Systems and Methods for Measuring Mat Density of Aquatic Biomass
20240263114 ยท 2024-08-08
Inventors
- Geoffrey MANGALAM (San Marcos, CA, US)
- Maurits VAN DE VEN (San Marcos, CA, US)
- Fedor KUZMINOV (San Marcos, CA, US)
- Edward CHEN (San Marcos, CA, US)
- Sheldon COMPTON (San Marcos, CA, US)
Cpc classification
G01N21/534
PHYSICS
International classification
Abstract
Provided are methods, devices, and systems for measuring aquatic biomass in an aqueous liquid, optionally for the cultivation, growth optimization, and harvest of an aquatic biomass for plant protein production. In particular, measurements of aquatic biomass density are based on light absorption of the aquatic biomass. The aquatic biomass includes an aquatic organism such as Lemna, including Lemna minor. The plant protein isolates include a RuBisCO protein.
Claims
1. A method for measuring aquatic biomass, the method comprising: flowing aqueous liquid and aquatic biomass in a pond; measuring light absorption of a portion of the aquatic biomass, wherein the measuring comprises use of a measurement device, wherein the measurement device comprises: a shield, wherein the shield obstructs flow of the biomass in an area adjacent to a shield; and light intensity sensors, wherein the light intensity sensors comprise at least three light intensity sensors, wherein the light intensity sensors collect measurements of light intensity: at a comparator region located above a surface of the aqueous liquid; at a flow obstruction region located below a surface of the aqueous liquid in an area substantially free of an aquatic biomass; and at a biomass region located below a surface of the aqueous liquid; and determining a value for mass, surface area, density, or combinations thereof of the aquatic biomass in the pond.
2. The method of claim 1, wherein the determining further comprises calculating, based on light intensity, the light absorption of a portion of the aquatic biomass.
3. The method of claim 1, wherein the light intensity sensors comprise optical sensors.
4. The method of claim 3, wherein the optical sensors each comprise a light meters lux meter, a UV meter, a photosynthetically active radiation (PAR) sensor, a camera, or a combinations thereof.
5. The method of claim 3, wherein the optical sensors measure photometric units.
6. The method of claim 3, wherein the optical sensors measure lumens per unit area.
7. The method of claim 3, wherein the optical sensors measure lux or lumens per square meter.
8. The method of claim 3, wherein the optical sensors comprise lux meters.
9. The method of claim 3, wherein the optical sensors comprise light meters.
10. The method of claim 4, wherein the camera comprises a digital camera, non-digital camera, integrated camera, single camera, dual camera, timer-specific camera, or combinations thereof.
11. The method of a claim 3, wherein the optical sensors comprise photosynthetically active radiation (PAR) sensors.
12. The method of claim 1, wherein the light intensity sensors measure light absorption at 10 nanometers to 400 nanometers wavelength.
13. The method of claim 1, wherein the light intensity sensors measure light absorption at 400 nanometers to 700 nanometers wavelength.
14. The method of claim 1, wherein the light intensity sensors measure light absorption at 750 nanometers to 10,000 nanometers wavelength.
15. The method of claim 2, wherein a light intensity differential is obtained from measurements of light intensity.
16. The method of claim 15, wherein a light intensity differential calculated from a difference between a ratio of light intensity at a comparator region located above a surface of the aqueous liquid to light intensity at a biomass region below a surface of the aqueous liquid in an area not substantially free of an aquatic biomass, and a ratio of light intensity at a comparator region located above a surface of the aqueous liquid to light intensity at a biomass region below a surface of the aqueous liquid in an area in that is substantially free of an aquatic biomass.
17. The method of claim 16, wherein the light absorption is calculated from the light intensity differential.
18. The method of claim 1, wherein an aquatic biomass measurement is related to the measurement of light absorption.
19. The method of claim 18, wherein the measurement is density.
20. The method of claim 18, wherein the measurement is value of mass.
21. The method of claim 18, wherein the measurement is surface area.
22. The method of claim 1, wherein the flow is a circulating flow.
23. The method of claim 1, wherein the method comprises the use of one, two, three, four, five, or more measurement devices.
24. The method of claim 1, wherein the light intensity sensors to collect measurements of light intensity communicate data measurements to an imaging system or a computer system adapted to process the data, wherein the processing comprises calculations.
25. The method of claim 1, wherein the value for mass, surface area, density, or combinations thereof of the aquatic biomass in the pond is determined from one or more device.
26. The method of claim 1, wherein the aquatic biomass comprises Lemna minor.
27. The method of claim 1, wherein the aquatic biomass comprises an aquatic photosynthetic organism.
28. The method of claim 27, wherein the aquatic photosynthetic organism comprises a member of the Bacillariophyta, Chlorophyta, Chrysophyta, Euglenophyta, Euglenozoa, Paeophyta, Porphyra, Pyrrophyta, Rhodophyta, or Xanthophyta phylum, or combinations thereof.
29. The method of claim 27, wherein the aquatic photosynthetic organism comprises a member of the Caulerpaceae, Chlorophyta, Chrysophyta, Chrysophyceae, Cryptophyceae, Dinophyceae, Euglenophyceae, Fucaceae, Florideophyceae, Gigartinaceae, Gracilariaceae, Laminariaceae, Lemnaceae, Salviniaceae, Monostromataceae, Phaeophyceae, Ulvaceae, Xanthophyceae, or algae family, or combinations thereof.
30. The method of claim 27, wherein the aquatic photosynthetic organism comprises a member of the Ankistrodesmus, Asteromonas, Azolla, Carteria, Chlamydomonas, Chlorella, Chlorococcum, Chlorogonium, Chlorophyceace, Chrysosphaera, Dunaliella, Euglena, Fucus, Furcellaria, Gracilaria, Haematococcus, Laminaria, Landoltia, Lemna, Macrocystis, Monoraphidium, Monostroma, Nannochloropsis, Neochloris, Oedogonium, Ochromona, Oscillatoria, Pelagomonas, Phormidium, Pleurococcus, Porphyra, Pyrobotrys, Sargassum, Scenedesmus, Selenastrum, Spirodela, Spirulina, Volvox, Wolffia, or Wolffiella genus, or combinations thereof.
31. The method of claim 27, wherein the aquatic photosynthetic organism comprises Lemna.
32. The method of claim 31, wherein the Lemna comprises Lemna aequinoctialis, Lemna disperma, Lemna ecuadoriensis, Lemna gibba, Lemna japonica, Lemna minuta, Lemna obscura, Landoltia punctata, Lemna perpusilla, Lemna tenera, Lemna trisulca, Lemna turionifera, Lemna valdiviana, Lemna yungensis, Spirodela polyrhiza, Wolffia arrhiza, Wolffia globosa.
33. The method of claim 27, wherein the aquatic photosynthetic organism comprises Azolla, Azolla caroliniana, Azolla cristata, Azolla filiculoides, Azolla imbricata, Azolla nilotica, Azolla pinnata, Azolla rubra, or combinations thereof.
34. The method of claim 27, wherein the aquatic photosynthetic organism comprises Ascophyllum nodosum, Botrydium, Caulerpa, Chondrus crispus, Euglenoids, Fucus, Fucus crispus, Fucus serratus, Fucus vesiculosus, Furcellaria lumbricalis, Gracilaria parvispora, Gracilaria tikvahiae, Laminaria digitata, Laminaria farlowii, Laminaria hyperborean, Laminaria nigripes, Macrocystis pyrifera, Monostroma kuroshiense, Monostroma latissimum, Monostroma nitidum, Prymnesium parvum, Palmaria palmata, Saccharina latissima, Tribonema, Ulva intestinalis, Vaucheria, or combinations thereof.
35. The method of claim 27, wherein the aquatic photosynthetic organism comprises duckweed, duckweed fern, mosquito fern, water fern, fairy moss, and algae, or combinations thereof.
36. The method of claim 27, wherein the aquatic photosynthetic organism comprises lesser duckweed, minute duckweed, gibbous duckweed, common duckweed, ivy duckweed, least duckweed, Valdivia duckweed, rockweed, gutweed, green algae, golden algae, golden brown algae, golden brown algae and diatoms, fire algae, red algae, yellow-green algae, brown algae, single-cell algae, microalgae, macroalgae, kombu, kelp, sugarkelp, grass kelp, giant kelp, bladder kelp, sea oak, knotted kelp, knotted wrack, sea lettuce, serrated wrack, carrageen, forked seaweed, brown seaweed, dulse, dulce sol, or combinations thereof.
37. The method of claim 36, wherein the aquatic photosynthetic organism comprises a floating aquatic photosynthetic organism.
38. The method of claim 1, wherein the density comprises mat density.
39. The method of claim 38, wherein mat density is from about 750 g/m.sup.2 to about 1500 g/m.sup.2.
40. The method of claim 37, wherein the floating aquatic photosynthetic organism comprises a Lemna species.
41. The method of claim 1, wherein the aquatic biomass comprises a thickness of about 0.1 millimeters to about 5 millimeters.
42. The method of claim 1, wherein the aquatic biomass comprises a weight of about 100 grams per meter squared to about 3000 grams per meter squared.
43. The method of claim 1, further comprising the step of optimizing a growth of the aquatic biomass, wherein the method comprises adjusting a mass, surface area, or density, of the aquatic biomass based on the calculated mass, surface area, or density, thereby optimizing the growth of the aquatic biomass or aquatic photosynthetic organism.
44. The method of claim 43, wherein optimizing the growth of the aquatic biomass comprises adjusting aquatic biomass over a time interval.
45. The method of claim 43, wherein optimizing the growth of the aquatic biomass comprises adjusting aqueous liquid turbidity.
46. The method of claim 43, wherein optimizing the growth of the aquatic biomass comprises adjusting temperature, pH, nutrients, flow, light intensity, light spectrum, and time interval.
47. The method of claim 43, wherein method further comprises harvesting the aquatic biomass.
Description
BRIEF DESCRIPTION OF THE DRAWINGS
[0012] The features of the disclosure are set forth with particularity in the appended claims. A better understanding of the features and advantages of the present disclosure will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the disclosure are utilized, and the accompanying drawings of which:
[0013]
[0014]
[0015]
[0016]
[0017]
[0018]
[0019]
[0020]
[0021]
[0022]
DETAILED DESCRIPTION
[0023] Described herein are systems, devices, and methods for measuring an aquatic biomass. Such innovations allow for enhanced growth, monitoring, yield, and quality of the biomass and/or resultant purification products, including protein isolate compositions.
Definitions
[0024] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by those of ordinary skill in the art to which embodiments herein belongs. The following definitions are provided to facilitate understanding of certain terms used frequently herein and are not meant to limit the scope of the present disclosure.
[0025] The following definitions supplement those in the art and are directed to the current application and are not to be imputed to any related or unrelated case, e.g., to any commonly owned patent or application. Although any methods and materials similar or equivalent to those described herein can be used in the practice for testing of the present disclosure, the preferred materials and methods are described herein. Accordingly, the terminology used herein can be for the purpose of describing particular embodiments only and is not intended to be limiting.
[0026] Herein, the use of the singular includes the plural unless specifically stated otherwise. It must be noted that, as used in the specification, the singular forms a, an and the include plural referents unless the context clearly dictates otherwise. In this application, the use of or means and/or unless stated otherwise. Furthermore, use of the term including as well as other forms, such as include, includes, and included, is not limiting.
[0027] Unless specifically stated or obvious from context, as used herein, the term about as used herein when referring to a measurable value such as a dosage or time period and the like refers to variations of ?20%, ?10%, ?5%, ?1%, ?0.5%, or even ?0.1% of the specified amount. As used herein, phrases such as between X and Y and between about X and Y should be interpreted to include X and Y. As used herein, phrases such as between about X and Y mean between about X and about Y and phrases such as from about X to Y mean from about X to about Y.
[0028] Herein, the use of or means and/or unless stated otherwise. The terms and/or and any combination thereof and their grammatical equivalents as used herein, can be used interchangeably. These terms can convey that any combination is specifically contemplated. Solely for illustrative purposes, the following phrases A, B, and/or C or A, B, C, or any combination thereof can mean A individually; B individually; C individually; A and B; B and C; A and C; and A, B, and C. The term or can be used conjunctively or disjunctively, unless the context specifically refers to a disjunctive use.
[0029] Reference herein to some embodiments, an embodiment, one embodiment or other embodiments means that a particular feature, structure, or characteristic described in connection with the embodiments can be included in at least some embodiments, but not necessarily all embodiments, of the present disclosure.
[0030] As used in this specification and claim(s), the words comprising (and any form of comprising, such as comprise and comprises), having (and any form of having, such as have and has), including (and any form of including, such as includes and include) or containing (and any form of containing, such as contains and contain) are inclusive or open-ended and do not exclude additional, un-recited elements or method steps. It is contemplated that any embodiment discussed in this specification can be implemented with respect to any method or composition of the present disclosure, and vice versa. Furthermore, compositions of the present disclosure can be used to achieve methods of the present disclosure.
[0031] As used herein, identity, refers to a relationship between two or more amino acid sequences, as determined by comparing the sequences. In the art, identity also refers to the degree of sequence relatedness between amino acid sequences as determined by the match between strings of such sequences. Identity can be readily calculated by known methods, including, but not limited to, those described in (Computational Molecular Biology, Lesk, A M., Ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., Ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part I, Griffin, A M., and Griffin, H. G., Eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., Eds., M Stockton Press, New York, 1991; and Carillo, H., and Lipman, D., SIAM J. Applied Math. 1988, 48: 1073. Preferred methods to determine identity are designed to give the largest match between the sequences tested. Methods to determine identity are codified in publicly available computer programs. The percent identity between two sequences can be determined by using analysis software (e.g., Sequence Analysis Software Package of the Genetics Computer Group, Madison Wis.) that incorporates the Needelman and Wunsch, (J. Mol. Biol., 1970, 48: 443-453) algorithm (e.g., NBLAST, and XBLAST). The default parameters are used to determine the identity for the polypeptides of the present disclosure, unless stated otherwise.
