CCAAAAGTCGCCCTCCCGGG (SEQIDNO:52) JUNB sg1 knockout CCGGAGTCTCAAAGCGCCTG (SEQIDNO:53) JUNB sg2 knockout GGGTAAAAGTACTGTCCCGG (SEQIDNO:54) B3GNT2 sg1 knockout CAACGCAGGGAACCAAACGG (SEQIDNO:55) B3GNT2 sg2 knockout GGTTCCAGTATGCCTCGGGA (SEQIDNO:56) TNFSF9 sg1 knockout CCCATCGATCAGCAGAACTG (SEQIDNO:57) TNFSF9 sg2 knockout GCCAGCCCGAGACTCCGCGA (SEQIDNO:58) TNFSF9 sg3 knockout GGGGGGCCTGAGCTACAAAG (SEQIDNO:59) TNFSF9 sg4 knockout TCAACTAGAGCTGCGGCGCG (SEQIDNO:60) Non- sg1 CTGAAAAAGGAAGGAGTTGA targeting (SEQIDNO:61) Non- sg2 AAGATGAAAGGAAAGGCGTT targeting (SEQIDNO:62)

    Cell Culture

    [0480] HEK293FT cells (Thermo Fisher Scientific R70007) were maintained in high-glucose DMEM with GlutaMax and pyruvate (Thermo Fisher Scientific 10569010) supplemented with 10% fetal bovine serum (VWR 97068-085) and 1% penicillin/streptomycin (Thermo Fisher Scientific 15140122). Cells were passaged every other day at a ratio of 1:4 or 1:5 using TrypLE Express (Thermo Fisher Scientific 12604021).

    [0481] All cancer cell lines [A375 melanoma (NY-ESO-1+, HLA-A2+; Millipore Sigma 88113005-1VL), H1793 non-small cell lung adenocarcinoma (NY-ESO-1+, HLA-A2-; ATCC CRL-5896), H1299 non-small cell lung carcinoma (NY-ESO-1+, HLA-A2; ATCC CRL-5803), LN-18 glioblastoma (NY-ESO-1+, HLA-A2+; ATCC CRL-2610), SK-N-AS neuroblastoma (NY-ESO-1+, HLA-A2; ATCC CRL-2137), A2058 melanoma (NY-ESO-1.sup.+, HLA-A2; ATCC CRL-11147), OAW28 ovarian cystadenocarcinoma (NY-ESO-1.sup.+, HLA-A2; Millipore Sigma 85101601-1VL), and SW1417 colorectal adenocarcinoma (NY-ESO-1, HLA-A2; ATCC CCL-238)] were maintained in RPMI 1640 with Glutamax (Thermo Fisher Scientific 61870127) supplemented with 10% fetal bovine serum and 1% penicillin/streptomycin. Cells were passaged every other day at a ratio of 1:3 to 1:6 using TrypLE Express.

    [0482] Leukopaks from anonymous healthy normal donors (purchased from MGH under an IRB-exempt protocol) are processed using the Ficoll-based RosetteSep Human T Cell Enrichment Cocktail (StemCell Technologies 15061). Isolated CD4.sup.+ and CD8+ T cells were frozen in FBS with 10% DMSO with 20-50?10.sup.6 cells per vial. Once thawed, T cells were maintained in RPMI 1640 with Glutamax (Thermo Fisher Scientific 61870127) supplemented with 10% fetal bovine serum, 1% penicillin/streptomycin, and 20 IU/mL IL-2 (Stemcell Technologies 78036.3). T cells were activated and expanded for 1 week using CD3/CD28 Dynabeads (Thermo Fisher Scientific 11132D). Beads were removed with 2 rounds of magnetic separation and T cells were frozen down (for in vitro cytotoxicity assays) or cultured for 1 week without beads (for adoptive cell transfer). CD4.sup.+ or CD8.sup.+ T cells were further purified using EasySep selection kits (StemCell Technologies 17852 and 17853 respectively) to assess the resistance of candidate genes against cytotoxicity produced from each T cell type. Each experiment with T cells was performed using T cells derived from 2-4 unique donors.

    Lentivirus Production and Transduction

    [0483] One day prior to transfection, HEK293FT cells were seeded at ?40% confluency in T25, T75, or T225 flasks (Thermo Fisher Scientific 156367, 156499, or 159934). Cells were transfected the next day at ?90-99% confluency. For each T25 flask, 3.4 ?g of plasmid containing the vector of interest, 2.6 ?g of psPAX2 (Addgene 12260), and 1.7 ?g of pMD2.G (Addgene 12259) were transfected using 17.5 ?L of Lipofectamine 3000 (Thermo Fisher Scientific L3000150), 15 ?L of P3000 Enhancer (Thermo Fisher Scientific L3000150), and 1.25 mL of Opti-MEM (Thermo Fisher Scientific 31985070). Transfection parameters were scaled up linearly with flask area for T75 and T225 flasks. Media was changed 5 h after transfection. Virus supernatant was harvested 48 h post-transfection, filtered with a 0.45 ?m PVDF filter (MilliporeSigma SLHV013SL), and concentrated as described previously when necessary (Joung et al., 2017). Virus supernatant was then aliquoted and stored at ?80? C.

    [0484] Cancer cell lines were transduced by spinfection or mixing as described previously (Joung et al., 2017). For mixing, 3?10.sup.6 cells were seeded in a T75 flask with 8 ?g/mL Polybrene (Millipore Sigma TR-1003-G) and the appropriate volume in lentivirus. After 1 day, media was refreshed with the appropriate antibiotic and cells were maintained under antibiotic selection for 5 days. Concentrations for selection agents were determined using a kill curve: 300 ?g/mL Hygromycin (Thermo Fisher Scientific 10687010), 10 ?g/mL Blasticidin (Thermo Fisher Scientific A1113903), 300 ?g/mL Zeocin (Thermo Fisher Scientific R25001), and 1 ?g/mL Puromycin (Thermo Fisher Scientific A1113803). T cells were transduced after 1 day of activation by mixing 1?10.sup.6 cells in 1 mL media with 8 ?g/mL Polybrene and lentivirus in each well of a 24-well plate (Millipore Sigma CLS3527-100EA). Transduction efficiency of T cells was measured by sorting 1?10.sup.6 cells for GFP expression on the TCR vector after 7 days of activation. T cells used for experiments had transduction efficiencies of 80-90%.

    T Cell Cytotoxicity Assays

    [0485] Expanded T cells were thawed and maintained in culture media for 8-10 h before incubation with cancer cells. Cancer cells were seeded in 96-well plates and allowed to attach for 3-4 h before T cells were added at the appropriate effector to target cell (E:T) ratio. Paired controls with no T cells added were included for each condition. After 18 h, cancer cells were washed twice with PBS to remove T cells, passaged, and cultured for 2 days. Primary patient-derived cell models were not passaged after T cell co-culture. Viability was measured using CellTiter-Glo (Promega G7571). For each E:T ratio, percent survival was calculated as viability of the cells incubated with T cells divided by viability of the paired control that was not incubated with T cells. For example, CD274-overexpressing melanoma cells that were co-cultured with ESO T cells were compared to CD274-overexpressing melanoma cells that were cultured without T cells in parallel. As an alternative cytotoxicity assay, A375 cells stably expressing Gaussia luciferase were co-cultured with ESO T cells. At each time point, 10% of cell culture media was used for the Gaussia luciferase assay (Targeting Systems GAR-2B) to directly measure cytotoxicity.

    CRISPRa Screen for Resistance to T Cell Cytotoxicity

    [0486] The CRISPRa screen was performed as described previously (Joung et al., 2017) using A375 melanoma cells. For the acute exposure screen, A375 cells transduced with the genome-scale human CRISPR activation library components were co-cultured with T cells expressing the NY-ESO-1 TCR, unmodified T cells, or no T cells at E:T ratio of 3. Each screen contained two replicates with T cells from different donors. After 18 h of co-culture, cells were washed twice with PBS to remove T cells, passaged, and cultured for 2 days before genomic DNA was harvested. For the chronic exposure screen, A375 cells were co-cultured with T cells expressing the NY-ESO-1 TCR or no T cells at E:T ratio of 2. Screening replicates used T cells from the same donor and each round of screening selection used T cells from different donors. After 3 days of co-culture, cells were washed twice with PBS to remove T cells, passaged, and cultured for 2 days before seeding for the next round of screening selection. After 3 rounds of screening selection, genomic DNA was harvested. MAGeCK RRA analysis (Li et al., 2014) was used to analyze the screens and identify candidate genes. A set of 576 candidate genes that ranked in the top 1% and overlapped at least two screening replicates (combining the acute and chronic exposure screens) were used for pathway and cytolytic activity analyses. The FDR of screening results was estimated using a set of 311 negative control housekeeping genes consisting of ribosomal proteins, RNA polymerases, translation factors, mitochondrial ribosomal proteins, GAPDH, and ACTB (Table 2). For each screening replicate, the FDR of each candidate gene was measured as the fraction of negative control genes with higher average sgRNA enrichment than the candidate gene. To validate the top four candidate genes from the screens, sgRNAs targeting candidate genes from the genome-scale library were individually cloned and transduced into A375 cells. Validation was performed using T cell cytotoxic assays at an E:T ratio of 3 as described above.

    Pathway Enrichment Analysis

    [0487] Pathway enrichment analysis of the top 576 candidate genes was performed using g:Profiler (Raudvere et al., 2019). GO:BP pathways with between 5 and 200 genes that were significantly enriched (FDR<0.05) were included. To identify non-overlapping pathways, the enriched pathways were sorted by FDR and any pathway that had more than 30% genes overlapping a different pathway with lower FDR was excluded.

    The Cancer Genome Atlas (TCGA) Analysis

    [0488] TCGA copy number variation and RNA-seq data was downloaded from the Firehose Broad GDAC (gdac.broadinstitute.org/) using the TCGA2STAT package for R (Wan et al., 2016). The RNA-seq data was normalized using RSEM and log 2 transformed. Local tumor immune cytolytic activity was determined as the geometric mean of granzyme A (GZMA) and perforin 1 (PRF1) RNA-seq expression was used to assess cytolytic activity as described previously (Patel et al., 2017; Rooney et al., 2015). For each gene in the TCGA RNA-seq dataset, the Pearson's correlation between cytolytic activity and expression was calculated. Significance was evaluated using Fisher transformation of Pearson's correlation followed by Benjamini-Hochberg procedure to determine the FDR. For visualization, heatmaps with hierarchical clustering using Ward's linkage were generated using Python's Seaborn clustermap (github.com/mwaskom/seaborn/).

    [0489] For prevalence of increased expression and copy number of the top four candidate genes, TCGA RNA-seq data (https://www.cancer.gov/tcga) was analyzed using GEPIA (Tang et al., 2017). TCGA tumor samples were matched with TCGA normal and GTEx data and filtered for |log 2(fold change)|?1. Genes were considered significantly differentially expressed if the p-value was greater than 0.05 FDR correction. Copy number variation was reported using the NCI Genomic Data Commons (Grossman et al., 2016).

    Indel Analysis

    [0490] Cells plated in 96-well plates were grown to 60-80% confluency and assessed for indel rates as previously described (Joung et al., 2017). Genomic DNA was harvested from cells using QuickExtract DNA Extraction kit (Lucigen QE09050). The genomic region flanking the site of interest was amplified using NEBNext High Fidelity 2?PCR Master Mix (New England BioLabs M0541L), first with region-specific primers (Table 9) for 15 cycles and then with barcoded primers for 15 cycles as previously described. PCR products were sequenced on the Illumina MiSeq platform (>10,000 reads per condition), and indel analysis was performed as previously described (Joung et al., 2017).

    TABLE-US-00012 TABLE9 Primersforindelamplificationandquantification. Targetgene sgRNAID Primer Sequence(5to3) CTAG1A/B sg1 Fwd CTTTCCCTACACGACGCTCTTCCGATCTGGGCAGCAAG GGCCTC(SEQIDNO:63) CTAG1A/B sg1 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTGCTCTC CGGCCCCCT(SEQIDNO:64) CTAG1A/B sg2 Fwd CTTTCCCTACACGACGCTCTTCCGATCTTCAGGGCTGA ATGGATGCTG(SEQIDNO:65) CTAG1A/B sg2 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTTGCCCT CCCCATCTCCC(SEQIDNO:66) CTAG1A/B sg3 Fwd CTTTCCCTACACGACGCTCTTCCGATCTGGGCAGCAAG GGCCTC(SEQIDNO:67) CTAG1A/B sg3 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTGCCCCC ACCTCGCCA(SEQIDNO:68) CD274 sg1 Fwd CTTTCCCTACACGACGCTCTTCCGATCTTGTTTATGTC CTAGCCCCATAC(SEQIDNO:69) CD274 sg1 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTCTTGAT GGTCACTGCTTGTCC(SEQIDNO:70) CD274 sg2 Fwd CTTTCCCTACACGACGCTCTTCCGATCTAAACGCTGTG CCAATTTTGTAAATG(SEQIDNO:71) CD274 sg2 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTGACAAT TAGTGCAGCCAGGTCTA(SEQIDNO:72) MCL1 sg1 Fwd CTTTCCCTACACGACGCTCTTCCGATCTGGAGTTGGTC GGGGAATCTG(SEQIDNO:73) MCL1 sg1 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTCAACCC GTCGTAAGGTCTCC(SEQIDNO:74) MCL1 sg2 Fwd CTTTCCCTACACGACGCTCTTCCGATCTAAAAGAAACG CGGTAATCGGAC(SEQIDNO:75) MCL1 sg2 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTGCGCTT CCGCCAATCAC(SEQIDNO:76) JUNB sg1 Fwd CTTTCCCTACACGACGCTCTTCCGATCTGGCCTCTCTC TACACGACTAC(SEQIDNO:77) JUNB sg1 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTCAGCTC CGAAGAGGCGAG(SEQIDNO:78) JUNB sg2 Fwd CTTTCCCTACACGACGCTCTTCCGATCTATTGTCCCCA ACAGCAACGG(SEQIDNO:79) JUNB sg2 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTTTGTGC AGATCGTCCAGGGC(SEQIDNO:80) B3GNT2 sg1 Fwd CTTTCCCTACACGACGCTCTTCCGATCTTGCTGGCGAT TAAGTCCCTC(SEQIDNO:81) B3GNT2 sg1 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTATCTGA AAGGTCGGGGTGGT(SEQIDNO:82) B3GNT2 sg2 Fwd CTTTCCCTACACGACGCTCTTCCGATCTTCTCCAAAAG CAGTAGCCAAG(SEQIDNO:83) B3GNT2 sg2 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTTATATT GGAGAGCCTGCCCG(SEQIDNO:84) TNFSF9 sg1 Fwd CTTTCCCTACACGACGCTCTTCCGATCTTCTTTTCTCC CAGGGCTGC(SEQIDNO:85) TNFSF9 sg1 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTCTTTGT AGCTCAGGCCCCC(SEQIDNO:86) TNFSF9 sg2 Fwd CTTTCCCTACACGACGCTCTTCCGATCTTTCCTCGCCT GCCCCT(SEQIDNO:87) TNFSF9 sg2 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTGCCGCA GGTCCAAGAGG(SEQIDNO:88) TNFSF9 sg3 Fwd CTTTCCCTACACGACGCTCTTCCGATCTACAAAGAGGA CACGAAGGAGC(SEQIDNO:89) TNFSF9 sg3 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTCCCCAG CAGCAGAGCG(SEQIDNO:90) TNFSF9 sg4 Fwd CTTTCCCTACACGACGCTCTTCCGATCTTTTCCTCCCA CAGTTCTGCTGAT(SEQIDNO:91) TNFSF9 sg4 Rev GACTGGAGTTCAGACGTGTGCTCTTCCGATCTCGCAGC TCTAGTTGAAAGAAGACA(SEQIDNO:92)
    qPCR Quantification of Transcript Expression