[0032] Ranges of values are disclosed herein. The ranges set out a lower limit value and an upper limit value. Unless otherwise stated, the ranges include the lower limit value, the upper limit value, and all values between the lower limit value and the upper limit value, including, but not limited to, all values to the magnitude of the smallest value (either the lower limit value or the upper limit value) of a range. It is to be understood that such a range format is used for convenience and brevity, and thus, should be interpreted in a flexible manner to include not only the numerical values explicitly recited as the limits of the range, but also to include all the individual numerical values or sub-ranges encompassed within that range as if each numerical value and sub-range is explicitly recited. To illustrate, a numerical range of about 0.1% to about 5% should be interpreted to include not only the explicitly recited values of about 0.1% to about 5%, but also, unless otherwise stated, include individual values (e.g., about 1%, about 2%, about 3%, about 4%, etc.) and the sub-ranges (e.g., about 0.5% to about 1.1%; about 0.5% to about 2.4%; about 0.5% to about 3.2%, about 0.5% to about 4.4%, and other possible sub-ranges, etc.) within the indicated range. It is also understood that there are a number of values disclosed herein, and that each value is also herein disclosed as about that particular value in addition to the value itself. For example, if the value 10 is disclosed, then about 10 is also disclosed. Ranges can be expressed herein as from about one particular value, and/or to about another particular value. Similarly, when values are expressed as approximations, by use of the antecedent about, it will be understood that the particular value forms a further disclosure. For example, if the value about 10 is disclosed, then 10 is also disclosed.
[0033] As used herein, the term substantially free refers to less than 5% of a measurable value.
Methods and Systems for Aquatic Biomass Measurement
[0034] Provided herein are methods and systems for measuring an aquatic biomass described herein. In some embodiments, methods and systems for measuring an aquatic biomass comprise the use of: an aqueous liquid and an aquatic biomass in the aqueous liquid, and one or more measurement devices described herein. In some embodiments, the one or more measurement device measures light absorption, optionally of a portion of the aquatic biomass. In some embodiments, the one or more measurement device comprises: a shield and one or more light intensity sensors, wherein each one or more light intensity sensors collects a measurement of light intensity. In some embodiments, one or more light intensity sensors collect a measurement of light intensity at one or more of: an area above a surface of an aqueous liquid, an area below the surface of the aqueous liquid in an area that is not substantially free of an aquatic biomass, an area below the surface of then aqueous liquid in an area substantially free of an aquatic biomass, or combinations thereof. In some embodiments, an area above a surface of the aqueous liquid may be referred to herein as a comparator region. In some embodiments, an area below a surface of the aqueous liquid in an area that is not substantially free of an aquatic biomass may be referred to herein as a biomass region. In some embodiments, an area below a surface of an aqueous liquid in an area substantially free of an aquatic biomass may be referred to herein as a flow obstruction region. In some embodiments, one or more light intensity sensors collect a measurement of light intensity at one or more of: a comparator region, a biomass region, a flow obstruction region, or combinations thereof.
[0035] In some embodiments, methods and systems described herein further comprise calculating based on the measurements of light intensity, the light absorption of a portion of the aquatic biomass. In some embodiments, systems and methods described herein further comprise determining, based on the measurement of light absorption, a value for mass, surface area, density, or combinations thereof of the aquatic biomass in a body of liquid. In some embodiments, systems and methods described herein further comprise the use of one or more processing units. In some embodiments, systems and methods described herein further comprise the use of one or more user interfaces.
[0036] Referring to the drawings:
[0037] As shown in
[0038] In some instances, the shield 110 is capable of dispersing an amount of an aquatic biomass 104, and in some cases obstruct a flow of aquatic biomass 104, thereby rendering a flow obstruction region 120 which is substantially free of aquatic biomass 104. In some instances, a first sensor 114 measures light intensity at a comparator region 122 that is located above a surface of the aqueous liquid 106. In some instances, a second sensor 116 measures light intensity at a flow obstruction region 120 that adjacent to a shield 110 and located below a surface of an aqueous liquid 106 in an area substantially free of an aquatic biomass 104. In some instances, a third sensor 118 measures light intensity at a biomass region 124 that located below a surface of an aqueous liquid 106 and in an area that comprises an aquatic biomass 104.
[0039] As additionally shown in
[0040]
[0041] As shown in
[0042]
[0043] As shown in
[0044] Illustrated in
[0045]
[0046] Referring to
[0047] Referring to
[0048] As shown in
Body of Liquid
[0049] Systems and methods described herein comprise a body of liquid or a use thereof. Bodies of liquid described herein generally comprises a container that functions to hold the aqueous liquid. Aquatic biomass measured herein is cultivated in the body of liquid. In some embodiments, a container has an open top surface. In some embodiments, a container comprises one or more of an open top surface, or peripheral walls and a base. In some embodiments, a container comprises three peripheral walls, and a base. In some embodiments, a container comprises three peripheral walls connected to a base. In some embodiments, a container does not have an open top surface (i.e., is enclosed). A container is generally capable of housing conditions necessary to cultivate an aquatic biomass (e.g., abiotic and biotic factors). Exemplary conditions to foster cultivation of an aquatic biomass are described herein. A container may be any suitable container. In some embodiments, a container comprises a watertight container. In some embodiments, a container comprises watertight lining. In some embodiments, a container plastic lining. In some embodiments, a container comprises configuration to be an oblong shape. In some embodiments, a container comprises configuration to be an elongated oval shape. In some embodiments, a container comprises configuration to be a raceway shape. In some embodiments, the body of liquid comprises a pond or tank. In some embodiments, the body of liquid is a sub section of a lake, ocean, river or similar environment having a delineated barrier to create a spatially limited controlled cultivation volume.
[0050] In some embodiments, a body of liquid comprises configuration to be about 10 cm to about 10 m, or more, deep. In some embodiments, a body of liquid comprises configuration to be about 10 cm, about 100 cm, about 500 cm, about 1 m, about 2 m, about 3 m, about 4 m, about 5 m, about 6 m, about 7 m, about 8 m, about 9 m, about 10 m or more.
[0051] In some embodiments, a body of liquid comprises configuration to be about 5 m to about 500 m, or more, in a longest dimension. In some embodiments, a body of liquid comprises configuration to be about 5 m, about 50 m, about 100 m, about 200 m, about 300 m, about 400 m, about 500 m or more.
[0052] In some embodiments, a body of liquid comprises configuration to have a surface area about 10 m.sup.2 to about 10,000 m.sup.2, or more, in a longest dimension. In some embodiments, a body of liquid comprises configuration to be about 10 m.sup.2, about 100 m.sup.2, about 500 m.sup.2, about 1,000 m.sup.2, about 2,000 m.sup.2, about 3,000 m.sup.2, about 4,000 m.sup.2, about 5,000 m.sup.2, about 6,000 m.sup.2, about 7,000 m.sup.2, about 8,000 m.sup.2, about 9,000 m.sup.2, about 10,000 m.sup.2 or more.
[0053] In some embodiments, a body of liquid comprises configuration to contain an aqueous liquid at a temperature of about 1? ? C. to about 45? C. In some embodiments, a body of liquid comprises configuration to contain an aqueous liquid at a temperature of about 10? C. to about 40? C. In some embodiments, a body of liquid comprises configuration to contain an aqueous liquid at a pH of about 2 to about 11. In some embodiments, a body of liquid comprises configuration to contain an aqueous liquid at a pH of about 4 to about 8. In some embodiments, a body of liquid comprises configuration to contain an aqueous liquid at a pH of about 4, about 4.1, about 4.2, about 4.3, about 4.4, about 4.5, about 4.6, about 4.7, about 4.8, about 4.9, about 5, about 5.1, about 5.2, about 5.3, about 5.4, about 5.5, about 5.6, about 5.7, about 5.8, about 5.9, about 6, about 6.1, about 6.2, about 6.3, about 6.4, about 6.5, about 6.6, about 6.7, about 6.8, about 6.9, about 7, about 7.1, about 7.2, about 7.3, about 7.4, about 7.5, about 7.6, about 7.7, about 7.8, about 7.9, about 8, about 8.1, about 8.2, about 8.3, about 8.4, or about 8.5, or more.
[0054] In some embodiments, a body of liquid comprises configuration to contain a circulating aqueous liquid. In some embodiments, a body of liquid comprises configuration to contain a flowing aqueous liquid. In some embodiments, a body of liquid comprises configuration to contain a flowing and circulating aqueous liquid. In some embodiments, a body of liquid comprises configuration to hold an aqueous liquid flowing at a rate of about 0.01 meters/second to about 1 meters/second. In some embodiments, systems and methods described herein comprise a propulsion mechanism wherein a propulsion mechanism comprises configuration to propel an aqueous liquid. In some embodiments, a propulsion mechanism propels an aqueous liquid at a flow rate. In some embodiments, a propulsion mechanism comprises configuration to propel an aqueous liquid at a flow rate. In some embodiments, a flow rate of a flowing liquid is about 0.01 meters/second to about 1 meters/second. In some embodiments, a flow rate of a flowing liquid is about 0.01 meters/second to about 0.5 meters/second. In some embodiments, a flow rate of a flowing liquid is about 0.5 meters/second to about 1 meters/second. Examples of flow rates include: about 0.01 meter/second, about 0.1 meter/second, about 0.2 meter/second, about 0.3 meter/second, about 0.4 meter/second, about 0.5 meter/second, about 0.6 meter/second, about 0.7 meter/second, about 0.8 meter/second, about 0.9 meter/second, or about 1 meter/second. In some embodiments, a propulsion mechanism comprises a paddle wheel or a pump.
Aqueous Liquid
[0055] Systems and methods comprise an aqueous liquid described herein, or a use thereof. In some embodiments, an aqueous liquid comprises a flowing liquid. In some embodiments, a flowing liquid comprises a circulating flow. In some embodiments, a flowing liquid comprises a flow rate.
[0056] In some embodiments, an aqueous liquid described herein comprises a pH range of about 4 to about 8.5. In some embodiments, an aqueous liquid comprises a pH of about 4, about 4.1, about 4.2, about 4.3, about 4.4, about 4.5, about 4.6, about 4.7, about 4.8, about 4.9, about 5, about 5.1, about 5.2, about 5.3, about 5.4, about 5.5, about 5.6, about 5.7, about 5.8, about 5.9, about 6, about 6.1, about 6.2, about 6.3, about 6.4, about 6.5, about 6.6, about 6.7, about 6.8, about 6.9, about 7, about 7.1, about 7.2, about 7.3, about 7.4, about 7.5, about 7.6, about 7.7, about 7.8, about 7.9, about 8, about 8.1, about 8.2, about 8.3, about 8.4, or about 8.5. In some embodiments, an aqueous liquid described herein has a pH of less than 4.0. In some embodiments, the aqueous liquid described herein comprises a pH of greater than 8.5. In some embodiments, an aqueous liquid described herein comprises a pH of about 4 to about 8.5, about 5 to about 7, or about 6.4 to about 6.9. In some embodiments, an aqueous liquid described herein comprises a pH of about 5 to about 7.
[0057] An aqueous liquid used herein may be any suitable aqueous liquid that supports the growth of aquatic biomass. In some embodiments, an aqueous liquid may be water. In some embodiments, water is not pure water (i.e., free from non-water molecules). In some embodiments, aqueous liquid used herein comprises one or more of abiotic material, biotic material, and combinations thereof. Abiotic materials include any suitable non-living materials that may help support cultivation of aquatic biomass, such as minerals, vitamins, cofactors, and the like. Biotic materials include any suitable organic materials that may help support cultivation of aquatic biomass, such as symbiotic organisms, flora, fauna, and the like.
Processing Unit(s)
[0058] Systems and methods described herein comprise one or more processing units or a use thereof. In some embodiments, one or more processing units are communicatively coupled to one or more measurement devices; one or more light intensity sensors; one or more user interfaces; or any combination thereof. As used herein, the term communicatively coupled comprises configuration for two or more objects to communicate data, input, and/or output in a wireless or wired fashion. Wireless communication includes: Bluetooth, wireless networks, and the like. Wired communication includes: ethernet, corded connections, and the like.
[0059] In some embodiments, one or more processing units comprise configuration to receive communication from one or more measurement devices; one or more light intensity sensors; one or more user interfaces; or any combination thereof. In some embodiments, configuration to receive communication comprises one or more receivers. In some embodiments, received communication comprises data or input. In some embodiments a receiver receives data transmitted from one or more measurement devices. In some embodiments a receiver receives input transmitted from one or more user interface. In some embodiments a receiver receives data and/or input processed from a central processing unit.
[0060] In some embodiments, one or more processing units comprise configuration to process data, input, or both from one or more measurement devices; one or more light intensity sensors; one or more user interfaces; or any combination thereof. In some embodiments, configuration to process data, input, and/or output comprises a central processing unit. In some embodiments, a central processing unit processes data, input, output, or any combination thereof, wherein data, input, and/or output is received or to be transmitted. In some embodiments, a central processing unit processes data and/or input received by one or more receivers. In some embodiments, a central processing unit processes data and/or output to be transmitted by one or more transmitter.
[0061] In some embodiments, one or more processing units comprise configuration to transmit communication to one or more measurement devices; one or more light intensity sensors; one or more user interfaces; or any combination thereof. In some embodiments, configuration to transmit communication comprises one or more transmitters. In some embodiments, transmitted communication comprises data, input, output, or any combination thereof. In some embodiments, configuration to transmit communication comprises one or more transmitters. In some embodiments, one or more transmitters transmits data, input, and/or output as processed by a central processing unit. In some embodiments, one or more transmitters transmits data and/or output to one or more user interface. In some embodiments, one or more transmitters transmits input to one or more measurement device.
[0062] In some embodiments, one or more receivers comprise configuration to receive light intensity data from one or more measurement devices described herein. In some embodiments, one or more receivers comprises configuration to receive light intensity data from one or more light intensity sensors described herein. In some embodiments, one or more receivers comprise configuration to receive input from one or more user interfaces described herein.
[0063] In some embodiments, a central processing unit comprises configuration to process light intensity data to calculate an absorption coefficient. In some embodiments, processing light intensity data comprises calculating light intensity differential from light intensity data. In some embodiments, a light intensity differential is a difference between a ratio of light intensity data in a comparator region to light intensity data in a biomass region and a ratio of light intensity data in a comparator region to light intensity data in a flow obstruction region. In some embodiments, light intensity differential provides an absorption coefficient. In some embodiments, an absorption coefficient may be calculated from the use of the equation set forth in EQUATION 1. In some embodiments, a central processing unit comprises configuration to utilize the equation set forth in EQUATION 1.
[0064] In some embodiments, a central processing unit comprises configuration to process a calculated absorption coefficient to determine an aquatic biomass measurement value. In some embodiments, processing a calculated absorption coefficient comprises determining the correlation between an aquatic biomass measurement value and an absorption coefficient. In some embodiments, processing a calculated absorption coefficient comprises the use of EQUATION 2. In some embodiments, a central processing unit comprises configuration to utilize the equation set forth in EQUATION 2. In some embodiments, an aquatic biomass measurement value comprises a value for mass, surface area, density, or combinations thereof of the aquatic biomass in the pond.
[0065] Configuration to utilize equations described herein and/or to process data, input, output, or combinations thereof, may comprise the use of software code and/or instructions which are stored in one more processing units, optionally within a central processing unit. In some embodiments, one or more processing units further comprise a memory unit. A memory unit may comprise storage capability for data, input, output, equations, software code, and/or instructions in a readable medium for use by one or more processing unit as described herein.
[0066] In some embodiments, one or more transmitters comprises configuration to transmit light intensity data to one or more user interfaces described herein. In some embodiments, one or more transmitters comprise configuration to transmit a calculated absorption coefficient to one or more user interfaces described herein. In some embodiments, one or more transmitters comprise configuration to transmit a determined aquatic biomass measurement value to one or more user interfaces described herein. In some embodiments, one or more transmitters comprise configuration to transmit a determined a value for mass of an aquatic biomass. In some embodiments, one or more transmitters comprise configuration to transmit a determined a value for surface area of an aquatic biomass. In some embodiments, one or more transmitters comprise configuration to transmit a determined a value for density of an aquatic biomass.
[0067] In some embodiments, one or more transmitters comprise configuration to transmit input to one or more measurement device described herein. In some embodiments, one or more transmitters comprise configuration to transmit input to one or more light sensor. In some embodiments, one or more transmitters transmit input as processed by a central processing unit and/or as received by a receiver from a user interface.
User Interface(s)
[0068] Systems and methods described herein comprise one or more user interfaces or a use thereof. In some embodiments, one or more user interfaces are communicatively coupled to one or more measurement devices; one or more light intensity sensors; one or more processing units; or any combination thereof.
[0069] In some embodiments, a user interface comprises configuration to display data and/output transmitted by a transmitter as described herein. In some embodiments, configuration to display data and/output comprises one or more of: a screen, a speaker, or combinations thereof. In some embodiments, a user interface displays light intensity data. In some embodiments, a user interface displays a calculated absorption coefficient. In some embodiments, a user interface displays a determined measurement value for an aquatic biomass.
[0070] In some embodiments, a user interface comprises any combination of input and/or output devices that allow a user to provide operator inputs to one or more processing units and/or that allow the one or more processing units to provide feedback to the user, such as a keyboard, keypad, touchpad, touchscreen, pointing device, mouse, buttons, knobs, mobile device, audio input device, audio output device, and/or the like.
Aquatic Biomass
[0071] Systems, methods, and devices described herein comprise an aquatic biomass or a use thereof. In some embodiments, an aquatic biomass comprises an aquatic photosynthetic organism. In some embodiments, an aquatic biomass comprises a member of the Bacillariophyta, Chlorophyta, Chrysophyta, Euglenophyta, Euglenozoa, Paeophyta, Porphyra, Pyrrophyta, Rhodophyta, or Xanthophyta phylum. In some embodiments, an aquatic biomass comprises a member of the Caulerpaceae, Chlorophyta, Chrysophyta, Chrysophyceae, Cryptophyceae, Dinophyceae, Euglenophyceae, Fucaceae, Florideophyceae, Gigartinaceae, Gracilariaceae, Laminariaceae, Lemnaceae, Salviniaceae, Monostromataceae, Phaeophyceae, Ulvaceae, Xanthophyceae, or Algae family. In some embodiments, an aquatic biomass comprises a member of the Amphora, Ankistrodesmus, Asteromonas, Azolla, Carteria, Chlamydomonas, Chlorella, Chlorococcum, Chlorogonium, Chlorophyceace, Chrysosphaera, Dunaliella, Euglena, Fucus, Furcellaria, Gracilaria, Haematococcus, Laminaria, Landoltia, Lemna, Macrocystis, Monoraphidium, Monostroma, Nannochloropsis, Neochloris, Oedogonium, Ochromona, Oscillatoria, Pelagomonas, Phormidium, Pleurococcus, Porphyra, Pyrobotrys, Sargassum, Scenedesmus, Selenastrum, Spirodela, Spirulina, Volvox, Wolffia, or Wolffiella genus. In some embodiments, an aquatic biomass comprises one or more of the following species: Lemna aequinoctialis, Lemna disperma, Lemna ecuadoriensis, Lemna gibba (swollen duckweed), Lemna japonica, Lemna minor, Lemna minuta, Lemna obscura, Lemna paucicostata, Lemna perpusilla, Lemna tenera, Lemna trisulca, Lemna turionifera, Lemna valdiviana, Lemna yungensis, Landoltia punctata, Spirodela polyrhiza, Wolffia arrhiza, Wolffia globosa, Azolla, Azolla caroliniana, Azolla cristata, Azolla filiculoides, Azolla imbricata, Azolla nilotica, Azolla pinnata, Azolla rubra, Ascophyllum nodosum, Botrydium, Caulerpa, Chondrus crispus, Euglenoids, Fucus, Fucus crispus, Fucus serratus, Fucus vesiculosus, Furcellaria lumbricalis, Gracilaria parvispora, Gracilaria tikvahiae, Laminaria digitata, Laminaria farlowii, Laminaria hyperborean, Laminaria nigripes, Macrocystis pyrifera, Monostroma kuroshiense, Monostroma latissimum, Monostroma nitidum, Prymnesium parvum, Palmaria palmata, Saccharina latissima, Tribonema, Ulva intestinalis, Vaucheria, Achnanthes orientalis, Agmenellum spp., Amphora coffeiformis, Amphora coffeiformis var. linea, Amphora coffeiformis var. punctata, Amphora coffeiformis var. taylori, Amphora coffeiformis var. tenis, Amphora delicatissima, Amphora delicatissima var. capitata, Amphora sp., Anabaena, Ankistrodesmus, Ankistrodesmus falcatus, Borodinella sp., Botryococcus braunii, Botryococcus sudeticus, Bracteococcus minor, Bracteococcus medionucleatus, Carteria, Chaetoceros gracilis, Chaetoceros muelleri, Chaetoceros muelleri var. subsalsum, Chaetoceros sp., Chlamydomas perigranulata, Chlorella anitrata, Chlorella antarctica, Chlorella aureoviridis, Chlorella Candida, Chlorella capsulate, Chlorella desiccate, Chlorella ellipsoidea, Chlorella emersonii, Chlorella fusca, Chlorella fusca var. vacuolate, Chlorella glucotropha, Chlorella infusionum, Chlorella infusionum var. actophila, Chlorella infusionum var. auxenophila, Chlorella kessleri, Chlorella lobophora, Chlorella luteoviridis, Chlorella luteoviridis var. aureoviridis, Chlorella luteoviridis var. lutescens, Chlorella miniata, Chlorella minutissima, Chlorella mutabilis, Chlorella nocturna, Chlorella ovalis, Chlorella parva, Chlorella photophila, Chlorella pringsheimii, Chlorella protothecoides, Chlorella protothecoides var. acidicola, Chlorella regularis, Chlorella regularis var. minima, Chlorella regularis var. umbricata, Chlorella reisiglii, Chlorella saccharophila, Chlorella saccharophila var. ellipsoidea, Chlorella salina, Chlorella simplex, Chlorella sorokiniana, Chlorella sp., Chlorella sphaerica, Chlorella stigmatophora, Chlorella vanniellii, Chlorella vulgaris, Chlorella vulgaris fo. tertia, Chlorella vulgaris var. autotrophica, Chlorella vulgaris var. viridis, Chlorella vulgaris var. vulgaris, Chlorella vulgaris var. vulgaris fo. tertia, Chlorella vulgaris var. vulgaris fo. viridis, Chlorella xanthella, Chlorella zofingiensis, Chlorella trebouxioides, Chlorella vulgaris, Chlorococcum infusionum, Chlorococcum sp., Chlorogonium, Chroomonas sp., Chrysosphaera sp., Crypthecodinium cohnii, Cryptomonas sp., Cyclotella cryptica, Cyclotella meneghiniana, Cyclotella sp., Dunaliella sp., Dunaliella bardawil, Dunaliella bioculata, Dunaliella granulate, Dunaliella maritime, Dunaliella minuta, Dunaliella parva, Dunaliella peircei, Dunaliella primolecta, Dunaliella salina, Dunaliella terricola, Dunaliella tertiolecta, Dunaliella viridis, Dunaliella tertiolecta, Eremosphaera viridis, Eremosphaera sp., Euglena spp., Franceia sp., Fragilaria crotonensis, Fragilaria sp., Gleocapsa sp., Gloeothamnion sp., Haematococcus pluvialis, Hymenomonas sp., Isochrysis aff. galbana, Isochrysis galbana, Lepocinclis, Micractinium, Micractinium, Monoraphidium minutum, Monoraphidium sp., Nannochloris sp., Nannochloropsis salina, Nannochloropsis sp., Navicula acceptata, Navicula biskanterae, Navicula pseudotenelloides, Navicula pelliculosa, Navicula saprophila, Navicula sp., Nephroselmis sp., Nitschia communis, Nitzschia alexandrine, Nitzschia closterium, Nitzschia communis, Nitzschia dissipata, Nitzschia frustulum, Nitzschia hantzschiana, Nitzschia inconspicua, Nitzschia intermedia, Nitzschia microcephala, Nitzschia pusilla, Nitzschia pusilla elliptica, Nitzschia pusilla monoensis, Nitzschia quadrangular, Nitzschia sp., Ochromonas sp., Oocystis parva, Oocystis pusilla, Oocystis sp., Oscillatoria limnetica, Oscillatoria sp., Oscillatoria subbrevis, Parachlorella kessleri, Pascheria acidophila, Pavlova sp., Phaeodactylum tricomutum, Phacus, Phormidium, Platymonas sp., Pleurochrysis camerae, Pleurochrysis dentate, Pleurochrysis sp., Prototheca wickerhamii, Prototheca stagnora, Prototheca portoricensis, Prototheca moriformis, Prototheca zopfii, Pseudochlorella aquatica, Pyramimonas sp., Pyrobotrys, Rhodococcus opacus, Sarcinoid chrysophyte, Scenedesmus armatus, Schizochytrium, Spirogyra, Spirulina platensis, Stichococcus sp., Synechococcus sp., Synechocystisf, Tetraedron, Tetraselmis sp., Tetraselmis suecica, and Thalassiosira weissflogii. In some embodiments, an aquatic biomass comprises one or more of duckweed, duckweed fern, mosquito fern, water fern, fairy moss, algae, lesser duckweed, minute duckweed, gibbous duckweed, common duckweed, ivy duckweed, least duckweed, Valdivia duckweed, rockweed, gutweed, green algae, golden algae, golden brown algae, golden brown algae and diatoms, fire algae, red algae, yellow-green algae, brown algae, single-cell algae, microalgae, macroalgae, kombu, kelp, sugarkelp, grass kelp, giant kelp, bladder kelp, sea oak, knotted kelp, knotted wrack, sea lettuce, serrated wrack, carrageen, forked seaweed, brown seaweed, dulse, or dulce sol.
[0072] In some embodiments, an aquatic biomass used herein comprises one or more organisms described herein. In some embodiments, an aquatic biomass described herein comprises any chlorophyll-containing plant material. In some embodiments, an aquatic biomass used herein comprises an aquatic surface dwelling plant. In some embodiments, an aquatic biomass used herein comprises Lemna minor.
[0073] In some embodiments, an aquatic biomass described herein comprises a sequence that has at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100% sequence identity with any one of the sequences as set forth in SEQ ID NOS: 1-2, and 9-10.
Cultivation of Aquatic Biomass
[0074] In some embodiments, systems and methods described herein are useful for cultivating an aquatic biomass. In some embodiments, cultivation of an aquatic biomass comprises cultivating an aquatic biomass in an aqueous liquid as contained by a body of liquid as described herein.
[0075] In some embodiments, systems and methods described herein are useful for optimizing growth of an aquatic biomass. Such systems and methods comprise the cultivation of an aquatic biomass and further comprise adjusting an inoculation amount and/or harvest amount of said aquatic biomass as based on a measurement of an aquatic biomass described herein. In some embodiments, an inoculation amount comprises an amount of aquatic biomass to be added to an aqueous liquid. In some embodiments, an inoculation amount may be calculated from EQUATION 3. In some embodiments, an inoculation amount comprises an amount of aquatic biomass to be removed from the aqueous liquid. In some embodiments, a harvest amount may be calculated from EQUATION 4. In some embodiments, one or more processing units, and optionally a central processing unit, may comprise configuration to calculate inoculation amount and/or harvest amount.
[0076] In some embodiments, systems and methods described herein further comprise the use of a harvesting unit, wherein the harvesting unit comprises configuration to remove an amount of aquatic biomass from an aqueous liquid. In some embodiments, a harvesting unit comprises an obstruction pipe. In some embodiments, an obstruction pipe is a polyvinyl chloride (PVC) pipe. In some embodiments, an obstruction pipe comprises a pipe with a diameter of about 4 inches to about 6 inches. In some embodiments, an obstruction pipe comprises a pipe with a diameter equal to or greater than a thickness of an aquatic biomass. In some embodiments, an obstruction pipe comprises a diameter of about 1 inch to about 2 inches.
[0077] In some embodiments, systems and methods described herein further comprise the use of an inoculation unit, wherein the inoculation unit comprises configuration to add an amount of aquatic biomass to an aqueous liquid. In some embodiments, an inoculation unit comprises a net. In some embodiments, a net is a net bag, hoop net, scoop net, tubular net, mesh net, fishing net, drive-in net, or mounted net.