    [0491] Cells were seeded in 96-well plates and grown to 60-90% confluency before RNA was reverse transcribed for qPCR as described previously (Joung et al., 2017). TaqMan qPCR was performed with custom [B3GNT2-Fwd (GGGCAGGCTCTCCAATATAAG (SEQ ID NO: 93)), B3GNT2-probe (/56-FAM/TGAACTACT/Zen/GCGAACCTGACCTGA/3IABKFQ/(SEQ ID NO: 94)), B3GNT2-Rev (GGCATCTCAAATACAGCAGAAAG (SEQ ID NO: 95))] or readymade probes from Thermo Fisher Scientific [CD274 (Hs00204257_m1), MCL1 (Hs01050896_ml), JUNB (Hs00357891_s1), BID (Hs00609632_m1), PMAIP1 (Hs00560402_m1), BBC3 (Hs00248075_m1), BAD (Hs00188930_m1), BAX (Hs00180269_m1), BAKI (Hs00832876_g1), BCL2A1 (Hs06637394_s1), CD276 (Hs00987207_m1)].

    Adoptive Cell Transfer and In Vivo Validation

    [0492] The designs of animal studies and procedures were approved by the Institutional Animal Care and Use Committee (IACUC) of the Broad Institute. Ethical compliance with IACUC protocols and institute standards was maintained. Specific pathogen-free facilities at the Broad Institute was used for the storage and care of all mice. Female NSG mice (strain 005557) aged 4-6 weeks were purchased from The Jackson Laboratory and used for tumor induction experiments. A375 cells were transduced with dox-inducible candidate genes. NSG mice were subcutaneously injected with 1?10.sup.6 A375 cells. After 2 days of tumor xenograft implantation, mice were switched to 1,000 mg/kg doxycycline diet (Envigo TD.05298). At 7 days after tumor implantation, for the adoptive cell transfer conditions, 2?10.sup.7 ESO T cells were intravenously injected in a blinded manner. Each tumor was measured every 2 days beginning on day 7 after ACT until the survival endpoint was reached. Measurements were assessed manually using the longest dimension (length) and the longest perpendicular dimension (width). Tumor volume was estimated with the formula: (L?W.sup.2)/2. Mice with tumor volumes greater than 2,000 mm.sup.3 were euthanized. CO.sub.2 inhalation was used to euthanize mice. No statistical methods were used to predetermine sample size. Sample size was determined based on prior knowledge of the variability of experiments with ACT. Animals were randomized before treatment and no blinding was performed for tumor measurements.

    Bulk RNA Sequencing and Data Analysis

    [0493] RNA from cells plated in 24-well plates and grown to 60-90% confluency was harvested using the RNeasy Plus Mini Kit (Qiagen 74134). RNA-seq libraries were prepared using NEBNext Ultra RNA Library Prep Kit for Illumina (New England Biolabs E7530S) and deep sequenced on the Illumina NextSeq platform (>9 million reads per biological replicate). Bowtie (Langmead et al., 2009) index was created based on the human hg38 UCSC genome and RefSeq transcriptome. Next, RSEM v1.3.1 (Li and Dewey, 2011) was run with command line options --estimate-rspd--bowtie-chunkmbs 512--paired-end to align paired-end reads directly to this index using Bowtie and estimate expression levels in transcripts per million (TPM) based on the alignments.

    [0494] To identify genes that were differentially expressed as a result of ORF overexpression, RSEM's TPM estimates for each transcript were transformed to log-space by taking log 2(TPM+1). Transcripts were considered detected if their expression level was equal to or above 10. All genes detected in at least three libraries were used to find differentially expressed genes. The Student's t-test was performed on the TF ORF overexpression condition against GFP control condition. Only genes that were significant (p-value pass 0.01 FDR correction) were reported.

    Chromatin Immunoprecipitation with Sequencing (ChIP-Seq)

    [0495] Cells were plated in 10-cm cell culture dishes and grown to 60-80% confluency. For each condition, two biological replicates were harvested for ChIP-seq. Formaldehyde (Millipore Sigma 252549) was added directly to the growth media for a final concentration of 1% and cells were incubated at 37? C. for 10 mins to initiate chromatin fixation. Fixation was quenched by adding 2.5 M glycine (Millipore Sigma G7126) in PBS for a final concentration of 125 mM glycine and incubated at room temperature for 5 mins. Cells were then washed with ice-cold PBS, scraped, and pelleted at 1,000?g for 5 mins.