[0078] In some embodiments, targeted optimized growth of an aquatic biomass comprises a mat density of less than about 50 g/m.sup.2, from about 50 g/m.sup.2 to about 3000 g/m.sup.2, or more In some embodiments, targeted optimized growth of an aquatic biomass comprises a mat density of about 50 g/m.sup.2, about 100 g/m.sup.2, about 200 g/m.sup.2, about 400 g/m.sup.2, about 600 g/m.sup.2, about 800 g/m.sup.2, about 1000 g/m.sup.2, about 1200 g/m.sup.2, about 1400 g/m.sup.2, about 1600 g/m.sup.2, about 1800 g/m.sup.2, about 2000 g/m.sup.2, about 2200 g/m.sup.2, about 2400 g/m.sup.2, about 2600 g/m.sup.2, about 2800 g/m.sup.2, about 3000 g/m.sup.2, or more. In some embodiments, targeted optimized growth of an aquatic biomass comprises a mat density of about 750 g/m.sup.2 to about 1500 g/m.sup.2.
[0079] In some embodiments, targeted optimized growth of an aquatic biomass comprises a mat density of less than 200 g/m.sup.2, about 200 g/m.sup.2 to about 2000 g/m.sup.2, or more. In some embodiments, targeted optimized growth of an aquatic biomass comprises a mat density of about 200 g/m.sup.2, about 400 g/m.sup.2, about 600 g/m.sup.2, about 800 g/m.sup.2, about 1000 g/m.sup.2, about 1200 g/m.sup.2, about 1400 g/m.sup.2, about 1600 g/m.sup.2, about 1800 g/m.sup.2, about 2000 g/m.sup.2, or more.
[0080] In some embodiments, targeted optimized growth of an aquatic biomass comprises a thickness of about 0.1 mm to about 10 mm, or more. In some embodiments, targeted optimized growth of an aquatic biomass comprises a thickness of about 0.1 mm, about 0.2 mm, about 0.3 mm, about 0.4 mm, about 0.5 mm, about 0.6 mm, about 0.7 mm, about 0.8 mm, about 0.9 mm, about 1 mm, about 1.5 mm, about 2 mm, about 2.5 mm, about 3 mm, about 3.5 mm, about 4 mm, about 4.5 mm, about 5 mm, about 5.5 mm, about 6 mm, about 6.5 mm, about 7 mm, about 7.5 mm, about 8 mm, about 8.5 mm, about 9 mm, about 9.5 mm, about 10 mm, or more. In some embodiments, thickness may be median or average thickness.
[0081] In some embodiments, targeted optimized growth of an aquatic biomass comprises a growth rate of about 10 g/m.sup.2 per day to about 300 g/m.sup.2 per day. In some embodiments, targeted optimized growth of an aquatic biomass comprises a growth rate of about 10 g/m.sup.2 per day to about 150 g/m.sup.2 per day. In some embodiments, targeted optimized growth of an aquatic biomass comprises a growth rate of about 100 g/m.sup.2 per day to about 300 g/m.sup.2 per day. In some embodiments, targeted optimized growth of an aquatic biomass comprises a growth rate of about 10 g/m.sup.2, about 50 g/m.sup.2, about 100 g/m.sup.2, about 150 g/m.sup.2, about 200 g/m.sup.2, about 250 g/m.sup.2, or about 300 g/m.sup.2 per day. In some embodiments, targeted optimized growth of an aquatic biomass comprises a growth rate of less than about 10 g/m.sup.2 per day. In some embodiments, targeted optimized growth of an aquatic biomass comprises a growth rate of more than about 300 g/m.sup.2 per day.
[0082] In some embodiments, optimizing growth of an aquatic biomass comprises adjusting an inoculation or harvest amount of an aquatic biomass based on a calculated mass, surface area, or density of an aquatic biomass. In some embodiments, optimizing growth of an aquatic biomass comprises adjusting a growth rate. In some embodiments, optimizing growth of an aquatic biomass comprises adjusting aqueous liquid turbidity, temperature, pH, nutrients concentration, flow rate, light intensity, and the like.
[0083] In some embodiments, systems and methods for measuring aquatic biomass described herein are useful for maximizing plant protein harvest. Such systems and methods comprise the cultivation of an aquatic biomass, optimizing growth of an aquatic biomass, and further comprise harvesting aquatic biomass for use the production of plant protein, wherein said plant protein harvested is thereby maximized. In some embodiments, upon harvesting plant protein, systems and methods described herein further comprise a system of or a method of plant protein production.
Plant Protein Production and Isolation
[0084] In some embodiments, systems and methods described herein are useful for the production of plant protein. In some embodiments, methods of plant production comprise: measuring an aquatic biomass measurement as described herein, harvesting aquatic biomass upon reaching the targeted biomass measurement, and extracting plant protein from the harvested aquatic biomass. In some embodiments, provided herein are compositions comprising plant protein described herein.
[0085] Proteins can be extracted from aquatic biomass through any known processes, wherein aquatic biomass generally comprises plant material. For example, plant material containing protein, such as RuBisCO, can be homogenized and the protein extracted from the pulp and/or liquid. The extract can be further clarified, filtered, and washed to arrive at the described protein isolate. Other extraction processes can include solvent extraction (e.g., using polar solvents, organic solvents, or supercritical fluids), chromatography (e.g., preparative liquid chromatography), clarification, distillation, filtration (e.g., ultrafiltration), recrystallization, and/or solvent-solvent partitioning.
[0086] In some embodiments, described herein is a process for making a purified protein isolate from a plant material, comprising the steps of: a) providing the plant material in a solution comprising a reducing agent; b) lysing the plant material; c) separating the lysed plant material into a solid phase and a liquid phase, wherein the liquid phase contains soluble protein and chlorophyll; d) coagulating the chlorophyll in the liquid phase by heating it to a first set temperature in no more than about 30 min, then cooling it to a second set temperature in no more than about 30 min, wherein the cooling is initiated when the liquid phase reaches the first set temperature; e) contacting the liquid phase of d) with a flocculant and/or an adsorbent, and mixing for a period of time sufficient to flocculate and/or adsorb chlorophyll in the liquid phase to the adsorbent, thereby forming a flocculated mixture; f) separating the flocculated mixture of e) into a solid phase and a liquid phase; and g) filtering the liquid phase of f) to yield a filtrate containing a purified protein. In some embodiments, the plant material is harvested and cleaned before the process is started. For instance, in some embodiments, the plant material is chemically washed or washed with water prior to processing. In some embodiments, the plant material is washed more than one time prior to processing.
[0087] In some embodiments, the plant material is mixed in a solution comprising a reducing agent. Examples of reducing agents suitable for use in the disclosed processes include, but are not limited to, 2-mercaptoethanol (BME), 2-mercaptoethylamine-HCL, sodium sulfite, magnesium sulfite, sodium metabisulfite, sodium bisulfite, cysteine hydrochloride, dithiothreitol (DTT), glutathione, cysteine, tris(2-carboxyethyl)phosphine (TCEP), ferrous ion, nascent hydrogen, sodium amalgam, oxalic acid, formic acid, magnesium, manganese, phosphorous acid, potassium, sodium, and any combination thereof. Said solution may comprise other components to provide beneficial properties to the solution or to the process. Examples such components include buffering agents, chelating agents, protease inhibitors, pH adjustors, and the like.
[0088] Lysing can be through any suitable method to disrupt plant material and release cellular contents, such as a plant cell's cytoplasm. Types of lysing described herein include mechanical, chemical, and/or enzymatic lysis. Mechanical lysing encompassed by the processes described herein includes, but is not limited to, mechanical agitation, pressure, grinding, squeezing, shearing, using a blender, using a mill, using a press, a sonicator, a nitrogen burst, ultrasonic energy, by freezing, using a homogenizer, a pulse electric field, a disintegrator, more than one of the foregoing, or any combination thereof. Chemically lysing encompassed by the processes described herein includes, but is not limited to, lysed chemically using one or more of detergents (e.g., ionic, cationic, anionic, sodium dodecyl sulfates, non-ionic, zwitterionic, hypotonic, hypertonic, and isotonic detergents and the like). Chemically lysing encompassed by the processes described herein includes, but is not limited to, using one or more enzymes, such as cellulase and/or pectinase. Separation of the lysed plant material and/or flocculated mixture into solid phase and a liquid phase may be performed by any suitable solid-liquid separation technique. Suitable solid-liquid separation techniques include but are not limited to: gravity settling, sieving (e.g., circular vibratory separator or a linear/inclined motion shaker), filtration (e.g., dead-end filtration system, using ultrafiltration, using a tangential flow filtration system, or using a plate filter), centrifugation (e.g., disk stack centrifuge, a decanter centrifuge, a continuous centrifuge, or a basket centrifuge), a press (e.g., screw press, a French press, a belt press, a filter press, a fan press, a finisher press, or a rotary press), or decanting (e.g., using a decantor), or any combination thereof.
[0089] The process for making the protein isolates described herein can also comprise a step of coagulating components that are undesired (e.g., components that are not protein, such as RuBisCO) using any suitable method to effect coagulation. Examples include, but are not limited to: heat treatment, cooling; addition of one or more salts (e.g., a calcium salt, a magnesium salt, a beryllium salt, a zinc salt, a cadmium salt, a copper salt, an iron salt, a cobalt salt, a tin salt, a strontium salt, a barium salt, a radium salt, calcium chloride, calcium nitrate, or iron carbonate potassium phosphate, calcium chloride, or any combination thereof); addition of quaternary ammonia specie; addition of a polymer based coagulate; electrocoagulation; and the like.
[0090] The process for making the protein preparation may also comprise a step of contacting the liquid phase with a flocculant and/or an adsorbent and mixing for a period of time sufficient to flocculate and/or adsorb chlorophyll in the liquid phase to the adsorbent, thereby forming a flocculated mixture. Any suitable process of flocculation can be used and exemplary flocculants may include, but are not limited to, an alkylamine epichlorohydrin, polydimethyldiallylammonium chloride, a polysaccharide (e.g., chitosan), a polyamine, starch, aluminum sulphate, alum, polyacrylamide, polyacromide, or polyethyleneimine. Any suitable adsorbent can be used and exemplary adsorbents may include activated carbon, graphite, silica gel, zeolites, clay, polyethylene, and resins (e.g., ion-exchange resins, size exclusion chromatography (SEC) resins, affinity based resins, or hydrophobicity based resin).
[0091] After the separation of the flocculated mixture into a solid phase and a liquid phase, the liquid phase may be filtered to yield a filtrate containing the purified protein. Any suitable method of filtration can be used and include, for example, the use of surface filters, depth filters, by membrane filtration, column filtration, diafiltration, ultrafiltration, tangential flow filtration, filtration with diatomaceous earth, filtration with silt, filtration with activated carbon, and the like.
[0092] Liquid phases and/or filtrates can be further sterilized, concentrated, dialyzed, dried, and/or otherwise processed to provide protein isolates for use herein. In some embodiments, liquid phases and/or filtrates may be dried. In some embodiments, drying may be accomplished using a spray dryer, a freeze dryer, drum drying, film drying, bed drying, a flash dryer, or a rotary dryer.
[0093] In some embodiments, the purity of protein isolates described herein is at least about 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or more. In some embodiments, the purity of protein isolate described herein is 80% or more. In certain embodiments, protein isolates described herein may contain no more than 50%, 40%, 30%, 20% 10% or less impurities. In certain embodiments, protein isolates described herein may contain no more than 20% 10% or less impurities. In some embodiments, processes described herein produce one or more by-products, such as sodium hydroxide.
[0094] In some embodiments, the methods of plant protein production described herein comprise extracting plant protein isolate from harvest aquatic biomass. In some embodiments, plant protein isolate is RuBisCO, wheat gluten, a dehydrin protein, an albumin, a conglycinin, a globulin, a zein, a leghemoglobin, a non-symbiotic hemoglobin, or a cytoplasmic actin. Non-limiting examples of suitable plant proteins include RuBisCO, an algal protein, a seaweed protein, an albumin, a gluten, a glycinin, a conglycinin, a legumin, a globulin, a vicilin, a conalbumin, a gliadin, a glutelin, a glutenin, a hordein, a prolamin, a phaseolin, a proteinoplast, a secalin, a triticeae gluten, a zein, an oleosin, a caloleosin, a steroleosin, or mixtures thereof (e.g., albumin fractions). In some embodiments, plant protein isolate is RuBisCo.
[0095] In some embodiments, plant protein isolate described herein can be used to formulate compositions for use herein. In some embodiments, RuBisCO used in compositions disclosed herein is isolated from one or more sources described herein.
[0096] In some embodiments, a RuBisCO protein isolate is free from other substances, including naturally occurring substances, such as chlorophyll, and/or substances added to isolate RuBisCO protein from a RuBisCO source, such as a solvent or water. In some embodiments, RuBisCO protein isolate is chlorophyll-free. In some embodiments, RuBisCO is also flavorless, tasteless, colorless, and/or uncolored.
[0097] Subsequent extraction, RuBisCO proteins may be further processed to improve the purity of the protein sample. In other scenarios, the extracted RuBisCO may undergo further processing (e.g., adjusting the pH, adjusting the heat, etc.) in order to concentrate the extracted proteins.
[0098] Additionally, extracted RuBisCO proteins may also be combined with other proteins, where such combination may occur before or after the additional processing described. In some embodiments, RuBisCO protein isolate comprises other proteins, including but not limited to: pea proteins, isolates, and/or concentrates; garbanzo (chickpea) proteins, isolates, and/or concentrates; fava bean proteins, isolates, and/or concentrates; soy proteins, isolates, and/or concentrates; rice proteins, isolates, and/or concentrate; potato proteins, isolates, and/or concentrates; hemp proteins, isolates, and/or concentrates; canola proteins, isolates, and/or concentrates; wheat proteins, isolates, and/or concentrates; corn proteins, isolates, and/or concentrates; zein proteins, isolates, and/or concentrates; rice proteins, isolates, and/or concentrates; oat proteins, isolates, and/or concentrates; potatoes proteins, isolates, and/or concentrates; peanut proteins, isolates, and/or concentrates; legumes/pulses proteins, isolates, and/or concentrates; lentils proteins, isolates, and/or concentrates; or any combinations thereof. RuBisCO protein and other protein combinations. In some examples, RuBisCO and additional proteins may be in a dry form (e.g., powdered, pelletized, or the like). In other examples, the RuBisCO and the additional proteins may be in a liquid form or in a liquid solution. In some embodiments, a RuBisCO protein isolate from one source, may be combined with a RuBisCO protein isolate from separate source. For example, RuBisCO protein isolate may be extracted from an aquatic biomass (e.g., Lemna minor) and combined with RuBisCO extracted from a second source (e.g., Chlorella vulgaris).
[0099] In some embodiments, the RuBisCO protein isolate comprises protein comprising a sequence that has at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100% sequence identity with any one of the sequences as set forth in TABLE 1. In some embodiments, the RuBisCO protein isolate comprises protein comprising a sequence that has at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100% sequence identity with more than one of the sequences as set forth in TABLE 1. In some embodiments, the RuBisCO protein isolate comprises one or more protein comprising one or more sequences, each of which has at least about 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 99%, or about 100% sequence identity with any one of the sequences as set forth in SEQ ID NOs: 1 to 10. Provided in TABLE 1 are large and small RuBisCO subunits for various species described herein, including Lemna minor, Nicotiana tabacum, Medicago sativa (alfalfa), Spinacia oleracea (Spinach), and Chlorella vulgaris (green algae).
TABLE-US-00001 TABLE1 RUBISCOSEQUENCES SEQ ID NO: Sequence 1 MSPQTETKASAGFKAGVKDYKLNYYTPEYETKDTDILAAFRVTP QPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIE PVAGEENQFIAYIAYPLDLFEEGSVTNMFTSIVGNVFGFKALRA LRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKP KLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF CAEAIYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPI VMHDYLTGGFTANTSLAYYCRDNGLLLHIHRAMHAVIDRQKNHG MHFRVLAKALRMSGGDHVHSGTVVGKLEGEREMTLGFVDLLRDD FIEKDRSRGIFFTQDWVSMPGVLPVASGGIHVWHMPALTEIFGD DSVLQFGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLARE GNEIIREACNWSPELAAACEVWKEIKFEYEPVDKLDVK 2 MASSMMASTAAAVARAGPAQSSMVPFNACRSSVPFPATRKANNN LSTLPGNGGRVSCMQVWPPEGLKKFETLSYLPPLSVEDLAKEVD YLLRNDWVPCIEFSKEGFVYRENHASPGYYDGRYWTMWKLPMFG CTDASQVIAEVEEAKKAYPEYFVRIIGFDNKRQVQCISFIAYKP T 3 MSPQTETKASVGFKAGVKEYKLTYYTPEYQTKDTDILAAFRVTP QPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYRIE RVVGEKDQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRA LRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKP KLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF CAEALYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPI VMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAVIDRQKNHG IHFRVLAKALRMSGGDHIHSGTVVGKLEGERDITLGFVDLLRDD FVEQDRSRGIYFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGD DSVLQFGGGTLGHPWGNAPGAVANRVALEACVKARNEGRDLAQE GNEIIREACKWSPELAAACEVWKEIVFNFAAVDVLDK 4 MAFLIMSSAAAVATGTNAAQASMIAPFTGLKSATSFPVSRKQNL DITSIASNGGRVQCMQVWPPINKKKYETLSYLPDLSEEQLLREV EYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPM FGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAY KPEGY 5 MSPQTETKATVGFKAGVKDYRLTYYTPDYETKDTDILAAFRVSP QPGVPAEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIE PVAGEETQFIAYVAYPLDLFEEGSVNYMFTSIVGNVFGFKALRA LRLEDLRIPAAYVKTFQGPPQGIQVERDKLNKYGRPLLGCTIKP KLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF CAEAIYKAQAETGEIKGHYLNATAGTCEEMMKRAVFARELGVPI VMHDYLTVGFTANTTLAHYCRDNGLLLHIHRAMHAVIDRQKNHG MHFRVLAKALRMSGGDHIHAGTVVGKLEGERDITLGFVDLLRDD FIEKDRSRGIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGD DSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDTLAR EGNEIIREAKWSPELAAACEVWKEIKFEFPAMDN 6 MALISSAAVTTVNRASSAQANLVAPFTGLKSSAGFPVTKKTNND ITSIASNGGRVNCMQVWPPVGKKKFETLSYLPPLTEEQLAKEVE YLIRKGWIPCLEFELEKGFVYRENHRSPGYYDGRYWTMWRLPLF GATDSSQVLKELADCKAEYPDSFIRIIGFDNVRQVQCISFIAHT PKNY 7 MSPQTETKASVEFKAGVKDYKLTYYTPEYETLDTDILAAFRVSP QPGVPPEEAGAAVAAESSTGTWTTVWTDGLTNLDRYKGRCYHIE PVAGEENQYICYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRA LRLEDLRIPVAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKP KLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF CAEALYKAQAETGEIKGHYLNATAGTCEDMMKRAVFARELGVPI VMHDYLTGGFTANTTLSHYCRDNGLLLHIHRAMHAVIDRQKNHG MHFRVLAKALRLSGGDHIHSGTVVGKLEGERDITLGFVDLLRDD YTEKDRSRGIYFTQSWVSTPGVLPVASGGIHVWHMPALTEIFGD DSVLQFGGGTLGHPWGNAPGAVANRVALEACVQARNEGRDLARE GNTIIREATKWSPELAAACEVWKEIKFEFPAMDTV 8 MQVWPPLGLKKFETLSYLPPLTTEQLLAEVNYLLVKGWIPPLEF EVKDGFVYREHDKSPGYYDGRYWTMWKLPMFGGTDPAQVVNEVE EVKKAPPDAFVRFIGFNDKREVQCISFIAYKPAGY 9 MSPQTETKARVGFKAGVKDYRLTYYTPDYQPKDTDILAAFRMTP QPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIE PVPGEENQYIAYIAYPLDLFEEGSVTNLFTSIVGNVFGFKALRA LRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRGLLGCTIKP KLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLF VAEAIYKSQAETGEIKGHYLNATAATAEAMMQRAECAKDLGVPI IMHDYLTGGFTANTSLSHYCRDNGLLLHIHRAMHAVIDRQRNHG ITFRVLAKALRLSGGDHLHSGTVVGKLEGEREVTLGFVDLMRDD YIEKDRSRGIYFTQDWVSLPGTMPVASGGIHVWHMPALVEIFGD DACLQFGGGTLGHPWGNAPGAAANRVALEACTQARNEGRDLARE GGDVIRAACKWSPELAAACEVWKEIKFEFETIDTL 10 MAALTASLVSCPVAVAAKPARLASPAWPASLSPRRLSPPSPRGP SQTAAAPARCSCGSPLTTSSSRPSPTCPSDRRPDRQAGRLHHPS GWTPALEFSNAESAYVKDVANIRFTGGSASCNYYDNRYWAMYKL PMFGCTDASQVLAEIANAVKTFPDSYVRMAAFDAVRQVQTVAIL VHRPASATDYRLPENPQPLIGCTTQLERPQYCKSLANL
[0100] In some embodiments, a RuBisCO protein isolate comprises protein comprising sequence that has at least 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% sequence identity to SEQ ID NO: 1 or 2 or both.
[0101] In some embodiments, a RuBisCO protein isolate comprises protein comprising sequence that has at least 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% sequence identity to SEQ ID NO: 3 or 4 or both.
[0102] In some embodiments, a RuBisCO protein isolate comprises protein comprising sequence that has at least 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% sequence identity to SEQ ID NO: 5 or 6 or both.
[0103] In some embodiments, a RuBisCO protein isolate comprises protein comprising sequence that has at least 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% sequence identity to SEQ ID NO: 7 or 8 or both.
[0104] In some embodiments, a RuBisCO protein isolate comprises protein comprising sequence that has at least 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% sequence identity to SEQ ID NO: 9 or 10 or both.
[0105] RuBisCO is composed of 8 large subunits with a molecular mass of about 53 kDalton and 8 small subunits with a molecular mass of about 12 kDalton. Accordingly, in some embodiments, a disclosed RuBisCO protein isolate comprises one or more large subunits, one or more small subunits, or any combination thereof. For example, a RuBisCO protein isolate includes a large subunit, a small subunit or both. In some embodiments, a RuBisCO subunit comprises an amino acid sequence in any one of the Uniprot records set forth in TABLE 2.
TABLE-US-00002 TABLE 2 RUBISCO SUBUNITS Subunit Uniprot Accession Number Large A9L9A4, A0A3GlN0S3, K4Fl51, A0A3GlMVZ6, H9ALP2, D6NJG9, Q8WHI2, G8D4W8, D3W4G8, H9ALP3, G0WYT7, B5WX54, A0A1S7JIB4, A0A482K3Y6, R9S086, A0A411PP11, D6NJG2, H9AHZ6, Q8WHI1, R4I7N5, 085040, Q31NB3, P00880, P00875, P00879, O93627, O03042, P0C2C2, P04718, P00877, P0C512, P04717, P00876, Pll383, P22849, Q8DIS5, P22859, 085040,B0Z5Bl, Q31HD8, P22850, Small P19309, P19308, P19310, P19311, Pl9312, P00872, P10795, B3H5S2, P10796, P10797, A0A0S4IJL0, P45686, P04716, P69249, Q0INY7, Q31NB2, P05348, P08475, P00873,
[0106] In some embodiments, a RuBisCO protein isolate comprises protein comprising sequence that has at least 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% sequence identity to an amino acid sequence as set forth in any one of the records described in TABLE 2.
[0107] In some embodiments, a disclosed RuBisCO protein isolate comprises protein comprising about 4 to about 478 contiguous amino acids, but is less than the full-length, native or naturally occurring, wild-type ribulose-1,5-bisphosphate carboxylase/oxygenase polypeptide. In some embodiments, a disclosed RuBisCO protein isolate comprises protein comprising about 4, about 5, about 6, about 7, about 8, about 9, about 10, about 11, about 12, about 13, about 14, about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29, about 30, about 31, about 32, about 33, about 34, about 35, about 36, about 37, about 38, about 39, about 40, about 41, about 42, about 43, about 44, about 45, about 46, about 47, about 48, about 49, about 50, about 51, about 52, about 53, about 54, about 55, about 56, about 57, about 58, about 59, about 60, about 61, about 62, about 63, about 64, about 65, about 66, about 67, about 68, about 69, about 70, about 71, about 72, about 73, about 74, about 75, about 76, about 77, about 78, about 79, about 80, about 81, about 82, about 83, about 84, about 85, about 86, about 87, about 88, about 89, about 90, about 91, about 92, about 93, about 94, about 95, about 96, about 97, about 98, about 99, about 100, about 101, about 102, about 103, about 104, about 105, about 106, about 107, about 108, about 109, about 110, about 111, about 112, about 113, about 114, about 115, about 116, about 117, about 118, about 119, about 120, about 121, about 122, about 123, about 124, about 125, about 126, about 127, about 128, about 129, about 130, about 131, about 132, about 133, about 134, about 135, about 136, about 137, about 138, about 139, about 140, about 141, about 142, about 143, about 144, about 145, about 146, about 147, about 148, about 149, about 150, about 151, about 152, about 153, about 154, about 155, about 156, about 157, about 158, about 159, about 160, about 161, about 162, about 163, about 164, about 165, about 166, about 167, about 168, about 169, about 170, about 171, about 172, about 173, about 174, about 175, about 176, about 177, about 178, about 179, about 180, about 181, about 182, about 183, about 184, about 185, about 186, about 187, about 188, about 189, about 190, about 191, about 192, about 193, about 194, about 195, about 196, about 197, about 198, about 199, about 200, about 201, about 202, about 203, about 204, about 205, about 206, about 207, about 208, about 209, about 210, about 211, about 212, about 213, about 214, about 215, about 216, about 217, about 218, about 219, about 220, about 221, about 222, about 223, about 224, about 225, about 226, about 227, about 228, about 229, about 230, about 231, about 232, about 233, about 234, about 235, about 236, about 237, about 238, about 239, about 240, about 241, about 242, about 243, about 244, about 245, about 246, about 247, about 248, about 249, about 250, about 251, about 252, about 253, about 254, about 255, about 256, about 257, about 258, about 259, about 260, about 261, about 262, about 263, about 264, about 265, about 266, about 267, about 268, about 269, about 270, about 271, about 272, about 273, about 274, about 275, about 276, about 277, about 278, about 279, about 280, about 281, about 282, about 283, about 284, about 285, about 286, about 287, about 288, about 289, about 290, about 291, about 292, about 293, about 294, about 295, about 296, about 297, about 298, about 299, about 300, about 301, about 302, about 303, about 304, about 305, about 306, about 307, about 308, about 309, about 310, about 311, about 312, about 313, about 314, about 315, about 316, about 317, about 318, about 319, about 320, about 321, about 322, about 323, about 324, about 325, about 326, about 327, about 328, about 329, about 330, about 331, about 332, about 333, about 334, about 335, about 336, about 337, about 338, about 339, about 340, about 341, about 342, about 343, about 344, about 345, about 346, about 347, about 348, about 349, about 350, about 351, about 352, about 353, about 354, about 355, about 356, about 357, about 358, about 359, about 360, about 361, about 362, about 363, about 364, about 365, about 366, about 367, about 368, about 369, about 370, about 371, about 372, about 373, about 374, about 375, about 376, about 377, about 378, about 379, about 380, about 381, about 382, about 383, about 384, about 385, about 386, about 387, about 388, about 389, about 390, about 391, about 392, about 393, about 394, about 395, about 396, about 397, about 398, about 399, about 400, about 401, about 402, about 403, about 404, about 405, about 406, about 407, about 408, about 409, about 410, about 411, about 412, about 413, about 414, about 415, about 416, about 417, about 418, about 419, about 420, about 421, about 422, about 423, about 424, about 425, about 426, about 427, about 428, about 429, about 430, about 431, about 432, about 433, about 434, about 435, about 436, about 437, about 438, about 439, about 440, about 441, about 442, about 443, about 444, about 445, about 446, about 447, about 448, about 449, about 450, about 451, about 452, about 453, about 454, about 455, about 456, about 457, about 458, about 459, about 460, about 461, about 462, about 463, about 464, about 465, about 466, about 467, about 468, about 469, about 470, about 471, about 472, about 473, about 474, about 475, about 476, about 477, or about 478 contiguous amino acids of SEQ ID NO: 1, 2, both, one or more large subunits set forth in TABLE 2, one or more small subunits set forth in TABLE 2, or any combination thereof, but is less than the full-length, native or naturally occurring, wild-type ribulose-1,5-bisphosphate carboxylase/oxygenase polypeptide.