    [0496] Cell pellets were prepared for ChIP-seq using the Epigenomics Alternative Mag Bead ChIP Protocol v2.0 (Consortium, 2004). Briefly, cell pellets were resuspended in 100 ?L of lysis buffer (1% SDS, 10 mM EDTA, 50 mM Tris-HCL pH 8.1) containing protease inhibitor cocktail (Millipore Sigma 05892791001) and incubated for 10 mins at 4? C. Then 400 ?L of dilution buffer (0.01% SDS, 1.1% Triton X-100, 1.2 mM EDTA, 16.7 mM Tris-HCl pH 8.1, and 167 mM NaCl) containing protease inhibitor cocktail was added. Samples were pulse sonicated with 2 rounds of 10 mins (30s on-off cycles, high frequency) in a rotating water bath sonicator (Diagenode Bioruptor) with 5 mins on ice between each round. 10 ?L of sonicated sample was set aside as input control. Then 500 ?L of dilution buffer (0.01% SDS, 1.1% Triton X-100, 1.2 mM EDTA, 16.7 mM Tris-HCl pH 8.1, and 167 mM NaCl) containing protease inhibitor cocktail and 1 ?L of anti-FLAG (Millipore Sigma F3165-1MG) was added to the sonicated sample. ChIP samples were rotated end over end overnight at 4? C.

    [0497] For each ChIP, 50 ?L of Protein A/G Magnetic Beads (Thermo Fisher Scientific 88802) was washed with 1 mL of blocking buffer (0.5% TWEEN and 0.5% BSA in PBS) containing protease inhibitor cocktail twice before resuspending in 100 ?L of blocking buffer. ChIP samples were transferred to the beads and rotated end over end for 1 h at 4? C. ChIP supernatant was then removed and the beads were washed twice with 200 ?L of RIPA low salt buffer (0.1% SDS, 1% Triton x-100, 1 mM EDTA, 20 mM Tris-HCl pH 8.1, 140 mM NaCl, 0.1% DOC), twice with 200 ?L of RIPA high salt buffer (0.1% SDS, 1% Triton x-100, 1 mM EDTA, 20 mM Tris-HCl pH 8.1, 500 mM NaCl, 0.1% DOC), twice with 200 ?L of LiCI wash buffer (250 mM LiCl, 1% NP40, 1% DOC, 1 mM EDTA, 10 mM Tris-HCl pH 8.1), and twice with 200 ?L of TE (10 mM Tris-HCl pH8.0, 1 mM EDTA pH 8.0). ChIP samples were eluted with 50 ?L of elution buffer (10 mM Tris-HCl pH 8.0, 5 mM EDTA, 300 mM NaCl, 0.1% SDS). 40 ?L of water was added to the input control samples. 8 ?L of reverse cross-linking buffer (250 mM Tris-HCl pH 6.5, 62.5 mM EDTA pH 8.0, 1.25 M NaCl, 5 mg/ml Proteinase K, 62.5 ?g/ml RNAse A) was added to the ChIP and input control samples and then incubated at 65?C for 5 h. After reverse crosslinking, samples were purified using 116 ?L of SPRIselect Reagent (Beckman Coulter B23318).

    [0498] ChIP samples were prepared for NGS with NEBNext Ultra II DNA Library Prep Kit for Illumina (New England Biolabs E7645S) and deep-sequenced on the Illumina NextSeq platform (>60 million reads per condition). Bowtie (Langmead et al., 2009) was used to align paired-end reads to the human hg38 UCSC genome with command line options q-X 300sam chunkmbs 512. Next, biological replicates were merged and Model-based Analysis of ChIP-seq (MACS) (Feng et al., 2012) was run with command line options -g hs-B-Smfold 6,30 to identify TF peaks. HOMER (Heinz et al., 2010) was used to discover motifs in the TF peak regions identified by MACS. TFs were considered potential regulators of a candidate gene if the TF peak region identified by MACS overlapped with the 20 kb region centered around the transcriptional start site of the candidate gene based on RefSeq annotations.

    Co-Immunoprecipitation (Co-IP) and Mass Spectrometry

    [0499] Cells were plated in 10-cm cell culture dishes and grown to 60-80% confluency. For each condition, two biological replicates were harvested for co-IP. Cells were washed with PBS and 4 mL of lysis buffer (20 mM HEPES, 1% Triton X-100, 150 mM NaCl, 1 mM EDTA, and 10% glycerol) containing protease inhibitor cocktail was added. Cells were scraped and lysate was incubated at 4? C. under rotary agitation for 1 h. Lysate was centrifuged at 14,000?g for 10 min at 4? C. Supernatant was transferred to a new tube and an aliquot was taken as the input. The remaining lysate was split into two tubes for the FLAG and IgG control conditions. For mass spectrometry, 10 ?g/mL Mouse Anti-FLAG (Millipore Sigma F3165-1MG) and IgG control (Millipore Sigma 12-371) were added to the respective conditions. For Western blots, 10 ?g/mL Chicken Anti-FLAG (Aves labs ET-DY100) and IgY control (R&D Systems AB-101-C) antibodies were biotinylated (Thermo Fisher Scientific 90407) and added to the respective conditions. Lysates with antibodies were incubated at 4? C. under rotary agitation overnight. For each mL of lysate, 50 ?L of Pierce Protein A/G Magnetic Beads (Mass spectrometry; Thermo Fisher Scientific 88803) or Pierce Streptavidin Magnetic Beads (Western blot; Thermo Fisher Scientific 88817) was washed twice with lysis buffer. Lysates with antibodies were added to the beads and incubated at 4? C. under rotary agitation for 4 h. Beads were washed with lysis buffer 3 times and resuspended in lysis buffer for storage.

    [0500] Magnetic beads were resuspended in 100 mM Tris pH 7.8, reduced, alkylated and digested with trypsin at 37? ? C. overnight. This solution was subjected to solid phase extraction to concentrate the peptides and remove unwanted reagents followed by injection onto a Shimadzu HPLC with fraction collector. Eight fractions were collected and after concentration were injected on a Waters NanoAcquity HPLC equipped with a self-packed Aeris 3 ?m C18 analytical column 0.075 mm by 20 cm, (Phenomenex). Peptides were eluted using standard reverse-phase gradients. The effluent from the column was analyzed using a Thermo Orbitrap Elite mass spectrometer (nanospray configuration) operated in a data dependent manner for 54 minutes. The resulting fragmentation spectra were correlated against the known database using Proteome Discover 1.4 (Thermo Fisher Scientific). Scaffold Q+S (Proteome Software) was used to provide consensus reports for the identified proteins.

    Cytokine Assays

    [0501] To challenge cells with cytokines, cells were incubated with Interferon-? (IFN?; Cell Signaling Technology 80385S), FasL (AdipoGen AG-40B-0130-3010), TRAIL (R&D Systems 375-TL-010), or TNF-? (AdipoGen AG-40B-0019-3010) for 24 h. TRAIL was crosslinked by incubating with anti-His Tag antibody (Thermo Fisher Scientific MA121315, 1:500) for 15 min at room temperature. Cell viability was measured using CellTiter-Glo (Promega G7571) and protein was harvested for Western blots. For evaluating Caspase 8 activity, cells were incubated with FasL or crosslinked TRAIL for 3 h and harvested for Western blot or Caspase 8 colorimetric assay (R&D Systems K113-100). IFN? in the cell culture media of the T cell cytotoxic assay was quantified using an ELISA kit (Thermo Fisher Scientific KHC4021).