[0108] In some embodiments, compositions disclosed herein comprise about 1%, about 2%, about 3%, about 4%, about 5%, about 6%, about 7%, about 8%, about 9%, about 10%, about 11%, about 12%, about 13%, about 14%, about 15%, about 16%, about 17%, about 18%, about 19%, about 20%, about 21%, about 22%, about 23%, about 24%, about 25%, about 26%, about 27%, about 28%, about 29%, about 30%, about 31%, about 32%, about 33%, about 34%, about 35%, about 36%, about 37%, about 38%, about 39%, about 40%, about 41%, about 42%, about 43%, about 44%, about 45%, about 46%, about 47%, about 48%, about 49%, about 50%, about 51%, about 52%, about 53%, about 54%, about 55%, about 56%, about 57%, about 58%, about 59%, about 60%, about 61%, about 62%, about 63%, about 64%, about 65%, about 66%, about 67%, about 68%, about 69%, about 70%, about 71%, about 72%, about 73%, about 74%, about 75%, about 76%, about 77%, about 78%, about 79%, about 80%, about 81%, about 82%, about 83%, about 84%, about 85%, about 86%, about 87%, about 88%, about 89%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or about 100% protein isolate by dry weight or total weight. In some embodiments, the compositions comprise about 5% to about 80%, about 6% to about 50%, about 7% to about 40%, about 8% to about 30%, about 9% to about 20%, or about 10% to about 15% protein isolate by dry weight or total weight. In certain embodiments, total weight includes a preservative solution. In some embodiments, description of a measurement by weight is understood to encompass dry weight or total weight.
[0109] In some embodiments, compositions disclosed herein comprise about 1 g to about 100 g of protein isolate. In some embodiments, compositions disclosed herein comprise about 1 g, about 2 g, about 3 g, about 4 g, about 5 g, about 6 g, about 7 g, about 8 g, about 9 g, about 10 g, about 20 g, about 30 g, about 40 g, about 50 g, about 60 g, about 70 g, about 80 g, about 90 g, about 100 g, or more of a protein isolate, such as a RuBisCO protein isolate.
Measurement Device(s)
[0110] Provided herein are one or more measurement devices for measuring an aquatic biomass. In some embodiments, devices for measuring comprises: a shield and one or more light intensity sensors to collect one or more measurements of light intensity as described herein. In some embodiments, a measurement device further comprises one or more arms.
[0111] In some embodiments, one or more measurement devices comprises a shield. In some embodiments, a shield obstructs at least a portion of an aquatic biomass in an area adjacent to a shield, creating a flow obstruction region. In some embodiments, a flow obstruction region is an area substantially free of aquatic biomass. In some embodiments, a shield obstructs at least a portion of an aquatic biomass from contacting one or more light intensity sensor.
[0112] In some embodiments, a shield comprises at least one wall. In some embodiments, a shield comprises at least one wall wherein the at least one wall bisects an aqueous liquid and/or at least a portion of an aquatic biomass. In some embodiments, at least one wall bisects an aqueous liquid and/or at least a portion of an aquatic biomass so that at least a portion of an aquatic biomass is dispersed from contacting a flow obstruction region.
[0113] In some embodiments, a shield comprises at least one wall wherein the at least one wall is curved, optionally u-shaped. In some embodiments, a shield comprises at least one wall wherein the at least one wall is straight. In some embodiments, a shield comprises at least one wall wherein the at least one wall extends laterally. In some embodiments, a shield comprises at least one wall, at least two walls, at least three walls, at least four walls, or more. In some embodiments, wherein the shield comprises more than one wall wherein said walls are contiguously connected to one another. In some embodiments, a shield comprises more than one wall, wherein said walls are affixed along a longitudinal axis. In some embodiments, the at least one wall comprises metal, plastic polymer, copper, galvanized iron, polyvinyl chloride (PVC), or combinations thereof.
[0114] In some embodiments, a shield comprises a base. In some embodiments, a shield comprises a base contiguously connected to at least one wall. In some embodiments, a shield comprises a base, wherein the base is affixed to at last one wall along a lateral axis. In some embodiments, the base comprises metal, plastic polymer, copper, galvanized iron, polyvinyl chloride (PVC), or combinations thereof.
[0115] In some embodiments, a shield comprises a vent. In some embodiments, a shield comprises a vent affixed into at least one wall. In some embodiments, a shield comprises a frame. In some embodiments, a shield comprises a frame configured to support one or more of: at least one wall, a base, one or more arms, one or more light intensity sensors, or combinations thereof. In some embodiments, the frame comprises metal, plastic polymer, copper, galvanized iron, polyvinyl chloride (PVC), or combinations thereof.
[0116] In some embodiments, one or more measurement devices comprises one or more arms. In some embodiments, one or more arms comprises configuration to support one or more light intensity sensors. In some embodiments, one or more measurement devices comprises one or more, two or more, or three or more arms. In some embodiments, the measurement device comprises more than one arm wherein each arm comprises configuration to support one or more light intensity sensors. In some embodiments, the one or more arms comprises metal, plastic polymer, copper, galvanized iron, polyvinyl chloride (PVC), or combinations thereof.
[0117] In some embodiments, a measurement device described herein comprises one or more light intensity sensors. In some embodiments, a measurement device described herein comprises one or more, two or more, three or more light intensity sensors. In some embodiments, the one or more light intensity sensors are one or more optical sensors. In some embodiments, the one or more optical sensors measure light intensity across a range of exposure levels, such as full sunlight, partial sunlight, partial shade, full shade, and partial darkness. In some embodiments, the device comprises a light source. In some embodiments, the one or more optical sensors are one or more light meters, one or more lux meters, one or more UV meter, one or more photosynthetically active radiation (PAR) sensor, one or more camera, or combinations thereof. In some embodiments, the one or more optical sensors measure photometric units. In some embodiments, the one or more optical sensors measure lumens per unit area. In some embodiments, the one or more optical sensors measure lux or lumens per square meter. In some embodiments, the one or more optical sensors comprise one or more lux meters. In some embodiments, the one or more optical sensors comprise one or more light meters. In some embodiments, the one or more optical sensors comprise one or more cameras. In some embodiments, the one or more cameras are a digital camera, non-digital camera, integrated camera, single camera, dual camera, timer-specific camera, or combinations thereof. In some embodiments, the one or more cameras have a depth of at least 8 bits per pixel. In some embodiments, the one or more cameras have a depth of about 8 bits to about 16 bits per pixel. In some embodiments, the one or more cameras have a depth of about 8 bits to about 12 bits per pixel. In some embodiments, the one or more cameras have a depth of about 10 bits to about 14 bits per pixel. In some embodiments, the one or more cameras have a depth of about 12 bits to about 16 bits per pixel. In some embodiments, the one or more cameras have a depth of about 8 bits, about 10 bits, about 12 bits, about 14 bits, or about 16 bits. In some embodiments, the one or more cameras have a depth of more than about 16 bits per pixel.
[0118] In some embodiments, the one or more optical sensors measure photometric units over a time interval. In some embodiments, the one or more optical sensors measure photometric units once over a time interval of about 30 seconds to about 10 minutes. In some embodiments, the one or more optical sensors measure photometric units once over a time interval of about 30 seconds to about 2 minutes. In some embodiments, the one or more optical sensors measure photometric units once over a time interval of about 1 minute to about 5 minutes. In some embodiments, the one or more optical sensors measure photometric units once over a time interval of about 4 minutes to about 10 minutes. In some embodiments, the one or more optical sensors measure photometric units once over a time interval of about 30 seconds, about 1 minute, about 3 minutes, about 5 minutes, about 7 minutes, about 9 minutes, or about 10 minutes. In some embodiments, the one or more optical sensors measure photometric units once over a time interval of less than about 30 seconds. In some embodiments, the one or more optical sensors measure photometric units once over a time interval of more than about 10 minutes. In some embodiments, the one or more optical sensors measure lumens per square meter from about 0 lux to about 75,000 lux. In some embodiments, the one or more optical sensors measure lumens per square meter from about 0 lux to about 30,000 lux. In some embodiments, the one or more optical sensors measure lumens per square meter from about 25,000 lux to about 50,000 lux. In some embodiments, the one or more optical sensors measure lumens per square meter from about 45,000 lux to about 75,000 lux. In some embodiments, the one or more optical sensors measure lumens per square meter of about 0 lux, about 10,000 lux, about 20,000 lux, about 25,000 lux, about 30,000 lux, about 40,000 lux, about 50,000 lux, about 60,000 lux, about 70,000 lux, about 75,000 lux. In some embodiments, the one or more optical sensors measure lumens per square meter of more than about 75,000 lux.
[0119] In some embodiments, the one or more optical sensors measure lumens per square meter at a temperature of about 1? C. to about 45? C. In some embodiments, the one or more optical sensors measure lumens per square meter at a temperature of about 1? ? C. to about 11? C. In some embodiments, the one or more optical sensors measure lumens per square meter at a temperature of about 10? ? C. to about 40? C. In some embodiments, the one or more optical sensors measure lumens per square meter at a temperature of about 30? C. to about 45? C. In some embodiments, the one or more optical sensors measure lumens per square meter at a temperature of about 0? C., about 5? C., about 10? C., about 15? C., about 20? C., about 25? C., about 30? C., about 35? C., about 40? C., about 45? C. In some embodiments, the one or more optical sensors measure lumens per square meter at a temperature of less than about 1? C. In some embodiments, the one or more optical sensors measure lumens per square meter at a temperature of more than about 45? C.
[0120] In some embodiments, the one or more optical sensors comprise one or more PAR sensor. In some embodiments, the one or more PAR sensor measures light absorption at 400 nanometers to 700 nanometers wavelength. In some embodiments, the one or more PAR sensor measures light absorption at about 400 nanometers, about 500 nanometers, or about 700 nanometers. In some embodiments, the one or more PAR sensor measures light absorption at less than about 400 nanometers wavelength. In some embodiments, the one or more PAR sensor measures light absorption at more than about 700 nanometers wavelength.
[0121] In some embodiments, the one or more optical sensors comprise one or more light intensity sensor. In some embodiments, the one or more light intensity sensor measures light absorption at 10 nanometers to 400 nanometers wavelength. In some embodiments, the one or more light intensity sensor measures light absorption at 400 nanometers to 700 nanometers wavelength. In some embodiments, the one or more light intensity sensor measures light absorption at 750 nanometers to 10,000 nanometers wavelength. In some embodiments, the one or more light intensity sensor measures light absorption at 10 nanometers to 500 nanometers wavelength. In some embodiments, the one or more light intensity sensor measures light absorption at 400 nanometers to 750 nanometers wavelength. In some embodiments, the one or more light intensity sensor measures light absorption at 700 nanometers to 10,000 nanometers wavelength. In some embodiments, the one or more light intensity sensor measures light absorption at about 10 nanometers, about 250 nanometers, about 400 nanometers, about 500 nanometers, about 700 nanometers, about 750 nanometers, about 1,000 nanometers, about 2,000 nanometers, about 3,000 nanometers, about 4,000 nanometers, about 5,000 nanometers, about 6,000 nanometers, about 7,000 nanometers, about 8,000 nanometers, about 9,000 nanometers, or about 10,000 nanometers. In some embodiments, the one or more light intensity sensor measures light absorption at more than about 10,000 nanometers wavelength.
[0122] In some embodiments, a light intensity sensor collects light intensity data in the region of which the light intensity sensor is placed. In some embodiments, one or more light intensity sensors is positioned to collect light intensity data from a comparator region. In some embodiments, one or more light intensity sensors is positioned to collect light intensity data from a biomass region. In some embodiments, one or more light intensity sensors is positioned to collect light intensity data from a flow obstruction region. In some embodiments wherein more than one light intensity sensor is used, and each of the more than one light intensity sensor collects light intensity data from the same region, it is said that a set of light intensity sensors are used. In some embodiments wherein two light intensity sensors are used, each light intensity sensor may collect light intensity data from a comparator region, a biomass region, a flow obstruction region, or combinations thereof. In some embodiments wherein three light intensity sensors are used, each light intensity sensor may collect light intensity data from a comparator region, a biomass region, or a flow obstruction region. In some embodiments, three or more light intensity sensors are used, wherein each light intensity sensor may collect light intensity data from a comparator region, a biomass region, or a flow obstruction region.
[0123] In some embodiments, the one or more light intensity sensors comprise configuration to communicate data measurements. In some embodiments, the one or more light intensity sensors comprise configuration to communicate data measurements to one or more processing units as described herein.
[0124] In some embodiments, the one or more light intensity sensors comprise configuration to be anchored to the bottom of the body of liquid. In some embodiments, the one or more light intensity sensors comprise configuration to float on the aqueous liquid. In some embodiments, the one or more light intensity sensors comprise configuration to be connected to each other via one or more arms. In some embodiments, the one or more light intensity sensors comprise configuration to be connected to a shield.
[0125] In some embodiments, the one or more measurement device comprises configuration to be anchored to the bottom of the body of liquid. In some embodiments, the one or more measurement device comprises configuration to float on the aqueous liquid.
[0126] In some embodiments, systems and methods described herein comprise more than one measurement device. In some embodiments, systems and methods described herein comprise one or more, two or more, three or more, four or more measurement devices. In some embodiments wherein more than one measurement device is used, each measurement device may be positioned in a different location in a body of liquid. Systems and methods for measuring an aquatic biomass described herein comprising one of one or more, two or more, three or more, or four or more measurement devices are as shown in
Further Embodiments
[0127] In further embodiments, the present invention and its embodiments relate to systems and method for measuring mat density of Lemna and for analyzing the distribution of Lemna, the crop health of Lemna, and the protein concentration of Lemna.