    Small Molecule Inhibition

    [0502] For glycosylation inhibition, cells were treated with 20 ?g/mL Kifunensine (Cayman Chemical 10009437) or 2 mM Benzyl 2-acetamido-2-deoxy-alpha-D-galactopyranoside (BAG; Millipore Sigma B4894-100MG) for 48 h to inhibit N- and O-glycosylation respectively unless otherwise indicated. For MCL1 inhibition, cells were treated with 1-10 ?M of S63845 (Selleck Chemicals S8383) or AZD5991 (Selleck Chemicals S8643) for 4 h before incubation with T cells. Both glycosylation and MCL1 inhibitors were maintained at indicated concentrations during co-culture with T cells.

    Western Blot

    [0503] Protein lysates were harvested with RIPA lysis buffer (Cell Signaling Technologies 9806S) containing protease inhibitor cocktail (MilliporeSigma 05892791001). Samples were standardized for protein concentration using the Pierce BCA protein assay (VWR 23227), and incubated at 70?C for 10 mins under reducing conditions. To determine presence of glycosylation, samples were treated with Protein Deglycosylation Mix II (O- and N-deglycosylation; New England Biolabs P6044S) or PNGase F (N-deglycosylation; New England Biolabs P0704L). After denaturation, samples were separated by Bolt 4-12% Bis-Tris Plus Gels (Thermo Fisher Scientific NW04125BOX) and transferred onto a PVDF membrane using iBlot Transfer Stacks (Thermo Fisher Scientific IB401001).

    [0504] Blots were blocked with 5% BLOT-QuickBlocker (G Biosciences 786-011) in TBST for 1 h at room temperature. Blots were then probed with different primary antibodies [phospho-NF-?B p65 Ser536 (Cell Signaling Technology 3033S, 1:1,000), NF-?B p65 (Santa Cruz Biotechnology sc-8008, 1:200), phospho-STAT1 Tyr701 (Cell Signaling Technology 9167S, 1:1,000), STAT1 (Cell Signaling Technology 9172S, 1:1,000), CD276 (R&D Systems AF1027, 1:200), CD70 (Santa Cruz Biotechnology sc-365539, 1:200), CD58 (Thermo Fisher Scientific MA5800, 1:200), NECTIN2 (R&D Systems AF2229, 1:2,000), HLAA (Abcam ab52922, 1:5,000), TNFRSF1A (Santa Cruz Biotechnology sc-8436, 1:200), IFNGR2 (R&D Systems AF773, 1:200), FAS (Santa Cruz Biotechnology sc-8009, 1:200), IFNARI (Santa Cruz Biotechnology sc-7391, 1:100), TNFRSF10B (Novus Biologicals NB100-56618, 1:200), MICB (R&D Systems MAB1599-100, 1:500), TNFRSF10A (R&D Systems AF347, 1:200), PVR (R&D Systems MAB25301, 1:500), MICA (R&D Systems MAB1300-100, 1:500), HMGB1 (Abcam ab18256, 1:1,000), 4-1BBL (TNFSF9; R&D Systems AF2295, 1:200), NT5E (Abcam ab175396, 1:1,000), ULBP2 (R&D Systems AF1298, 1:2,000), IFNGR1 (R&D Systems MAB6731, 1:500), ULBP3 (R&D Systems AF1517, 1:2,000), CD39 (Abcam ab108248, 1:1,000), FLAG (Millipore Sigma F7425, 1:1,000), or GAPDH (Cell Signaling Technology 2118L, 1:1,000)] in 2.5% BLOT-QuickBlocker (G Biosciences 786-011) in TBST overnight at 4? C. Blots were washed with TBST before incubation with secondary antibodies [Anti-rabbit IgG, HRP-linked (Cell Signaling Technology 7074S, 1:5,000), Anti-mouse IgG, HRP-linked (Cell Signaling Technology 7076S, 1:5,000), anti-goat IgG-HRP (Santa Cruz Biotechnology sc-2354, 1:5,000)] in 2.5% BLOT-QuickBlocker (G Biosciences 786-011) in TBST for 1 h at room temperature. Blots were washed with TBST and imaged using chemiluminescent substrate [Pierce ECL (Thermo Fisher Scientific 32209), SuperSignal West Pico PLUS (Thermo Fisher Scientific 34577), or SuperSignal West Femto (Thermo Fisher Scientific 34096)] on the ChemiDox XRS+ (Bio-Rad).

    [0505] Caspase 8 blots were transferred onto a PVDF membrane with traditional wet transfer at 50V for 1 h. Blots were blocked with 5% bovine serum albumin (BSA; Millipore Sigma A9418) in TBST for 2 h at room temperature before probing with Caspase 8 primary antibody (Cell Signaling Technology 9746S, 1:1,000) in 5% BSA in TBST overnight at 4? C. Blots were washed with TBST before incubation with anti-mouse IgG, HRP-linked secondary antibody in 5% BSA in TBST for 1 h at room temperature. Blots were washed with TBST and imaged as described above.

    Flow Cytometry Assays

    [0506] Per condition, 5?10.sup.5 cells were pelleted at 200?g for 5 min and washed once with PBS. Cell were fixed in 4% Formaldehyde in PBS at 4? C. for 10 mins. Cells were washed twice with PBS and resuspended in PBS with 25 ?g/mL recombinant Fc chimera proteins [PVRIG (R&D Systems 9365-PV-050), CD226 (R&D Systems 666-DN-050), NKG2D (R&D 1299-NK-050), TREML2 (R&D Systems 3259-TL-050), CD2 (R&D Systems 1856-CD-050), CD96 (R&D Systems 9360-CD-050), TIGIT (BPS Bioscience 71186), CD27 (BPS Bioscience 71176), or 4-1BB (TNFRSF9; Sino Bio 10041-H03H)], 0.1 ?g/mL HLA-A2:NY-ESO-1 Fab (Stewart-Jones et al., 2009), 5 ?g/mL Fas antibody (Millipore Sigma 05-201), 25 ?g/mL TNFRSF10B antibody (Novus Biologicals NB100-56618, 1:200), or Dylight 649 labeled Tomato Lectin (Vector Laboratories DL-1178, 1:100). Cells were incubated at 4? C. for 1 h. Cells were washed twice with PBS and resuspended in PBS with the appropriate secondary antibody [IgG Fc PE (Thermo Fisher Scientific 12-4998-82, 1:50), His Tag Alexa Fluor 647 (Thermo Fisher Scientific MA121315A647), mouse Alexa Fluor 568 (Thermo Fisher Scientific A-11031), or rabbit Alexa Fluor 647 (Thermo Fisher Scientific A-21244)]. Cells stained with Tomato Lectin were not incubated with additional secondary antibodies. Cells were incubated at 4 ?C for 30 mins. Cells were washed twice with PBS. For each sample, 10,000 cells were analyzed on a CytoFLEX Flow Cytometer (Beckman Coulter) and quantified with FlowJo (FlowJo). For each experiment, median fluorescence values for 3 biological replicates were compared to determine statistical significance.