[0128] A first embodiment of the present invention describes a method to measure a mat density of Lemna. The method includes numerous process steps, such as: inserting a device at a location in a pond to obstruct a superficial flow of Lemna such that the Lemna compiles at an area upstream from the device. In examples, the pond is a raceway-shaped pond and the device is an obstruction mechanism. In preferred examples, the device is a mechanical obstruction mechanism. In other examples, the device may be a tube, a bar, a plate, or a combination thereof. In some examples, the device may float and in other examples, the device may be submerged. The method then includes: utilizing one or more sensors to determine a total surface area covered by the Lemna during a time period without taking physical samples, where a distribution of the Lemna over the total surface area depends on an amount of the Lemna such that similar amounts of the Lemna cover similar areas. Further, the total surface area covered by the Lemna depends on the amount of the Lemna. Additionally, the method includes measuring a total mat thickness and other parameters that used to assess total Lemna biomass, such as density of leaf tissue and optical characteristics, including leaf size and color. In some examples, one or more sensors comprises one or more optical sensors. In preferred examples, the one or more optical sensors comprise one or more cameras.
[0129] In some examples, the one or more sensors may be further configured to determine a distribution pattern of the Lemna into the device from when the device is inserted at the location until the Lemna has compiled behind the device and has reached a stable state covering a stable surface area.
[0130] In other examples, the one or more sensors may be further configured to determine a redistribution pattern of the Lemna when the device is removed.
[0131] In additional examples, the method may further include utilizing a first set of sensors located above the Lemna and water of the pond and a second set of sensors located in the water of the pond to measure a light intensity (lux) differential. In some examples, the first set of sensors and the second set of sensors comprise light sources that use specific wavelengths of the spectrum. In other examples, the first set of sensors and the second set of sensors comprise photosynthetically active radiation (PAR) sensors.
[0132] In some examples, a first subset of the first set of sensors and a first subset of the second set of sensors are located in the area upstream from the device. A second subset of the first set of sensors and a second subset of the second set of sensors are located in other locations in the pond. The first subset of the first set of sensors, the second subset of the first set of sensors, the first subset of the second set of sensors, and the second subset of the second set of sensors comprise configuration to capture one or more images to determine a decreasing density of the Lemna when it is compiling in the area upstream from the device and when the Lemna is redistributing on the surface of the pond. In examples, additional light sources (e.g., LED lights and/or lasers) may be used in combination with the aforementioned sensors to make the quantification more robust and less dependent on the solar output.
[0133] The method described herein may further include: determining a weight measurement of the Lemna in the total surface area, estimating a total amount of Lemna in the pond, and calculating a mat density of Lemna. Additional data points may also be incorporated into the calculation of the mat density of Lemna, such as: the distribution pattern, the redistribution pattern, the lux differential, and/or the decreasing density of the Lemna, among other data points not explicitly listed herein. Further, the method may include measuring the mat density of the Lemna using Normalized Difference Vegetation Index (NDVI) technology.
[0134] A second embodiment of the present invention describes a system to measure a mat density of Lemna. The system includes at least a mechanical obstruction mechanism and one or more sensors. In some examples, the one or more sensors comprise a first set of sensors located above the Lemna and water of the pond and a second set of sensors are located in the water of the pond. The second set of sensors may be underwater sensors located at varying depths in the water of the pond. In a first example, the first set of sensors and the second set of sensors comprise light sources that use specific wavelengths of the spectrum. In a second example, the first set of sensors and the second set of sensors comprise photosynthetically active radiation (PAR) sensors.
[0135] The mechanical obstruction mechanism is inserted at a location in a pond of water to obstruct a superficial flow of Lemna such that the Lemna compiles at an area upstream from the mechanical obstruction mechanism.
[0136] The one or more sensors comprise configuration to: determine a total surface area covered by the Lemna during a time period without taking physical samples, where a distribution of the Lemna over the total surface area depends on an amount of the Lemna such that similar amounts of the Lemna cover similar areas. Further, the one or more sensors comprise configuration to: determine a distribution pattern of the Lemna into the mechanical obstruction mechanism from when the mechanical obstruction mechanism is inserted at the location until the Lemna has compiled behind the mechanical obstruction mechanism and has reached a stable state covering a stable surface area and determine a redistribution pattern of the Lemna when the mechanical obstruction mechanism is removed.
[0137] In some examples, the first set of sensors and the second set of sensors comprise configuration to measure a light intensity (lux) differential. In another example, a first subset of the first set of sensors and a first subset of the second set of sensors are located in the area upstream from the device. A second subset of the first set of sensors and a second subset of the second set of sensors are located in other locations in the pond. The first subset of the first set of sensors, the second subset of the first set of sensors, the first subset of the second set of sensors, and the second subset of the second set of sensors comprise configuration to capture one or more images to determine a decreasing density of the Lemna when it is compiling in the area upstream from the device and when the Lemna is redistributing on the surface of the pond.
[0138] The system may comprise light sensors placed above the water surface and at the bottom of the pond with an additional obstruction device that will prevent Lemna mat forming above the sensor placed at the bottom of the pond. These sensors may be useful to quantify the amount of algae present in the water column. Correction for algae present in the water column may be useful in mat density calculations to increase the accuracy of the method.
[0139] Using the system, a weight measurement of the Lemna in the total surface area is determined, a total amount of Lemna in the pond is determined, and a mat density of the Lemna and a total protein content is calculated. Other data points may be incorporated into the determination of the mat density of the Lemna, such as: the distribution pattern, the redistribution pattern, the lux differential, and/or the decreasing density of the Lemna, among other data points not explicitly listed herein.
[0140] Duckweed belongs to the Lemnaceae family. The terms lemna and duckweed may be used interchangeably herein. Duckweed is composed of small-sized monocotyledon plants floating on the surface of stagnant or low water velocity pools, where water is rich in nutrients. The plant structure of duckweed is relatively simple, devoid of distinct roots, stalks or leaves. The worldwide spread of duckweed is due to its genetic adaptation, which leads to a wide variety of different species.
[0141] The Lemnaceae family includes four main families, namely Lemna, Spirodela, Wolffia and Wolfiella. About 40 species of duckweed have been inventoried worldwide in various aquatic environments. Duckweed displays fast reproduction through gemmation and absorbs large amounts of nutrients such as nitrogen (N) and phosphorus (P).
[0142] Under natural conditions, it is possible to see a mat or carpet of duckweed that explodes in a growth pattern. In fact, Lemna will distribute itself on the surface area of a pond towards where water current takes it, and where it will be easy for the floating biomass to go. The distribution of the total biomass is very unevenly spread over the total surface area of the pond, and distribution is not linear when total biomass in a pond varies, which complicates using samples from single or multiple spots as a reference for the estimation of total biomass.
[0143] Biotic and abiotic factors, such as water temperature, concentration of minerals in the water, water pH, incidence of sunlight, and mat density exert an effect on duckweed growth. Specifically, duckweed grows at temperatures as low as 1-3? C. and will survive light freezes and even continue to grow during the winter months. Duckweed growth is optimal at temperatures between 20 and 30? C. and the productivity/growth rate of the duckweed is negatively impacted. Below 17? C. some duckweeds show a decreasing rate of growth. Duckweed tolerates a wide range of pH (3.0-10.0), but displays optimum growth in a medium of 5.0-7.0.
[0144] Duckweed is being studied by researchers around the world as a possible source of clean energy and for biomanufacturing purposes. Duckweed is a good candidate as a biofuel because it grows rapidly, produces five to six times as much starch as corn per unit of area, and does not contribute to global warming.
[0145] For operational purposes, it is important to understand the quantity of Lemna in a pond system at a given point in time to properly manage the timing of harvest, dosing of nutrients and controlling other factors that influence productivity and quality of the crop. Further, as explained, Lemna will distribute itself on the surface area of a pond towards where water current takes it, and where it will be easy for floating biomass to go, which means that distribution of the total biomass is very unevenly spread over the total surface area of the pond, and distribution is not linear when total biomass in a pond varies, which complicates using samples from single or multiple spots as a reference for the estimation of total biomass.
[0146] Another exemplary method and a system to measure a mat density of Lemna are described and depicted in
[0147] It should be appreciated that the obstruction device 148 is inserted at a location in a pond 144 of water 146 to obstruct a superficial flow of Lemna 150 such that the Lemna 150 compiles at an area upstream from the obstruction device 148. In examples, the pond 144 comprises a raceway-shape. The Lemna 150 may be collected over an area upstream from the obstruction device 148.
[0148] The system also includes one or more sensors. As shown in
[0149] In a first example, the first set of sensors 154 and the second set of sensors 158 comprise light sources that use specific wavelengths of the spectrum. In a second example, the first set of sensors 154 and the second set of sensors 158 comprise photosynthetically active radiation (PAR) sensors. It should be appreciated that PAR sensors comprise configuration to measure photosynthetic light levels in both air and water and reports the Photosynthetic Photon Flux Density (PPFD), which corresponds to micromoles of photons per meter squared per second (umol m.sup.?2 s.sup.?1).
[0150] In general, the one or more sensors 154, and 158 of the system comprise configuration to: determine a total surface area covered by the Lemna 150 during a time period without taking physical samples. A distribution of the Lemna 150 over the total surface area depends on an amount of the Lemna 150 such that similar amounts of the Lemna 150 cover similar areas (e.g., more Lemna 150 covers a larger surface area than less Lemna 150). Further, the one or more sensors 154 and 158 comprise configuration to: determine a distribution pattern of the Lemna 150 into the obstruction device 148 from when the obstruction device 148 is inserted at the location until the Lemna 150 has compiled behind the obstruction device 148 and has reached a stable state covering a stable surface area. Furthermore, the one or more sensors 154 and 158 comprise configuration to: determine a redistribution pattern of the Lemna 150 when the obstruction device 148 is removed. The data points of the distribution pattern and/or the redistribution pattern may be incorporated into a determination of the mat density of the Lemna 150 to improve the accuracy of such determination.
[0151] In some examples, the first set of sensors 154 and the second set of sensors 158 comprise configuration to measure a light intensity (lux) differential. The natural ambient light will be fully captured by the first set of sensors 154. The light intensity captured by the second set of sensors 158 in the water 146 will determine a lower light intensity. The lux differential may also be incorporated into the determination of the mat density of the Lemna 150 to improve the accuracy of such determination.
[0152] In another example, a first subset 162 of the first set of sensors 154 and a first subset 164 of the second set of sensors 158 are located in the area upstream from the obstruction device 148. A second subset 166, 168 of the first set of sensors 154 and a second subset 170, 172 of the second set of sensors 158 are located in other locations in the pond 144. The first subset 162 of the first set of sensors 154, the second subset 166, 168 of the first set of sensors 154, the first subset 162 of the first set of sensors 154, and the second subset 170, 172 of the second set of sensors 158 comprise configuration to capture one or more images to determine a decreasing density of the Lemna 150 when it is compiling in the area upstream from the obstruction device 148 and when the Lemna 150 is redistributing on the surface of the pond 144. These data points may also be incorporated into the determination of the mat density of the Lemna 150.
[0153] Using the system described herein, since the Lemna 150 distribution takes place on an area of which the total surface area is known, actual weight measurements are taken to validate the consistency of the weight when Lemna 150 covers a certain area. The total surface area covered by the Lemna 150 when obstructed by the obstruction device 148 can therefore be used as a proxy to accurately estimate the total amount of the Lemna 150 in the pond 144. The mat density of the Lemna 150 may also be calculated. As described, other data points may be incorporated into the determination of the mat density of the Lemna 150.
[0154] In some implementations, the system may further utilize Normalized Difference Vegetation Index (NDVI) technology. As described herein, NDVI is a graphical indicator that can be used to analyze remote sensing measurements, assessing whether or not the target being observed contains live green vegetation. The local mat density may be measured using the NDVI technology to determine the reflection of near infrared light by the Lemna 150 on the surface 152, which can provide additional insight regarding density of the Lemna 150 in thicker areas of the total surface area where all of the Lemna 150 compiles behind the obstruction device 148. It should be appreciated that prior observations have shown that just the length of the Lemna 150 behind of the obstruction device 148 is an accurate indicator of total biomass given a constant water flow rate, and consistent biomass quality. However, accuracy can further be increased when a single density measurement just in front of the obstruction device 148 is taken, from where the Lemna mat generally shows a linear decline in mat density towards an end of the Lemna mat. Therefore, considering that the obstruction device 148 may always be placed in the same spot in a greenhouse, a spot sensor measuring the thickest area will be easy to implement and a source of consistent density measurements when the obstruction device 148 is in place.
[0155] In other examples, the present invention provides a technique for rapid superficial Lemna accumulation for harvesting. One of the challenges in harvesting the Lemna is to quickly remove large quantities of the Lemna from a pond system, without also removing a lot of water at the same time. The key in managing this is to maintain a high density of the Lemna at the location where harvesting takes place. During harvesting operations, a continuous supply of the Lemna over the surface of the water is necessary to keep densities of the Lemna high and to support continuous high harvesting rates. Increasing water flow rate contributes to faster superficial supply of the Lemna, but has limitations due to creation of waves, energy consumption, and decreasing effectiveness of the obstruction pipe. Also, the accumulation of very high densities makes the Lemna flow slower, because the thick mat starts to inhibit its own mobility and flow rate on the surface. Continuous supply of more moderate densities of the Lemna leads to higher amounts of the Lemna supplied to the target harvesting spot in the same time, and can be achieved by using water flow under the mat density that pulls the Lemna along. This water flow can be increased by using a simple, static underwater find mounted down vertically from the obstruction pipe or device, allowing more or less water flow in different areas where the obstruction pipe is blocking the Lemna. Using this technique, larger amounts of the Lemna can be supplied to spots where that is desired, without addition energy requirements or other mechanical (moving) adjustments.
EXAMPLES
[0156] The following examples are included for illustrative purposes only and are not intended to limit the scope of the invention.