    Primary Patient-Derived Cell Models

    [0507] CCLF_MELM_0011_T melanoma tumor tissue and CCLF_PANC_0014_T pancreatic tumor tissue were obtained from Dana-Farber Cancer Institute hospital with informed consent and the cancer cell model line generation was approved by the ethical committee. Both tumor tissues were freshly received into the lab, rinsed with 95-100% ethanol very quickly and 1?PBS twice. Tissue was transferred to a sterile petri dish and the tissue was minced into small 1-2 mm fragments. Dissected tissues were dissociated in a collagenase/hyaluronidase (StemCell technologies 07912) medium for 1 hour. The red blood cells were further depleted by adding Ammonium Chloride Solution (StemCell technologies 07800). CCLF_MELM_0011_T dissociated cells were plated with smooth muscle growing medium-2 (Lonza CC-3181) into a six well plate, media was changed every 2-3 days and cells were split when a confluency of 80% was reached. A 1:3 ratio was used when splitting CCLF_MELM_0011_T. CCLF_PANC_0014_T dissociated cells were plated into a twenty-four well plate with a 50:50 mix of Clevers pancreas organoid media (Sato et al., 2011): Propagenix Conditioned media (Propagenix 256-100) and split when a confluency of 80% was reached. Media was changed every 3-4 days. A 1:2 ratio was used when splitting CCLF_PANC_0014_T which is a mixed population of suspension and adherent cells. Both lines were passaged 5 times before a pellet was taken for sequencing verification. The confirmed melanoma cell model and confirmed pancreatic adenocarcinoma cell model were propagated for another 10-15 passages and their cryovials preserved. CCLF_MELM_0011_T passage 11 cells and CCLF_PANC_0014_T passage 20 cells were used for this study.

    Single-Sample Gene Set Enrichment Analysis (ssGSEA)

    [0508] A total of 310 unique patient tumor transcriptomes that were collected prior to immunotherapy were used for ssGSEA (Auslander et al., 2018; Braun et al., 2020; Gide et al., 2019; Hugo et al., 2016; Pender et al., 2021; Riaz et al., 2017). As processed data was not available for the Gide et al. 2019 dataset (Gide et al., 2019), fastq files were downloaded and expression levels were estimated using RSEM v1.3.1 (Li and Dewey, 2011) as described below. Expression values for replicates from the same patient were averaged. ssGSEA (Barbie et al., 2009) as implemented by GSEAPY v0.10.4 was performed on each sample using default parameters to determine the normalized enrichment score of the 576 candidate genes. The z-score of the normalized enrichment scores was calculated on each dataset and aggregated. Patients were classified as responders (i.e., RECIST categories of complete response or partial response, clinical benefit, and no tumor progression) or non-responders (i.e., RECIST categories of stable disease or progressive disease, no clinical benefit, and tumor progression) based on the reported response to subsequent anti-PD-1 or anti-CTLA-4 checkpoint blockade therapy.

    Statistics

    [0509] Statistical tests were applied with the sample size listed in the text and figure legends. Sample size represents the number of independent biological replicates. Data supporting main conclusions represents results from at least two independent experiments. All graphs with error bars report mean?s.e.m. values. Two-tailed 1-tests were performed unless otherwise indicated. Mantel-Cox log-rank tests were performed for host survival analyses. PRISM was used for basic statistical analysis and plotting (www.graphpad.com), and the R language and programming environment (www.r-project.org) was used for the remainder of the statistical analysis. Multiple hypothesis testing correction was applied where indicated.

    REFERENCES

    [0510] Alderson, M. R., Smith, C. A., Tough, T. W., Davis-Smith, T., Armitage, R. J., Falk, B., Roux, E., Baker, E., Sutherland, G. R., and Din, W. S. (1994). Molecular and biological characterization of human 4-1BB and its ligand. Eur J Immunol 24, 2219-2227. [0511] Auslander, N., Zhang, G., Lee, J. S., Frederick, D. T., Miao, B., Moll, T., Tian, T., Wei, Z., Madan, S., Sullivan, R. J., et al. (2018). Robust prediction of response to immune checkpoint blockade therapy in metastatic melanoma. Nat Med 24, 1545-1549. [0512] Barbie, D. A., Tamayo, P., Boehm, J. S., Kim, S. Y., Moody, S. E., Dunn, I. F., Schinzel, A. C., Sandy, P., Meylan, E., Scholl, C., et al. (2009). Systematic RNA interference reveals that oncogenic KRAS-driven cancers require TBK1. Nature 462, 108-112. [0513] Barretina, J., Caponigro, G., Stransky, N., Venkatesan, K., Margolin, A. A., Kim, S., Wilson, C. J., Lehar, J., Kryukov, G. V., Sonkin, D., et al. (2012). The Cancer Cell Line Encyclopedia enables predictive modelling of anticancer drug sensitivity. Nature 483, 603-607. [0514] Braun, D. A., Hou, Y., Bakouny, Z., Ficial, M., Sant'Angelo, M., Forman, J., Ross-Macdonald, P., Berger, A. C., Jegede, O. A., Elagina, L., et al. (2020). Interplay of somatic alterations and immune infiltration modulates response to PD-1 blockade in advanced clear cell renal cell carcinoma. Nat Med 26, 909-918. [0515] Chen, D. S., and Mellman, I. (2017). Elements of cancer immunity and the cancer-immune set point. Nature 541, 321-330. [0516] Cho, J. H., Collins, J. J., and Wong, W. W. (2018). Universal Chimeric Antigen Receptors for Multiplexed and Logical Control of T Cell Responses. Cell 173, 1426-1438 e1411. [0517] Czabotar, P. E., Lessene, G., Strasser, A., and Adams, J. M. (2014). Control of apoptosis by the BCL-2 protein family: implications for physiology and therapy. Nat Rev Mol Cell Biol 15, 49-63. [0518] Decker, C. E., Young, T., Pasnikowski, E., Chiu, J., Song, H., Wei, Y., Thurston, G., and Daly, C. (2019). Genome-scale CRISPR activation screen uncovers tumor-intrinsic modulators of CD3 bispecific antibody efficacy. Sci Rep 9, 20068. [0519] Doench, J. G. (2018). Am I ready for CRISPR? A user's guide to genetic screens. Nat Rev Genet 19, 67-80. [0520] Dong, H., Strome, S. E., Salomao, D. R., Tamura, H., Hirano, F., Flies, D. B., Roche, P. C., Lu, J., Zhu, G., Tamada, K., et al. (2002). Tumor-associated B7-H1 promotes T-cell apoptosis: a potential mechanism of immune evasion. Nat Med 8, 793-800. [0521] Dufva, O., Koski, J., Maliniemi, P., Ianevski, A., Klievink, J., Leitner, J., Polonen, P., Hohtari, H., Saeed, K., Hannunen, T., et al. (2020). Integrated drug profiling and CRISPR screening identify essential pathways for CAR T-cell cytotoxicity. Blood 135, 597-609. [0522] Feng, J., Liu, T., Qin, B., Zhang, Y., and Liu, X. S. (2012). Identifying ChIP-seq enrichment using MACS. Nat Protoc 7, 1728-1740. [0523] Garcia-Diaz, A., Shin, D. S., Moreno, B. H., Saco, J., Escuin-Ordinas, H., Rodriguez, G. A., Zaretsky, J. M., Sun, L., Hugo, W., Wang, X., et al. (2017). Interferon Receptor Signaling Pathways Regulating PD-L1 and PD-L2 Expression. Cell Rep 19, 1189-1201. [0524] Gide, T. N., Quek, C., Menzies, A. M., Tasker, A. T., Shang, P., Holst, J., Madore, J., Lim, S. Y., Velickovic, R., Wongchenko, M., et al. (2019). Distinct Immune Cell Populations Define Response to Anti-PD-1 Monotherapy and Anti-PD-1/Anti-CTLA-4 Combined Therapy. Cancer Cell 35, 238-255 e236.Grossman, R. L., Heath, A. P., Ferretti, V., Varmus, H. E., Lowy, D. R., Kibbe, W. A., and Staudt, L. M. (2016). Toward a Shared Vision for Cancer Genomic Data. N Engl J Med 375, 1109-1112. [0525] Grumont, R. J., Rourke, I. J., and Gerondakis, S. (1999). Rel-dependent induction of A1 transcription is required to protect B cells from antigen receptor ligation-induced apoptosis. Genes Dev 13, 400-411. [0526] Hashiguchi, M., Kobori, H., Ritprajak, P., Kamimura, Y., Kozono, H., and Azuma, M. (2008). Triggering receptor expressed on myeloid cell-like transcript 2 (TLT-2) is a counter-receptor for B7-H3 and enhances T cell responses. Proc Natl Acad Sci USA 105, 10495-10500. [0527] Hegde, P. S., and Chen, D. S. (2020). Top 10 Challenges in Cancer Immunotherapy. Immunity 52, 17-35. [0528] Heinz, S., Benner, C., Spann, N., Bertolino, E., Lin, Y. C., Laslo, P., Cheng, J. X., Murre, C., Singh, H., and Glass, C. K. (2010). Simple combinations of lineage-determining transcription factors prime cis-regulatory elements required for macrophage and B cell identities. Mol Cell 38, 576-589. [0529] Hoesel, B., and Schmid, J. A. (2013). The complexity of NF-kappaB signaling in inflammation and cancer. Mol Cancer 12, 86. [0530] Holmgaard, R. B., Zamarin, D., Munn, D. H., Wolchok, J. D., and Allison, J. P. (2013). Indoleamine 2,3-dioxygenase is a critical resistance mechanism in antitumor T cell immunotherapy targeting CTLA-4. J Exp Med 210, 1389-1402. [0531] Hugo, W., Zaretsky, J. M., Sun, L., Song, C., Moreno, B. H., Hu-Lieskovan, S., Berent-Maoz, B., Pang, J., Chmielowski, B., Cherry, G., et al. (2016). Genomic and Transcriptomic Features of Response to Anti-PD-1 Therapy in Metastatic Melanoma. Cell 165, 35-44. [0532] Joung, J., Konermann, S., Gootenberg, J. S., Abudayyeh, O. O., Platt, R. J., Brigham, M. D., Sanjana, N. E., and Zhang, F. (2017). Genome-scale CRISPR-Cas9 knockout and transcriptional activation screening. Nat Protoc 12, 828-863. [0533] Konermann, S., Brigham, M. D., Trevino, A. E., Joung, J., Abudayyeh, O. O., Barcena, C., Hsu, P. D., Habib, N., Gootenberg, J. S., Nishimasu, H., et al. (2015). Genome-scale transcriptional activation by an engineered CRISPR-Cas9 complex. Nature 517, 583-588. [0534] Lawson, K. A., Sousa, C. M., Zhang, X., Kim, E., Akthar, R., Caumanns, J. J., Yao, Y., Mikolajewicz, N., Ross, C., Brown, K. R., et al. (2020). Functional genomic landscape of cancer-intrinsic evasion of killing by T cells. Nature. [0535] Langmead, B., Trapnell, C., Pop, M., and Salzberg, S. L. (2009). Ultrafast and memory-efficient alignment of short DNA sequences to the human genome. Genome Biol 10, R25. Leitner, J., Klauser, C., Pickl, W. F., Stockl, J., Majdic, O., Bardet, A. F., Kreil, D. P., Dong, C., Yamazaki, T., Zlabinger, G., et al. (2009). B7-H3 is a potent inhibitor of human T-cell activation: No evidence for B7-H3 and TREML2 interaction. Eur J Immunol 39, 1754-1764. [0536] Li, B., and Dewey, C. N. (2011). RSEM: accurate transcript quantification from RNA-Seq data with or without a reference genome. BMC Bioinformatics 12, 323. [0537] Li, W., Xu, H., Xiao, T., Cong, L., Love, M. I., Zhang, F., Irizarry, R. A., Liu, J. S., Brown, M., and Liu, X. S. (2014). MAGeCK enables robust identification of essential genes from genome-scale CRISPR/Cas9 knockout screens. Genome Biol 15, 554. [0538] Liu, T., Zhang, L., Joo, D., and Sun, S. C. (2017). NF-kappaB signaling in inflammation. Signal Transduct Target Ther 2. [0539] Manguso, R. T., Pope, H. W., Zimmer, M. D., Brown, F. D., Yates, K. B., Miller, B. C., Collins, N. B., Bi, K., LaFleur, M. W., Juneja, V. R., et al. (2017). In vivo CRISPR screening