Example 1: Aquatic Biomass Mat Density Measurement Device
[0157] A mat density measurement device (MDM device) was developed to calculate the mat density of growing Lemna. The MDM device included a shield and three light sensors as shown in
[0158] Without being bound by theory, it was contemplated that light intensity from above the aqueous liquid Lemna surface (A) decreased rapidly as it passed through the floating layer of Lemna minor (B) into the aqueous liquid column (C) because it was absorbed by Lemna minor pigments. The Absorption Coefficient was determined from establishing the light intensity differential between the Lemna minor covered aqueous liquid column (C) and the Lemna minor free aqueous liquid column (D) as shown in Equation 1. Mat Density was then correlated to the Absorption Coefficient (X) as shown in Equation 2 below where Z.sub.1 and Z.sub.2 were correlation coefficients obtained by fitting a line through a series of points (e.g., data points for weighted mat density and absorption coefficient). Equation 2 is below.
[0159] Once past the Lemna layer, light intensity still slowly decreased in the aqueous liquid column (C) due to multiple factors, such as algae. It was also contemplated that another intervening variable for optically determining biomass density was aqueous liquid turbidity measured in Lemna minor free aqueous liquid column (D). Accordingly, to generate a reliable model for establishing Lemna minor mat density, and to reduce noise, forward and reverse calibrations were carried out to generate correlation coefficientsZ.sub.1 and Z.sub.2.
Example 2: Forward Calibration of the Correlation Coefficients
[0160] To calibrate Equation 2, a forward calibration was performed in a watertight 22 m.sup.2 pond with a depth of about 10 cm to about 50 cm configured to hold aqueous liquid at a temperature of about 10? C. to about 40? C. at a pH of about 5 to about 7. A propulsion mechanism in the pond generated a circulating aqueous liquid flowing at a rate of about 0.01 meters/second to about 1 meter/second. Known amounts of weighed Lemna minor were added incrementally to the pond in 45 to 60 minute intervals until mat density reached about 1400 g/m.sup.2 (TABLE 3). Scheduled and actual inoculation time was recorded for each inoculation. While inoculated Lemna minor amounts were known (Actual Inoculation Amount (AIA)), the AIA (and therefore actual mat density) differed from the Target Inoculation Amount (TIA). To avoid deviating from the Target Running Amount (TRA), and therefore not measuring the mat densities planned, a New Target Inoculation Amount (NTAI) was calculated after each inoculation as shown in Equation 3 below where the Actual Running Amount (ARA) was calculated as the sum of the AIAs. Equation 3 is below.
[0161] Light intensity measurements were acquired 15 minutes after each inoculation (addition) of weighed Lemna minor to allow for even distribution of Lemna minor in the pond. Absorption coefficient values, or the amount of light absorbed by Lemna minor, was calculated using the light intensity measurements in Equation 1 and correlated to weighed mat density as seen in TABLE 3.
TABLE-US-00003 TABLE 3 Mat Density of Growing Aquatic Plant v. Absorption Coefficient Weighed Mat Density Absorption Coefficient (g/m.sup.2) (Au) 0 0.0 212 0.4 427 1.2 646 1.9 882 2.7 1110 3.6 1378 4.3
[0162] Weighed mat density (in g/m.sup.2) was plotted against absorption coefficient values (in absorption units or Au). As seen in
Example 3: Reverse Calibration of the Mat Density/Absorption Coefficient Curve
[0163] An MDM system was set up to identify the most optimal location for sensor placement. Multiple MDM devices were distributed in a 250 m.sup.2 running pond used for Lemna growth (
[0164] Each scheduled harvest had a Target Harvest Amount (THA) measured in grams. The Actual Harvest Amount (AHA) and therefore the actual mat densities would differ from the target, so these actual values were recorded. To avoid deviating from the Target Running Amount (TRA), and therefore not measuring the mat densities planned, a New Target Harvest Amount (NTHA) was calculated after each harvest as shown in Equation 4 below where the Actual Running Amount (ARA) is calculated as Starting Running Amount?Sum of AHAs. Equation 4 is below.
[0165] At each harvest, Lemna minor was temporarily blocked with a 4 inch or 6 inch polyvinyl chloride (PVC) pipe floated across the running pond flow. The time point at which the PVC pipe block was removed from the pond was recorded as the block release time. In between blocks and removals, the remaining Lemna minor was evenly distributed in the pond. Light intensity measurements were acquired 15 minutes after each block release time.
[0166] Data from each MDM device was used to calculate the absorption coefficient for each known amount of Lemna minor removed from the pond and the mean absolute error calculated (TABLE 4).
TABLE-US-00004 TABLE 4 Absorption Coefficients of MDM Devices 1 2, 3, and 5 Absorption MDM Device Coefficient MAE 1 517.9794 27 2 639.7212 40 3 453.6014 118 4 5 577.9511 66
[0167] The data from each device was collected and plotted (
Example 4: Protein Isolation and Purification
Example 4.1: Workflow A
[0168] One kg of fresh Lemna minor was macerated in a Vitamix Blender (Vitamix Corp, Cleveland, Ohio) in a ratio of 1:1 with a sodium carbonate buffer containing 0.3% w/v sodium bisulfite. The extraction was performed for 3 minutes at medium speed setting maintaining the temperature at less than 30? C. Subsequently, the macerated biomass was filtered by using a nylon straining bag (Natural Home Brands, Sun Valley, California) with a fine mesh to separate the fibrous high solids cake from the liquid juice containing the soluble protein. The filtered homogenate was then centrifuged for 10 minutes at a speed/force of 4000 g (Allegra X15R, SX4750 rotor; Beckman Coulter, Inc., Pasadena, California). The pellet was discarded, and the supernatant was collected separately. The solution was heated to a temperature of 50? C. in a aqueous liquid bath that was set at a temperature of 55? C. and was cooled rapidly to a temperature less than 15? C. after reaching the target temperature. Following the rapid cooling of the protein solution, 2% v/v of activated chitosan and 4% w/v of activated carbon (Cabot Norit Americas Inc, Marshall, Texas) is added to the liquid juice. The solution was subsequently stirred for 5 minutes after which the solution was centrifuged for 10 minutes at a speed/force of 5000 g (Allegra X15R, SX4750 rotor; Beckman Coulter, Inc., Pasadena, California). The green pellet in the centrifuge bottle was discarded, and the clear yellow supernatant was micro filtered using a 0.7 pm Glass Micro fiber membrane (Whatman 1825-047 Glass Microfiber Binder Free Filter, 0.7 Micron; Global Life Sciences Solutions USA LLC, Marlborough, Massachusetts). The filtrate was subsequently exposed to a 0.2 pm polyethersulfone membrane (Polyethersulfone (PES) Membrane Filters, 0.2 Micron; Sterlitech Corporation Inc, Kent, Washington) to remove the remainder of the undesired particles including bacteria. The obtained pale yellow and deodorized proteinaceous solution was then concentrated using a 70 kDa membrane (MINIKROS? S02-E070-05-N; Spectrum Laboratories, Inc., Rancho Dominguez, California). The concentrated solution obtained was subsequently freeze dried (Harvest Right LLC, Salt Lake City, Utah) and the result was a white, odorless and soluble protein powder.
Example 4.2: Workflow B
[0169] One kg of fresh Lemna minor was macerated using a Vitamix Blender (Vitamix Corp, Cleveland, Ohio) in a ratio of 1:1 with a potassium phosphate buffer containing 0.3% w/v ascorbic acid. The maceration was performed for a period of 3 minutes at medium speed in order to maintain a temperature of less than 30? C. The lysed biomass was filtered by using a nylon straining bag (Natural Home Brands, Sun Valley, California) with a fine mesh to separate the fibrous high solids cake from the liquid juice containing the soluble protein. The filtered homogenate was then centrifuged for 10 minutes at a speed/force of 4000 g (Allegra X15R, SX4750 rotor; Beckman Coulter, Inc., Pasadena, California). The pellet was discarded, and the supernatant was collected separately. The supernatant was then mixed with 5% v/v of activated chitosan (Chitosan (10-120 cps), fungal origin (9012-76-4); Glentham Life Sciences Ltd., Corsham, Wiltshire, UK) and 10% w/v of activated carbon (Cabot Norit Americas Inc, Marshall, Texas) for a period of 5 minutes. Subsequently the mixed solution was centrifuged at a speed/force of 5000 g for 10 minutes (Allegra X15R, SX4750 rotor; Beckman Coulter, Inc., Pasadena, California). The obtained pellet was discarded, and the deodorized and decolored supernatant was microfiltered using a 0.2 pm polyethersulfone membrane (Polyethersulfone (PES) Membrane Lilters, 0.2 Micron; Sterlitech Corporation Inc, Kent, Washington). The obtained pale yellow and deodorized proteinaceous solution was then concentrated using a 70 kDa membrane (MINIKROS? S02-E070-05-N; Spectrum Laboratories, Inc., Rancho Dominguez, California). The concentrated solution obtained was subsequently freeze dried (Harvest Right LLC, Salt Lake City, Utah) and the result was a white, odorless and soluble protein powder.
Example 4.3: Workflow C
[0170] One kg of fresh Lemna minor was macerated using a Vitamix Blender (Vitamix Corp, Cleveland, Ohio) in a ratio of 1:1 with distilled aqueous liquid containing 0.3% w/v of sodium bisulfite and ascorbic acid. The maceration was performed for a period of 3 minutes at medium speed in order to maintain a temperature of less than 30? C. The lysed biomass was filtered by using a nylon straining bag (Natural Home Brands, Sun Valley, California) with a fine mesh to separate the fibrous high solids cake from the liquid juice containing the soluble protein. The filtered homogenate was then centrifuged for 10 minutes at a speed/force of 4000 g. The pellet was discarded, and the supernatant was collected separately. The supernatant was then mixed with a solution containing 30 mM of potassium phosphate and 20 mM of calcium chloride for a period of 5 minutes. Subsequently the mixed solution was centrifuged at a speed/force of 5000 g for 10 minutes (Allegra X15R, SX4750 rotor; Beckman Coulter, Inc., Pasadena, California). The obtained pellet was discarded. 5% w/v of activated carbon (Cabot Norit Americas Inc, Marshall, Texas) was added to the supernatant, and the solution was stirred for 5 minutes. Subsequently, the mixed solution containing the activated carbon was micro filtered using a 0.2 pm polyethersulfone membrane filter (Polyethersulfone (PES) Membrane Filters, 0.2 Micron; Sterlitech Corporation Inc, Kent, Washington) in order to remove the activated carbon that had adsorbed the remaining chlorophyll, polyphenol and other unwanted taste/color/odor impacting particles. The obtained pale yellow and deodorized proteinaceous solution was then concentrated using a 100 kDa membrane (Hollow Fiber Cartridge, 100,000 NMWC, 850 cm2; GE Healthcare Bio-Sciences Corp, Westborough, Massachusetts). The concentrated solution obtained was subsequently freeze dried and the result was a white, odorless and soluble protein powder.
Example 4.4: Workflow D
[0171] One kg of fresh Lemna minor was macerated using a Vitamix Blender (Vitamix Corp, Cleveland, Ohio) in a ratio of 1:1 with distilled aqueous liquid containing 0.5% w/v of sodium bisulfite. The maceration was performed for a period of 3 minutes at medium speed in order to maintain a temperature of less than 30? C. The lysed biomass was filtered by using a nylon straining bag (Natural Home Brands, Sun Valley, California) with a fine mesh to separate the fibrous high solids cake from the liquid juice containing the soluble protein. The filtered homogenate was then centrifuged for 10 minutes at a speed/force of 4000 g (Allegra X15R, SX4750 rotor; Beckman Coulter, Inc., Pasadena, California). The pellet was discarded, and the supernatant was collected separately. The supernatant was then mixed with a solution containing 30 mM of potassium phosphate and 20 mM of calcium chloride for a period of 5 minutes. Subsequently the mixed solution was centrifuged at a speed/force of 5000 g for 10 minutes (Allegra X15R, SX4750 rotor; Beckman Coulter, Inc., Pasadena, California). The obtained pellet was discarded. 2% w/v of activated chitosan (Chitosan (10-120 cps), fungal origin (9012-76-4); Glentham Life Sciences Ltd., Corsham, Wiltshire, UK) and 4% of activated carbon (Cabot Norit Americas Inc, Marshall, Texas) were added to the supernatant, and the solution was stirred for 5 minutes. Subsequently the mixed solution was centrifuged at a speed/force of 5000 g for 10 minutes (Allegra X15R, SX4750 rotor; Beckman Coulter, Inc., Pasadena, California). The obtained pellet was discarded, and the deodorized and decolored supernatant was microfiltered using a 0.7 pm polyethersulfone membrane (Whatman 1825-047 Glass Microfiber Binder Free Filter, 0.7 Micron; Global Life Sciences Solutions USA LLC, Marlborough, Massachusetts). The filtrate was then further microfiltered using a 0.2 pm polyethersulfone membrane (Polyethersulfone (PES) Membrane Filters, 0.2 Micron; Sterlitech Corporation Inc, Kent, Washington). The obtained pale yellow and deodorized proteinaceous solution was then concentrated using a 70 kDa membrane (MINIKROS? S02-E070-05-N; Spectrum Laboratories, Inc., Rancho Dominguez, California). The concentrated solution obtained was subsequently freeze dried (Harvest Right LLC, Salt Lake City, Utah) and the result was a white, odorless and soluble protein powder.
Example 4.5: Purity Analysis from Workflows A-D
[0172] The average purity of the protein preparations prepared by the methods of Workflows A-D was about 84.3% and the concentration of soluble protein after ultrafiltration was 1,316 pg/mL. The foaming capacity achieved was 195% and maintained a 92% stability after 1 hour. Gelation properties of the freeze-dried material were validated, and only 2% w/v of freeze-dried material was needed to be added in order to form a gel.
[0173] While preferred embodiments of the present invention have been shown and described herein, it will be obvious to those skilled in the art that such embodiments are provided by way of example only. Numerous variations, changes, and substitutions will now occur to those skilled in the art without departing from the invention. It should be understood that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention. It is intended that the following claims define the scope of the invention and that methods and structures within the scope of these claims and their equivalents be covered thereby.