identifies Ptpn2 as a cancer immunotherapy target. Nature 547, 413-418. [0540] Nausch, N., Florin, L., Hartenstein, B., Angel, P., Schorpp-Kistner, M., and Cerwenka, A. (2006). Cutting edge: the AP-1 subunit JunB determines NK cell-mediated target cell killing by regulation of the NKG2D-ligand RAE-1epsilon. J Immunol 176, 7-11. [0541] Pan, D., Kobayashi, A., Jiang, P., Ferrari de Andrade, L., Tay, R. E., Luoma, A. M., Tsoucas, D., Qiu, X., Lim, K., Rao, P., et al. (2018). A major chromatin regulator determines resistance of tumor cells to T cell-mediated killing. Science 359, 770-775. [0542] Patel, S. J., Sanjana, N. E., Kishton, R. J., Eidizadeh, A., Vodnala, S. K., Cam, M., Gartner, J. J., Jia, L., Steinberg, S. M., Yamamoto, T. N., et al. (2017). Identification of essential genes for cancer immunotherapy. Nature 548, 537-542. [0543] Pender, A., Titmuss, E., Pleasance, E. D., Fan, K. Y., Pearson, H., Brown, S. D., Grisdale, C. J., Topham, J. T., Shen, Y., Bonakdar, M., et al. (2021). Genome and Transcriptome Biomarkers of Response to Immune Checkpoint Inhibitors in Advanced Solid Tumors. Clin Cancer Res 27, 202-212. [0544] Raudvere, U., Kolberg, L., Kuzmin, I., Arak, T., Adler, P., Peterson, H., and Vilo, J. (2019). g:Profiler: a web server for functional enrichment analysis and conversions of gene lists (2019 update). Nucleic Acids Res 47, W191-W198. [0545] Reck, M., Rodriguez-Abreu, D., Robinson, A. G., Hui, R., Csoszi, T., Fulop, A., Gottfried, M., Peled, N., Tafreshi, A., Cuffe, S., et al. (2016). Pembrolizumab versus Chemotherapy for PD-L1-Positive Non-Small-Cell Lung Cancer. N Engl J Med 375, 1823-1833. [0546] Riaz, N., Havel, J. J., Makarov, V., Desrichard, A., Urba, W. J., Sims, J. S., Hodi, F. S., Martin-Algarra, S., Mandal, R., Sharfman, W. H., et al. (2017). Tumor and Microenvironment Evolution during Immunotherapy with Nivolumab. Cell 171, 934-949 e916. [0547] Robbins, P. F., Li, Y. F., El-Gamil, M., Zhao, Y., Wargo, J. A., Zheng, Z., Xu, H., Morgan, R. A., Feldman, S. A., Johnson, L. A., et al. (2008). Single and dual amino acid substitutions in TCR CDRs can enhance antigen-specific T cell functions. J Immunol 180, 6116-6131. [0548] Rooney, M. S., Shukla, S. A., Wu, C. J., Getz, G., and Hacohen, N. (2015). Molecular and genetic properties of tumors associated with local immune cytolytic activity. Cell 160, 48-61. [0549] Sato, T., Stange, D. E., Ferrante, M., Vries, R. G., Van Es, J. H., Van den Brink, S., Van Houdt, W. J., Pronk, A., Van Gorp, J., Siersema, P. D., et al. (2011). Long-term expansion of epithelial organoids from human colon, adenoma, adenocarcinoma, and Barrett's epithelium. Gastroenterology 141, 1762-1772. [0550] Shaw, S., Luce, G. E., Quinones, R., Gress, R. E., Springer, T. A., and Sanders, M. E. (1986). Two antigen-independent adhesion pathways used by human cytotoxic T-cell clones. Nature 323, 262-264. [0551] Sica, G. L., Choi, I. H., Zhu, G., Tamada, K., Wang, S. D., Tamura, H., Chapoval, A. I., Flies, D. B., Bajorath, J., and Chen, L. (2003). B7-H4, a molecule of the B7 family, negatively regulates T cell immunity. Immunity 18, 849-861. [0552] Singh, N., Lee, Y. G., Shestova, O., Ravikumar, P., Hayer, K. E., Hong, S. J., Lu, X. M., Pajarillo, R., Agarwal, S., Kuramitsu, S., et al. (2020). Impaired Death Receptor Signaling in Leukemia Causes Antigen-Independent Resistance by Inducing CAR T-cell Dysfunction. Cancer Discov 10, 552-567. [0553] Steinle, A., Li, P., Morris, D. L., Groh, V., Lanier, L. L., Strong, R. K., and Spies, T. (2001). Interactions of human NKG2D with its ligands MICA, MICB, and homologs of the mouse RAE-1 protein family. Immunogenetics 53, 279-287. [0554] Stewart-Jones, G., Wadle, A., Hombach, A., Shenderov, E., Held, G., Fischer, E., Kleber, S., Nuber, N., Stenner-Liewen, F., Bauer, S., et al. (2009). Rational development of high-affinity T-cell receptor-like antibodies. Proc Natl Acad Sci USA 106, 5784-5788. [0555] Tang, Z., Li, C., Kang, B., Gao, G., Li, C., and Zhang, Z. (2017). GEPIA: a web server for cancer and normal gene expression profiling and interactive analyses. Nucleic Acids Res 45, W98-W102. [0556] Sun, L., Li, C. W., Chung, E. M., Yang, R., Kim, Y. S., Park, A. H., Lai, Y. J., Yang, Y., Wang, Y. H., Liu, J., et al. (2020). Targeting Glycosylated PD-1 Induces Potent Antitumor Immunity. Cancer Res 80, 2298-2310. [0557] Togayachi, A., Kozono, Y., Kuno, A., Ohkura, T., Sato, T., Hirabayashi, J., Ikehara, Y., and Narimatsu, H. (2010). Beta3GnT2 (B3GNT2), a major polylactosamine synthase: analysis of B3GNT2-deficient mice. Methods Enzymol 479, 185-204. [0558] Tseng, D., Volkmer, J. P., Willingham, S. B., Contreras-Trujillo, H., Fathman, J. W., Fernhoff, N. B., Seita, J., Inlay, M. A., Weiskopf, K., Miyanishi, M., et al. (2013). Anti-CD47 antibody-mediated phagocytosis of cancer by macrophages primes an effective antitumor T-cell response. Proc Natl Acad Sci USA 110, 11103-11108. [0559] Tummers, B., Goedemans, R., Pelascini, L. P., Jordanova, E. S., van Esch, E. M., Meyers, C., Melief, C. J., Boer, J. M., and van der Burg, S. H. (2015). The interferon-related developmental regulator 1 is used by human papillomavirus to suppress NFkappaB activation. Nat Commun 6, 6537. [0560] Vredevoogd, D. W., Kuilman, T., Ligtenberg, M. A., Boshuizen, J., Stecker, K. E., de Bruijn, B., Krijgsman, O., Huang, X., Kenski, J. C. N., Lacroix, R., et al. (2019). Augmenting Immunotherapy Impact by Lowering Tumor TNF Cytotoxicity Threshold. Cell 178, 585-599 e515. [0561] Wan, Y. W., Allen, G. I., and Liu, Z. (2016). TCGA2STAT: simple TCGA data access for integrated statistical analysis in R. Bioinformatics 32, 952-954. [0562] Wolchok, J. D., Kluger, H., Callahan, M. K., Postow, M. A., Rizvi, N. A., Lesokhin, A. M., Segal, N. H., Ariyan, C. E., Gordon, R. A., Reed, K., et al. (2013). Nivolumab plus ipilimumab in advanced melanoma. N Engl J Med 369, 122-133. [0563] Xiang, W., Yang, C. Y., and Bai, L. (2018). MCL1 inhibition in cancer treatment. Onco Targets Ther 11, 7301-7314. [0564] Zaretsky, J. M., Garcia-Diaz, A., Shin, D. S., Escuin-Ordinas, H., Hugo, W., Hu-Lieskovan, S., Torrejon, D. Y., Abril-Rodriguez, G., Sandoval, S., Barthly, L., et al. (2016). Mutations Associated with Acquired Resistance to PD-1 Blockade in Melanoma. N Engl J Med 375, 819-829. [0565] Zong, W. X., Edelstein, L. C., Chen, C., Bash, J., and Gelinas, C. (1999). The prosurvival Bcl-2 homolog Bfl-1/A1 is a direct transcriptional target of NF-kappaB that blocks TNFalpha-induced apoptosis. Genes Dev 13, 382-387.

    [0566] Various modifications and variations of the described methods, pharmaceutical compositions, and kits of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific embodiments, it will be understood that it is capable of further modifications and that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the art are intended to be within the scope of the invention. This application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure come within known customary practice within the art to which the invention pertains and may be applied to the essential features herein before set forth.